Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1199
Gene name
LocationContig_1257:305..1976
Strand-
Gene length (bp)1671
Transcript length (bp)1545
Coding sequence length (bp)1545
Protein length (aa) 515

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09949 APP1_cat Phosphatidate phosphatase APP1, catalytic domain 7.6E-37 277 422

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0008195 phosphatidate phosphatase activity Yes
GO:0003824 catalytic activity No
GO:0016791 phosphatase activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0042578 phosphoric ester hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1199
MLRQVVSVAALAAFAWSAPTSMPTATATGSQIGGVAPAPAPEQTPAPKIGERDLKDNAKSFIDSLASNVGSEFSS
FLDSGILDFPKGFPTGSQVEQSAGVSKTDIDAKPTQVLNLPAYGNWTDRGWNVRIHGNVYKVPDISQKKIDDLAN
VFLIGTSVEKLSPSEQEQARNVTRSIFIVQQGDKNVTMRFESNVAVSSNASGGASNAGGGGQTVNLPYNTTAEGD
FDTFITLSNTTGPGGGHMVPGNETARIQTLNVYAEGTSSGNATAYLVPPEGVTVVSDIDDILRVTKIYEPKEGLL
NTFARPFAPWMKMPDIYANWSSSVNNLHFHYLTTTPEQVTRNYMDFIYKTYPLGSFDTRPLNFSDLSATLHIRRF
LLDKVFQTFPRRKFVLVADTTNRDVMKAYPQMYKDYPGQVQCILLRNTSSTDPGDKFPYDTSGFKDIPKERYMFF
NVPDDLARLDVVNGQCLNGSIAQNVTFRTQGLPFGIGDGGSAAGRAWPSVLPAMLAALVAAMVV*
Coding >Hirsu2|1199
ATGCTGCGACAAGTGGTCTCAGTCGCGGCGCTGGCCGCCTTCGCGTGGAGCGCGCCGACGTCGATGCCCACGGCG
ACAGCAACCGGCAGCCAAATAGGGGGCGTCGCGCCGGCACCGGCGCCGGAGCAAACGCCAGCCCCGAAGATCGGC
GAACGAGACTTGAAAGACAACGCCAAGAGTTTTATAGACAGCCTCGCGAGCAACGTCGGAAGCGAATTCTCTTCC
TTTCTCGACTCCGGCATCCTCGACTTCCCCAAAGGCTTCCCGACCGGGTCGCAGGTCGAGCAGTCGGCAGGCGTG
TCGAAGACGGACATTGACGCCAAGCCGACGCAAGTGCTGAACCTACCGGCCTACGGCAACTGGACAGACAGGGGC
TGGAACGTCCGGATCCACGGAAATGTGTACAAGGTCCCCGATATCTCGCAGAAGAAGATTGACGACCTCGCCAAT
GTTTTTCTCATTGGCACGAGTGTCGAGAAGCTGTCGCCTTCGGAGCAGGAGCAGGCCCGTAACGTGACAAGGTCC
ATCTTCATCGTCCAGCAAGGCGACAAGAACGTGACCATGAGATTCGAGAGCAACGTGGCCGTCAGCTCGAACGCG
AGCGGCGGCGCTTCCAATGCGGGCGGCGGTGGGCAGACGGTGAACTTGCCGTACAACACGACTGCCGAAGGCGAC
TTCGACACCTTCATCACCCTGAGCAACACCACGGGGCCGGGCGGCGGACACATGGTGCCGGGGAACGAGACGGCG
CGGATCCAGACCCTCAACGTGTACGCAGAAGGGACGAGCAGTGGAAACGCAACGGCATACCTGGTGCCGCCCGAG
GGCGTGACAGTCGTGTCCGACATCGACGACATCCTCCGCGTGACCAAGATCTACGAGCCAAAGGAGGGCCTGCTC
AACACGTTCGCGCGGCCGTTTGCGCCATGGATGAAAATGCCCGACATCTACGCGAACTGGTCGTCGTCGGTCAAC
AACCTGCACTTCCACTATCTGACGACGACGCCGGAGCAGGTGACGCGAAACTACATGGACTTCATCTACAAGACC
TACCCCCTCGGCTCCTTCGACACTCGGCCCCTCAACTTCTCCGACCTGTCCGCCACGCTGCACATCCGCAGGTTC
CTGCTCGACAAGGTGTTCCAGACCTTTCCACGCAGGAAGTTCGTCCTGGTGGCCGACACGACGAACCGCGACGTC
ATGAAGGCCTACCCGCAGATGTACAAGGACTACCCGGGGCAGGTCCAGTGCATCCTGCTGCGCAACACGAGCTCG
ACCGACCCGGGCGACAAGTTTCCGTACGACACGTCGGGCTTCAAGGACATACCCAAGGAACGATACATGTTCTTC
AACGTCCCCGACGACCTGGCCAGGCTCGACGTCGTCAACGGGCAGTGTCTGAACGGCTCGATTGCGCAGAACGTG
ACCTTTAGGACTCAGGGGCTGCCGTTTGGGATCGGCGACGGCGGCAGCGCGGCCGGCAGGGCGTGGCCGTCGGTG
CTTCCCGCAATGTTGGCGGCCCTGGTGGCGGCCATGGTCGTCTAA
Transcript >Hirsu2|1199
ATGCTGCGACAAGTGGTCTCAGTCGCGGCGCTGGCCGCCTTCGCGTGGAGCGCGCCGACGTCGATGCCCACGGCG
ACAGCAACCGGCAGCCAAATAGGGGGCGTCGCGCCGGCACCGGCGCCGGAGCAAACGCCAGCCCCGAAGATCGGC
GAACGAGACTTGAAAGACAACGCCAAGAGTTTTATAGACAGCCTCGCGAGCAACGTCGGAAGCGAATTCTCTTCC
TTTCTCGACTCCGGCATCCTCGACTTCCCCAAAGGCTTCCCGACCGGGTCGCAGGTCGAGCAGTCGGCAGGCGTG
TCGAAGACGGACATTGACGCCAAGCCGACGCAAGTGCTGAACCTACCGGCCTACGGCAACTGGACAGACAGGGGC
TGGAACGTCCGGATCCACGGAAATGTGTACAAGGTCCCCGATATCTCGCAGAAGAAGATTGACGACCTCGCCAAT
GTTTTTCTCATTGGCACGAGTGTCGAGAAGCTGTCGCCTTCGGAGCAGGAGCAGGCCCGTAACGTGACAAGGTCC
ATCTTCATCGTCCAGCAAGGCGACAAGAACGTGACCATGAGATTCGAGAGCAACGTGGCCGTCAGCTCGAACGCG
AGCGGCGGCGCTTCCAATGCGGGCGGCGGTGGGCAGACGGTGAACTTGCCGTACAACACGACTGCCGAAGGCGAC
TTCGACACCTTCATCACCCTGAGCAACACCACGGGGCCGGGCGGCGGACACATGGTGCCGGGGAACGAGACGGCG
CGGATCCAGACCCTCAACGTGTACGCAGAAGGGACGAGCAGTGGAAACGCAACGGCATACCTGGTGCCGCCCGAG
GGCGTGACAGTCGTGTCCGACATCGACGACATCCTCCGCGTGACCAAGATCTACGAGCCAAAGGAGGGCCTGCTC
AACACGTTCGCGCGGCCGTTTGCGCCATGGATGAAAATGCCCGACATCTACGCGAACTGGTCGTCGTCGGTCAAC
AACCTGCACTTCCACTATCTGACGACGACGCCGGAGCAGGTGACGCGAAACTACATGGACTTCATCTACAAGACC
TACCCCCTCGGCTCCTTCGACACTCGGCCCCTCAACTTCTCCGACCTGTCCGCCACGCTGCACATCCGCAGGTTC
CTGCTCGACAAGGTGTTCCAGACCTTTCCACGCAGGAAGTTCGTCCTGGTGGCCGACACGACGAACCGCGACGTC
ATGAAGGCCTACCCGCAGATGTACAAGGACTACCCGGGGCAGGTCCAGTGCATCCTGCTGCGCAACACGAGCTCG
ACCGACCCGGGCGACAAGTTTCCGTACGACACGTCGGGCTTCAAGGACATACCCAAGGAACGATACATGTTCTTC
AACGTCCCCGACGACCTGGCCAGGCTCGACGTCGTCAACGGGCAGTGTCTGAACGGCTCGATTGCGCAGAACGTG
ACCTTTAGGACTCAGGGGCTGCCGTTTGGGATCGGCGACGGCGGCAGCGCGGCCGGCAGGGCGTGGCCGTCGGTG
CTTCCCGCAATGTTGGCGGCCCTGGTGGCGGCCATGGTCGTCTAA
Gene >Hirsu2|1199
ATGCTGCGACAAGTGGTCTCAGTCGCGGCGCTGGCCGCCTTCGCGTGGAGCGCGCCGACGTCGATGCCCACGGCG
ACAGCAACCGGCAGCCAAATAGGGGGCGTCGCGCCGGCACCGGCGCCGGAGCAAACGCCAGCCCCGAAGATCGGC
GAACGAGACTTGAAAGACAACGCCAAGAGTTTTATAGACAGCCTCGCGAGCAACGTCGGAAGCGAATTCTCTTCC
TTTCTCGACTCCGGCATCCTCGACTTCCCCAAAGGCTTCCCGACCGGGTCGCAGGTCGAGCAGTCGGCAGGCGTG
TCGAAGACGGACATTGACGCCAAGCCGACGCAAGTGCTGAACCTACCGTGAGTCGCTCCGCAGCTTCAGTGTGTA
CCAGGAGGCACGCGTTGACAGCGGGTGCGCTCGTCAGGGCCTACGGCAACTGGACAGACAGGGGCTGGAACGTCC
GGATCCACGGAAATGTGTACAAGGTCCCCGATATCTCGCAGAAGAAGATTGACGACCTCGCCAATGTTTTTCTCA
TTGGCACGAGTGTCGAGAAGCTGTCGCCTTCGGAGCAGGAGCAGGCCCGTAACGTGACAAGGTCCATCTTCATCG
TCCAGCAAGGCGACAAGAACGTGACCATGAGATTCGAGAGCAACGTGGCCGTCAGCTCGAACGCGAGCGGCGGCG
CTTCCAATGCGGTAGGTCTCTTTGAACTGGCGATTCTTGTCCGGCGATCTTCGCTCACTCGTTACGGGACAGGGC
GGCGGTGGGCAGACGGTGAACTTGCCGTACAACACGACTGCCGAAGGCGACTTCGACACCTTCATCACCCTGAGC
AACACCACGGGGCCGGGCGGCGGACACATGGTGCCGGGGAACGAGACGGCGCGGATCCAGACCCTCAACGTGTAC
GCAGAAGGGACGAGCAGTGGAAACGCAACGGCATACCTGGTGCCGCCCGAGGGCGTGACAGTCGTGTCCGACATC
GACGACATCCTCCGCGTGACCAAGATCTACGAGCCAAAGGAGGGCCTGCTCAACACGTTCGCGCGGCCGTTTGCG
CCATGGATGAAAATGCCCGACATCTACGCGAACTGGTCGTCGTCGGTCAACAACCTGCACTTCCACTATCTGACG
ACGACGCCGGAGCAGGTGACGCGAAACTACATGGACTTCATCTACAAGACCTACCCCCTCGGCTCCTTCGACACT
CGGCCCCTCAACTTCTCCGACCTGTCCGCCACGCTGCACATCCGCAGGTTCCTGCTCGACAAGGTGTTCCAGACC
TTTCCACGCAGGAAGTTCGTCCTGGTGGCCGACACGACGAACCGCGACGTCATGAAGGCCTACCCGCAGATGTAC
AAGGACTACCCGGGGCAGGTCCAGTGCATCCTGCTGCGCAACACGAGCTCGACCGACCCGGGCGACAAGTTTCCG
TACGACACGTCGGGCTTCAAGGACATACCCAAGGAACGATACATGTTCTTCAACGTCCCCGACGACCTGGCCAGG
CTCGACGTCGTCAACGGGCAGTGTCTGAACGGCTCGATTGCGCAGAACGTGACCTTTAGGACTCAGGGGCTGCCG
TTTGGGATCGGCGACGGCGGCAGCGCGGCCGGCAGGGCGTGGCCGTCGGTGCTTCCCGCAATGTTGGCGGCCCTG
GTGGCGGCCATGGTCGTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail