Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1201
Gene name
LocationContig_1258:2934..4359
Strand-
Gene length (bp)1425
Transcript length (bp)1149
Coding sequence length (bp)1149
Protein length (aa) 383

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00891 Methyltransf_2 O-methyltransferase domain 1.2E-28 160 360

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 1 382 3.0E-90
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 1 382 2.0E-89
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 52 354 1.0E-34
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 52 354 2.0E-34
sp|Q9LEL6|6OMT_COPJA (RS)-norcoclaurine 6-O-methyltransferase OS=Coptis japonica PE=1 SV=1 54 365 4.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 1 382 3.0E-90
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 1 382 2.0E-89
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 52 354 1.0E-34
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 52 354 2.0E-34
sp|Q9LEL6|6OMT_COPJA (RS)-norcoclaurine 6-O-methyltransferase OS=Coptis japonica PE=1 SV=1 54 365 4.0E-25
sp|A1DA61|FTMD_NEOFI 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmMT PE=3 SV=1 18 367 7.0E-24
sp|Q4WAW6|FTMD_ASPFU 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmMT PE=1 SV=1 42 367 1.0E-23
sp|B9WZX2|FTMD_ASPFM 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata GN=ftmMT PE=1 SV=1 42 367 6.0E-23
sp|Q6WUC1|6OMT_PAPSO (RS)-norcoclaurine 6-O-methyltransferase OS=Papaver somniferum GN=6OMT PE=1 SV=1 54 360 1.0E-21
sp|Q8GSN1|MOMT_CATRO Myricetin O-methyltransferase OS=Catharanthus roseus PE=1 SV=1 51 360 2.0E-21
sp|O04385|IEMT_CLABR (Iso)eugenol O-methyltransferase OS=Clarkia breweri GN=IEMT1 PE=1 SV=2 42 361 2.0E-21
sp|Q6T1F6|BMT_AMMMJ Bergaptol O-methyltransferase OS=Ammi majus GN=BMT PE=1 SV=1 42 361 6.0E-21
sp|Q9FK25|OMT1_ARATH Flavone 3'-O-methyltransferase 1 OS=Arabidopsis thaliana GN=OMT1 PE=1 SV=1 42 361 8.0E-21
sp|B0EXJ8|HTOMT_CATRO Tabersonine 16-O-methyltransferase OS=Catharanthus roseus GN=16OMT PE=1 SV=1 52 366 9.0E-21
sp|A8J6X1|BMT_GLELI Bergaptol O-methyltransferase OS=Glehnia littoralis GN=BMT PE=1 SV=1 54 361 2.0E-20
sp|Q6T1F5|COMT1_AMMMJ Caffeic acid 3-O-methyltransferase OS=Ammi majus GN=COMT PE=1 SV=1 42 361 3.0E-20
sp|P42712|DMPM_STRAD O-demethylpuromycin-O-methyltransferase OS=Streptomyces alboniger GN=dmpM PE=3 SV=1 81 377 7.0E-20
sp|Q84KK5|D7OMT_GLYEC Isoflavone 7-O-methyltransferase OS=Glycyrrhiza echinata GN=D7OMT PE=1 SV=1 54 361 1.0E-19
sp|Q9XGV9|COMT2_OCIBA Caffeic acid 3-O-methyltransferase 2 OS=Ocimum basilicum GN=COMT2 PE=2 SV=1 161 361 2.0E-19
sp|C7SDN9|N7OMT_PAPSO Norreticuline-7-O-methyltransferase OS=Papaver somniferum PE=1 SV=1 166 360 3.0E-19
sp|Q9FQY8|COMT1_CAPAN Caffeic acid 3-O-methyltransferase OS=Capsicum annuum GN=COMT PE=2 SV=2 42 360 5.0E-19
sp|Q43047|COMT3_POPKI Caffeic acid 3-O-methyltransferase 3 OS=Populus kitakamiensis GN=HOMT3 PE=3 SV=1 42 382 7.0E-19
sp|P93324|CHOMT_MEDSA Isoliquiritigenin 2'-O-methyltransferase OS=Medicago sativa PE=1 SV=1 52 360 1.0E-18
sp|Q8GU25|COMT1_ROSCH Caffeic acid 3-O-methyltransferase OS=Rosa chinensis GN=COMT1 PE=2 SV=1 161 361 1.0E-18
sp|Q86I40|OMT4_DICDI O-methyltransferase 4 OS=Dictyostelium discoideum GN=omt4 PE=3 SV=1 74 382 2.0E-18
sp|Q54GZ0|OMT9_DICDI O-methyltransferase 9 OS=Dictyostelium discoideum GN=omt9 PE=3 SV=1 74 382 2.0E-18
sp|O22308|7OMT6_MEDSA Isoflavone-7-O-methyltransferase 6 OS=Medicago sativa PE=2 SV=1 53 361 2.0E-18
sp|P59049|OMT1_CHRAE Quercetin 3-O-methyltransferase 1 OS=Chrysosplenium americanum GN=OMT1 PE=1 SV=1 42 361 2.0E-18
sp|Q9XGW0|COMT1_OCIBA Caffeic acid 3-O-methyltransferase 1 OS=Ocimum basilicum GN=COMT1 PE=2 SV=1 161 361 3.0E-18
sp|Q7XB11|4OMT1_PAPSO 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase 1 OS=Papaver somniferum GN=4'OMT1 PE=2 SV=1 54 365 4.0E-18
sp|O24529|7OMT8_MEDSA Isoflavone-7-O-methyltransferase 8 OS=Medicago sativa PE=1 SV=1 53 361 4.0E-18
sp|Q43046|COMT1_POPKI Caffeic acid 3-O-methyltransferase 1 OS=Populus kitakamiensis GN=HOMT1 PE=3 SV=1 42 382 4.0E-18
sp|Q8W013|COMT1_CATRO Caffeic acid 3-O-methyltransferase OS=Catharanthus roseus GN=COMT1 PE=2 SV=1 161 361 4.0E-18
sp|Q7XB10|4OMT2_PAPSO 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase 2 OS=Papaver somniferum GN=4'OMT2 PE=1 SV=1 54 365 5.0E-18
sp|Q00763|COMT1_POPTM Caffeic acid 3-O-methyltransferase 1 OS=Populus tremuloides GN=OMT1 PE=1 SV=1 161 382 5.0E-18
sp|O22309|7OMT9_MEDSA Isoflavone-7-O-methyltransferase 9 OS=Medicago sativa PE=2 SV=1 53 361 7.0E-18
sp|Q9LEL5|4OMT_COPJA 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase OS=Coptis japonica PE=1 SV=1 54 360 9.0E-18
sp|B6VJS4|ROMT_VITVI Trans-resveratrol di-O-methyltransferase OS=Vitis vinifera GN=ROMT PE=1 SV=2 53 360 1.0E-17
sp|Q42653|OMT2_CHRAE Quercetin 3-O-methyltransferase 2 OS=Chrysosplenium americanum GN=OMT2 PE=1 SV=1 161 361 1.0E-17
sp|Q43609|COMT1_PRUDU Caffeic acid 3-O-methyltransferase OS=Prunus dulcis GN=COMT1 PE=2 SV=1 42 361 2.0E-17
sp|O81646|COMT1_CAPCH Caffeic acid 3-O-methyltransferase OS=Capsicum chinense GN=COMT PE=2 SV=1 161 356 3.0E-17
sp|Q43239|COMT1_ZINVI Caffeic acid 3-O-methyltransferase OS=Zinnia violacea PE=2 SV=1 161 361 7.0E-17
sp|P28002|COMT1_MEDSA Caffeic acid 3-O-methyltransferase OS=Medicago sativa PE=1 SV=1 161 372 8.0E-17
sp|Q54B59|OMT12_DICDI O-methyltransferase 12 OS=Dictyostelium discoideum GN=omt12 PE=1 SV=1 221 370 1.0E-16
sp|Q41086|COMT2_POPTM Caffeic acid 3-O-methyltransferase 2 OS=Populus tremuloides GN=OMT2 PE=3 SV=1 161 382 1.0E-16
sp|A8QW52|OMT1_SORBI Eugenol O-methyltransferase OS=Sorghum bicolor GN=EOMT PE=1 SV=1 159 369 1.0E-16
sp|Q8LL87|COMT1_COFCA Caffeic acid 3-O-methyltransferase OS=Coffea canephora PE=2 SV=1 161 373 3.0E-16
sp|Q38J50|FOMT2_WHEAT Tricetin 3',4',5'-O-trimethyltransferase OS=Triticum aestivum GN=OMT2 PE=1 SV=1 42 360 5.0E-16
sp|O23760|COMT1_CLABR Caffeic acid 3-O-methyltransferase OS=Clarkia breweri GN=COMT PE=1 SV=1 221 361 6.0E-16
sp|C6TAY1|SOMT2_SOYBN Flavonoid 4'-O-methyltransferase OS=Glycine max PE=1 SV=1 89 368 2.0E-15
sp|Q8HZJ0|ASMT_MACMU Acetylserotonin O-methyltransferase OS=Macaca mulatta GN=ASMT PE=2 SV=1 217 361 2.0E-15
sp|Q54S95|OMT7_DICDI O-methyltransferase 7 OS=Dictyostelium discoideum GN=omt7 PE=3 SV=1 221 382 3.0E-15
sp|O24305|M3OM1_PEA (+)-6a-hydroxymaackiain 3-O-methyltransferase 1 OS=Pisum sativum GN=HMM1 PE=1 SV=1 53 360 4.0E-15
sp|P46484|COMT1_EUCGU Caffeic acid 3-O-methyltransferase OS=Eucalyptus gunnii GN=OMT PE=2 SV=1 42 361 5.0E-15
sp|B0CN39|SFMM3_STRLA O-methyltransferase SfmM3 OS=Streptomyces lavendulae GN=sfmM3 PE=3 SV=1 75 367 2.0E-14
sp|Q93WU2|EOMT1_OCIBA Eugenol O-methyltransferase OS=Ocimum basilicum GN=EOMT1 PE=1 SV=1 53 361 2.0E-14
sp|P16559|TCMN_STRGA Multifunctional cyclase-dehydratase-3-O-methyl transferase TcmN OS=Streptomyces glaucescens GN=tcmN PE=1 SV=2 75 376 2.0E-14
sp|P45986|IMT1_MESCR Inositol 4-methyltransferase OS=Mesembryanthemum crystallinum GN=IMT1 PE=1 SV=1 67 365 3.0E-14
sp|P46597|ASMT_HUMAN Acetylserotonin O-methyltransferase OS=Homo sapiens GN=ASMT PE=1 SV=1 221 361 3.0E-14
sp|O95671|ASML_HUMAN N-acetylserotonin O-methyltransferase-like protein OS=Homo sapiens GN=ASMTL PE=1 SV=3 41 366 4.0E-14
sp|Q06509|COMT1_MAIZE Caffeic acid 3-O-methyltransferase OS=Zea mays PE=3 SV=1 217 360 1.0E-13
sp|Q6VMW0|Q8OMT_MENPI 8-hydroxyquercetin 8-O-methyltransferase OS=Mentha piperita GN=OMT2 PE=1 SV=1 221 360 4.0E-13
sp|O82054|COMT1_SACOF Caffeic acid 3-O-methyltransferase OS=Saccharum officinarum GN=COMT PE=2 SV=1 42 360 4.0E-13
sp|Q9SWC2|COMT1_EUCGL Caffeic acid 3-O-methyltransferase (Fragment) OS=Eucalyptus globulus GN=COMT1 PE=3 SV=1 161 347 5.0E-13
sp|Q7XXD4|METL_ORYSJ Probable inactive methyltransferase Os04g0175900 OS=Oryza sativa subsp. japonica GN=Os04g0175900 PE=1 SV=2 217 376 1.0E-12
sp|Q39522|SMT_COPJA (S)-scoulerine 9-O-methyltransferase OS=Coptis japonica GN=SMT PE=1 SV=1 221 360 2.0E-12
sp|Q93WU3|CVMT1_OCIBA Chavicol O-methyltransferase OS=Ocimum basilicum GN=CVOMT1 PE=1 SV=1 53 360 3.0E-12
sp|P10950|ASMT_BOVIN Acetylserotonin O-methyltransferase OS=Bos taurus GN=ASMT PE=1 SV=2 220 361 3.0E-12
sp|A9X7L0|ANMT_RUTGR Anthranilate N-methyltransferase OS=Ruta graveolens PE=1 SV=1 58 361 4.0E-12
sp|A8QW51|OMT2_SORBI Probable O-methyltransferase 2 OS=Sorghum bicolor GN=OMT2 PE=2 SV=1 194 360 4.0E-12
sp|Q8T638|DMTA_DICDI Des-methyl DIF-1 methyltransferase A OS=Dictyostelium discoideum GN=dmtA PE=1 SV=1 221 382 5.0E-12
sp|P0DH60|M3OM2_PEA (+)-6a-hydroxymaackiain 3-O-methyltransferase 2 OS=Pisum sativum GN=HMM2 PE=1 SV=1 53 360 9.0E-12
sp|Q29U70|I4OMT_MEDTR Isoflavone 4'-O-methyltransferase OS=Medicago truncatula GN=HI4'OMT PE=1 SV=1 53 365 1.0E-11
sp|Q6WUC2|7OMT_PAPSO (R,S)-reticuline 7-O-methyltransferase OS=Papaver somniferum GN=7OMT PE=1 SV=1 221 367 1.0E-11
sp|A8QW53|OMT3_SORBI 5-pentadecatrienyl resorcinol O-methyltransferase OS=Sorghum bicolor GN=OMT3 PE=1 SV=1 25 361 2.0E-11
sp|Q0IP69|NOMT_ORYSJ Naringenin 7-O-methyltransferase OS=Oryza sativa subsp. japonica GN=Os12g0240900 PE=1 SV=2 238 369 2.0E-11
sp|Q55216|DNRK_STRS5 Carminomycin 4-O-methyltransferase DauK OS=Streptomyces sp. (strain C5) GN=dauK PE=1 SV=1 74 380 7.0E-11
sp|B1P123|BX7_MAIZE TRIBOA-glucoside O-methyltransferase BX7 OS=Zea mays GN=BX7 PE=1 SV=1 199 361 1.0E-10
sp|D3KU66|ASMT_MOUSE Acetylserotonin O-methyltransferase OS=Mus musculus GN=Asmt PE=2 SV=1 221 360 1.0E-10
sp|D3KU67|ASMT_MUSMM Acetylserotonin O-methyltransferase OS=Mus musculus molossinus GN=Asmt PE=2 SV=1 221 360 1.0E-10
sp|Q06528|DNRK_STRPE Carminomycin 4-O-methyltransferase DnrK OS=Streptomyces peucetius GN=dnrK PE=1 SV=2 74 380 5.0E-10
sp|Q6ZD89|OMT1_ORYSJ Flavone 3'-O-methyltransferase 1 OS=Oryza sativa subsp. japonica GN=ROMT-9 PE=1 SV=1 245 360 1.0E-09
sp|B8RCD3|AIMT1_PIMAN Trans-anol O-methyltransferase 1 OS=Pimpinella anisum GN=AIMT1 PE=1 SV=1 40 360 2.0E-09
sp|Q92056|ASMT_CHICK Acetylserotonin O-methyltransferase OS=Gallus gallus GN=ASMT PE=2 SV=1 59 361 2.0E-09
sp|Q54FP4|OMT10_DICDI O-methyltransferase 10 OS=Dictyostelium discoideum GN=omt10 PE=3 SV=2 270 368 9.0E-09
sp|B4XY98|AZIB2_STREG 3-hydroxy-5-methyl-1-naphthoate 3-O-methyltransferase OS=Streptomyces sahachiroi GN=aziB2 PE=1 SV=1 221 351 1.0E-08
sp|Q84N28|FOMT1_WHEAT Flavone O-methyltransferase 1 OS=Triticum aestivum GN=OMT1 PE=1 SV=1 42 361 2.0E-08
sp|B3GSH5|ASMT_RAT Acetylserotonin O-methyltransferase OS=Rattus norvegicus GN=Asmt PE=1 SV=1 221 360 3.0E-08
sp|P47917|ZRP4_MAIZE O-methyltransferase ZRP4 OS=Zea mays GN=ZRP4 PE=2 SV=1 200 359 5.0E-08
sp|Q84HC8|NCSB1_STRCZ 2,7-dihydroxy-5-methyl-1-naphthoate 7-O-methyltransferase OS=Streptomyces carzinostaticus GN=ncsB1 PE=1 SV=1 271 366 8.0E-08
sp|Q54B60|OMT11_DICDI Probable inactive O-methyltransferase 11 OS=Dictyostelium discoideum GN=omt11 PE=3 SV=1 221 364 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008171 O-methyltransferase activity Yes
GO:0008168 methyltransferase activity No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.7293 0.3227 0.0194 0.0652 0.0628 0.0369 0.3544 0.3264 0.4329 0.0173

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup30
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7767
Ophiocordyceps australis 1348a (Ghana) OphauG2|7346
Ophiocordyceps australis 1348a (Ghana) OphauG2|7110
Ophiocordyceps australis 1348a (Ghana) OphauG2|4885
Ophiocordyceps australis 1348a (Ghana) OphauG2|4306
Ophiocordyceps australis 1348a (Ghana) OphauG2|3956
Ophiocordyceps australis 1348a (Ghana) OphauG2|1539
Ophiocordyceps australis 1348a (Ghana) OphauG2|1895
Ophiocordyceps australis 1348a (Ghana) OphauG2|266
Ophiocordyceps australis map64 (Brazil) OphauB2|758
Ophiocordyceps australis map64 (Brazil) OphauB2|1462
Ophiocordyceps australis map64 (Brazil) OphauB2|2012
Ophiocordyceps australis map64 (Brazil) OphauB2|4017
Ophiocordyceps australis map64 (Brazil) OphauB2|4564
Ophiocordyceps australis map64 (Brazil) OphauB2|7299
Ophiocordyceps camponoti-rufipedis Ophun1|2861
Ophiocordyceps camponoti-rufipedis Ophun1|2000
Ophiocordyceps subramaniannii Hirsu2|8115
Ophiocordyceps subramaniannii Hirsu2|7926
Ophiocordyceps subramaniannii Hirsu2|6259
Ophiocordyceps subramaniannii Hirsu2|2878
Ophiocordyceps subramaniannii Hirsu2|1201 (this protein)
Ophiocordyceps subramaniannii Hirsu2|11082

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1201
METALAPIRALAQTADAAGRLALLRALRQVQTELQSPTDTLMEIVNQAPLLASLRLGIDLGLFRTLADRGSVMSL
AQLAESCGASPQLLERFLRYYAANDVVEEVDVRQYKATSLTRVVADPKGTAMISHIFDTHAPTFQAMPGFFAEKG
YREIGSSTETPFQKAFKTDLGAFDWMARHPEQRESLQTVMTTLEGSAWADGLAVLEDAVQAAPAAGGRTFLVDVG
GGRGHQCVQLGRKFPSLLGRLVVQDLPEVVDGLPATDGVRAEAHDFFDEQPVAGASFYYLRRVLHDWPDGDCVRI
LDRIAGAMAADSRILVDEVVLPDRGAPCQAAMADLAMMVAMGGKERTEQQWRALAESSGLRVDEIHTYMASTCTS
VVVLARK*
Coding >Hirsu2|1201
ATGGAGACCGCCCTCGCGCCGATCCGCGCCCTGGCCCAGACGGCGGACGCGGCCGGCCGGCTGGCGCTGCTGCGG
GCCCTGCGCCAGGTGCAGACGGAGCTGCAGAGCCCGACGGACACGCTCATGGAGATTGTGAACCAGGCCCCGCTC
CTCGCATCCCTCCGGCTGGGCATAGACCTCGGCCTCTTCCGGACGCTGGCCGACCGCGGCTCCGTCATGAGCCTG
GCCCAGCTGGCCGAGTCCTGCGGAGCCTCGCCTCAGCTTCTGGAGCGCTTCCTTCGCTACTACGCGGCCAACGAC
GTGGTCGAGGAAGTGGACGTCCGTCAGTACAAGGCGACCAGCCTGACTCGTGTGGTCGCGGACCCCAAGGGGACG
GCCATGATTTCTCACATATTTGATACGCACGCGCCCACCTTCCAGGCCATGCCCGGCTTCTTCGCGGAGAAGGGG
TACCGGGAGATCGGCAGCAGCACCGAGACGCCGTTCCAGAAGGCCTTCAAGACCGACCTGGGCGCCTTCGACTGG
ATGGCCCGGCACCCGGAGCAGCGGGAGTCTCTGCAGACGGTCATGACGACCCTGGAGGGGTCCGCGTGGGCCGAC
GGACTGGCCGTGCTCGAGGACGCGGTCCAAGCCGCTCCTGCGGCCGGGGGGAGGACGTTCCTCGTCGACGTCGGG
GGAGGACGCGGCCACCAGTGCGTCCAGCTGGGGCGCAAGTTCCCGAGCCTGCTGGGACGGCTCGTCGTCCAAGAC
CTGCCCGAGGTCGTGGACGGGCTGCCTGCCACGGACGGGGTTCGAGCCGAGGCGCACGACTTTTTCGACGAACAG
CCCGTCGCCGGCGCCAGCTTCTACTACCTGCGCCGCGTCCTGCACGACTGGCCCGACGGCGACTGCGTCAGGATC
TTGGACAGGATTGCCGGCGCCATGGCCGCCGACTCCCGCATCCTCGTCGACGAGGTTGTCTTGCCCGACAGGGGC
GCTCCGTGCCAGGCGGCCATGGCCGATCTGGCCATGATGGTGGCCATGGGCGGCAAGGAGCGGACGGAGCAGCAG
TGGCGGGCCCTGGCCGAGAGCTCCGGCCTGCGCGTCGACGAGATCCATACGTACATGGCTTCCACATGCACCTCG
GTCGTTGTCTTGGCGCGGAAGTAG
Transcript >Hirsu2|1201
ATGGAGACCGCCCTCGCGCCGATCCGCGCCCTGGCCCAGACGGCGGACGCGGCCGGCCGGCTGGCGCTGCTGCGG
GCCCTGCGCCAGGTGCAGACGGAGCTGCAGAGCCCGACGGACACGCTCATGGAGATTGTGAACCAGGCCCCGCTC
CTCGCATCCCTCCGGCTGGGCATAGACCTCGGCCTCTTCCGGACGCTGGCCGACCGCGGCTCCGTCATGAGCCTG
GCCCAGCTGGCCGAGTCCTGCGGAGCCTCGCCTCAGCTTCTGGAGCGCTTCCTTCGCTACTACGCGGCCAACGAC
GTGGTCGAGGAAGTGGACGTCCGTCAGTACAAGGCGACCAGCCTGACTCGTGTGGTCGCGGACCCCAAGGGGACG
GCCATGATTTCTCACATATTTGATACGCACGCGCCCACCTTCCAGGCCATGCCCGGCTTCTTCGCGGAGAAGGGG
TACCGGGAGATCGGCAGCAGCACCGAGACGCCGTTCCAGAAGGCCTTCAAGACCGACCTGGGCGCCTTCGACTGG
ATGGCCCGGCACCCGGAGCAGCGGGAGTCTCTGCAGACGGTCATGACGACCCTGGAGGGGTCCGCGTGGGCCGAC
GGACTGGCCGTGCTCGAGGACGCGGTCCAAGCCGCTCCTGCGGCCGGGGGGAGGACGTTCCTCGTCGACGTCGGG
GGAGGACGCGGCCACCAGTGCGTCCAGCTGGGGCGCAAGTTCCCGAGCCTGCTGGGACGGCTCGTCGTCCAAGAC
CTGCCCGAGGTCGTGGACGGGCTGCCTGCCACGGACGGGGTTCGAGCCGAGGCGCACGACTTTTTCGACGAACAG
CCCGTCGCCGGCGCCAGCTTCTACTACCTGCGCCGCGTCCTGCACGACTGGCCCGACGGCGACTGCGTCAGGATC
TTGGACAGGATTGCCGGCGCCATGGCCGCCGACTCCCGCATCCTCGTCGACGAGGTTGTCTTGCCCGACAGGGGC
GCTCCGTGCCAGGCGGCCATGGCCGATCTGGCCATGATGGTGGCCATGGGCGGCAAGGAGCGGACGGAGCAGCAG
TGGCGGGCCCTGGCCGAGAGCTCCGGCCTGCGCGTCGACGAGATCCATACGTACATGGCTTCCACATGCACCTCG
GTCGTTGTCTTGGCGCGGAAGTAG
Gene >Hirsu2|1201
ATGGAGACCGCCCTCGCGCCGATCCGCGCCCTGGCCCAGACGGCGGACGCGGCCGGCCGGCTGGCGCTGCTGCGG
GCCCTGCGCCAGGTGCAGACGGAGCTGCAGAGCCCGACGGACACGCTCATGGAGATTGTGAACCAGGTGCGTCTC
TAGCCCGCGAACCCCTCCTCCTCCCTCTCGCGTCTCCCCGGACCGACGAGCAGAGCGCAGGCCCCGCTCCTCGCA
TCCCTCCGGCTGGGCATAGACCTCGGCCTCTTCCGGACGCTGGCCGACCGCGGCTCCGTCATGAGCCTGGCCCAG
CTGGCCGAGTCCTGCGGAGCCTCGCCTCAGCTTCTGGGTGAGTTCTGCGCCCCGAGTGCCCGTCTTCCCGCGGAA
TGGGCGGCTGAAGCAGGTCTCGCCCAAAAAAAAAGAGCGCTTCCTTCGCTACTACGCGGCCAACGACGTGGTCGA
GGAAGTGGACGTCCGTCAGTACAAGGCGACCAGCCTGACTCGTGTGGTCGCGGACCCCAAGGGGACGGCCATGAT
TTCTCACATGTTGGTCATCCCGTCTGCAGCCAGTCTCGGCCGAGAACTCACCGGCGCCGCGTTCCAGATTTGATA
CGCACGCGCCCACCTTCCAGGCCATGCCCGGCTTCTTCGCGGAGAAGGGGTACCGGGAGATCGGCAGCAGCACCG
AGACGCCGTTCCAGAAGGCCTTCAAGACCGACCTGGGCGCCTTCGACTGGATGGCCCGGCACCCGGAGCAGCGGG
AGTCTCTGCAGACGGTCATGACGACCCTGGAGGGGTCCGCGTGGGCCGACGGACTGGCCGTGCTCGAGGACGCGG
TCCAAGCCGCTCCTGCGGCCGGGGGGAGGACGTTCCTCGTCGACGTCGGGGGAGGACGCGGCCACCAGTGCGTCC
AGCTGGGGCGCAAGTTCCCGAGCCTGCTGGGACGGCTCGTCGTCCAAGACCTGCCCGAGGTCGTGGACGGGCTGC
CTGCCACGGACGGGGTTCGAGCCGAGGCGCACGACTTTTTCGACGAACAGCCCGTCGCCGGTCGGTTGTCCCCCC
TCCATCCCCTCTTCTGATGCCCAGGAGGCGCTCCGCTGACGACGGGTGCTCGGTGACGCAGGCGCCAGCTTCTAC
TACCTGCGCCGCGTCCTGCACGACTGGCCCGACGGCGACTGCGTCAGGATCTTGGACAGGATTGCCGGCGCCATG
GCCGCCGACTCCCGCATCCTCGTCGACGAGGTTGTCTTGCCCGACAGGGGCGCTCCGTGCCAGGCGGCCATGGCC
GATCTGGCCATGATGGTGGCCATGGGCGGCAAGGAGCGGACGGAGCAGCAGTGGCGGGCCCTGGCCGAGAGCTCC
GGCCTGCGCGTCGACGAGATCCATACGTACATGGCTTCCACATGCACCTCGGTCGTTGTCTTGGCGCGGAAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail