Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1190
Gene name
LocationContig_1253:38..2301
Strand-
Gene length (bp)2263
Transcript length (bp)1968
Coding sequence length (bp)1968
Protein length (aa) 656

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13632 Glyco_trans_2_3 Glycosyl transferase family group 2 1.2E-20 268 533

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 12 29 17
2 59 81 22
3 514 533 19
4 543 565 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1190
MSLFAWCSRRAGGLSMMALLGLCYWVISQESTLQRHGYKFERPGTPGASYSSTSTSGAGVWTFVFAYYCLLIHVL
VFIFPLRACWSVWDITQALRRSVHCRVSENFKMALRRRGSSTSISSSETLTSETLTSSDGNAYSSTASEASDVEP
DMYTDAADAALDPVIHAIVVPNYKEEMDTLRETLEVLASHPQAHSSYDIYLGMEQREAHGESKALNLIQEFVKKF
RSIDYTLHPADIPGESAGKGSNLGWAARKLSAKYSMAVRKNVIVTGIDADSHLSPRYFANVSMMHLSHPETATTT
LYAAPIVFDRNAHNVPAIVRVADILWCAAGISGLYRGSSIAPPTSVYSLPLELVDRVGGWDCDAEAIGEDLHMYL
KCFFALNGNLTCRTILSPVSQSNVTGGGKGGIRGTIIDMQARYKQALRHMWGALDTGFALRQAAEMWQERKHTSR
AFRPLHRSQGDSSNCYFPINHASDGNVDHPRENGVFSDVTQDTLKEPHWEHILYLFHRLFEAHFLPVHMTILVLA
SALYVWATDGKDDPNNLGWIFSLCNVLRTLGFIEVACYLFLYESFHRICVTTREREMTKAGLADGMCFSHRSIKR
NMIDYVLVPLVAPLYGAIPCAQAEISHFWTVDLIYTVSKKVTRQRARSMVADDMA*
Coding >Hirsu2|1190
ATGTCTCTGTTCGCATGGTGCTCGCGACGGGCGGGCGGCCTCAGCATGATGGCCCTGCTCGGCCTCTGCTACTGG
GTCATTTCACAGGAATCGACGCTCCAACGGCACGGCTACAAGTTTGAGCGGCCGGGGACGCCTGGCGCATCCTAC
TCGTCCACCTCGACGTCGGGCGCCGGCGTCTGGACCTTCGTCTTCGCCTACTACTGCCTGCTCATCCACGTCCTC
GTCTTCATCTTCCCCCTCCGCGCTTGCTGGTCCGTCTGGGACATCACTCAGGCCCTGCGCCGCTCCGTCCACTGC
CGCGTTAGCGAGAATTTCAAGATGGCCCTGCGCCGCCGCGGTTCCAGCACCTCCATCTCGAGCTCCGAGACGCTG
ACGTCGGAAACGCTCACCTCGTCCGACGGCAACGCCTACTCGTCGACGGCCAGCGAGGCCAGCGACGTCGAGCCG
GACATGTACACCGACGCCGCCGACGCCGCCCTCGACCCCGTCATTCACGCCATCGTCGTCCCCAACTACAAGGAG
GAAATGGACACGCTCAGGGAGACGCTCGAGGTCCTGGCTTCGCACCCCCAGGCGCATTCTTCCTACGATATTTAT
CTCGGCATGGAGCAGCGCGAGGCGCATGGCGAATCAAAGGCCCTCAACCTCATCCAAGAATTCGTCAAGAAGTTC
CGCTCCATCGACTACACCCTCCACCCCGCCGACATCCCGGGCGAGTCCGCCGGCAAGGGCAGCAACCTCGGGTGG
GCCGCGAGGAAGCTCAGCGCCAAGTACTCGATGGCGGTTCGGAAGAATGTCATTGTCACGGGAATCGACGCCGAT
AGCCACCTCTCGCCAAGGTACTTCGCCAACGTCAGCATGATGCACCTGTCTCACCCGGAGACGGCGACGACGACA
CTGTACGCCGCGCCCATCGTCTTCGACCGCAACGCCCACAACGTGCCCGCCATCGTCCGCGTCGCCGACATCCTC
TGGTGCGCCGCCGGCATCTCGGGCCTGTACCGGGGCTCGTCGATTGCGCCGCCCACGTCCGTCTACTCGCTGCCG
CTCGAGCTCGTCGACCGCGTCGGCGGCTGGGACTGCGACGCCGAGGCCATCGGCGAGGACCTGCACATGTACCTC
AAGTGCTTCTTCGCCCTCAACGGCAACCTCACCTGCCGCACCATCCTGAGCCCCGTGAGCCAGAGCAACGTGACG
GGCGGCGGCAAGGGCGGCATCCGCGGCACCATCATCGACATGCAGGCCCGGTACAAGCAGGCCCTGCGGCACATG
TGGGGGGCCCTCGACACGGGCTTCGCCCTGCGCCAGGCGGCCGAGATGTGGCAGGAGCGCAAGCACACGTCGAGG
GCCTTTCGCCCGCTGCACCGCAGCCAGGGCGACAGCTCCAACTGCTACTTCCCCATCAACCACGCGTCCGACGGC
AACGTTGACCACCCGCGCGAGAACGGCGTCTTCTCGGACGTGACGCAGGACACGCTCAAGGAGCCGCACTGGGAG
CACATACTGTACCTCTTCCACCGCCTGTTCGAGGCGCACTTCCTGCCGGTGCACATGACGATCCTGGTCCTGGCC
TCGGCGCTGTACGTGTGGGCGACGGACGGCAAGGACGACCCCAACAACCTGGGCTGGATCTTCTCGCTCTGCAAC
GTGCTGCGGACGCTGGGCTTCATCGAGGTGGCCTGCTACCTGTTCCTCTACGAAAGCTTCCACCGGATATGCGTG
ACGACGCGCGAGCGGGAGATGACCAAGGCGGGCCTCGCCGACGGCATGTGCTTCTCGCACCGATCCATCAAGCGC
AACATGATTGACTACGTCCTGGTGCCGCTGGTGGCGCCGCTGTACGGCGCGATACCGTGCGCCCAGGCCGAGATT
TCGCACTTTTGGACGGTCGACTTGATCTACACGGTCAGCAAGAAGGTGACGCGACAACGAGCCCGGTCGATGGTG
GCCGACGACATGGCATGA
Transcript >Hirsu2|1190
ATGTCTCTGTTCGCATGGTGCTCGCGACGGGCGGGCGGCCTCAGCATGATGGCCCTGCTCGGCCTCTGCTACTGG
GTCATTTCACAGGAATCGACGCTCCAACGGCACGGCTACAAGTTTGAGCGGCCGGGGACGCCTGGCGCATCCTAC
TCGTCCACCTCGACGTCGGGCGCCGGCGTCTGGACCTTCGTCTTCGCCTACTACTGCCTGCTCATCCACGTCCTC
GTCTTCATCTTCCCCCTCCGCGCTTGCTGGTCCGTCTGGGACATCACTCAGGCCCTGCGCCGCTCCGTCCACTGC
CGCGTTAGCGAGAATTTCAAGATGGCCCTGCGCCGCCGCGGTTCCAGCACCTCCATCTCGAGCTCCGAGACGCTG
ACGTCGGAAACGCTCACCTCGTCCGACGGCAACGCCTACTCGTCGACGGCCAGCGAGGCCAGCGACGTCGAGCCG
GACATGTACACCGACGCCGCCGACGCCGCCCTCGACCCCGTCATTCACGCCATCGTCGTCCCCAACTACAAGGAG
GAAATGGACACGCTCAGGGAGACGCTCGAGGTCCTGGCTTCGCACCCCCAGGCGCATTCTTCCTACGATATTTAT
CTCGGCATGGAGCAGCGCGAGGCGCATGGCGAATCAAAGGCCCTCAACCTCATCCAAGAATTCGTCAAGAAGTTC
CGCTCCATCGACTACACCCTCCACCCCGCCGACATCCCGGGCGAGTCCGCCGGCAAGGGCAGCAACCTCGGGTGG
GCCGCGAGGAAGCTCAGCGCCAAGTACTCGATGGCGGTTCGGAAGAATGTCATTGTCACGGGAATCGACGCCGAT
AGCCACCTCTCGCCAAGGTACTTCGCCAACGTCAGCATGATGCACCTGTCTCACCCGGAGACGGCGACGACGACA
CTGTACGCCGCGCCCATCGTCTTCGACCGCAACGCCCACAACGTGCCCGCCATCGTCCGCGTCGCCGACATCCTC
TGGTGCGCCGCCGGCATCTCGGGCCTGTACCGGGGCTCGTCGATTGCGCCGCCCACGTCCGTCTACTCGCTGCCG
CTCGAGCTCGTCGACCGCGTCGGCGGCTGGGACTGCGACGCCGAGGCCATCGGCGAGGACCTGCACATGTACCTC
AAGTGCTTCTTCGCCCTCAACGGCAACCTCACCTGCCGCACCATCCTGAGCCCCGTGAGCCAGAGCAACGTGACG
GGCGGCGGCAAGGGCGGCATCCGCGGCACCATCATCGACATGCAGGCCCGGTACAAGCAGGCCCTGCGGCACATG
TGGGGGGCCCTCGACACGGGCTTCGCCCTGCGCCAGGCGGCCGAGATGTGGCAGGAGCGCAAGCACACGTCGAGG
GCCTTTCGCCCGCTGCACCGCAGCCAGGGCGACAGCTCCAACTGCTACTTCCCCATCAACCACGCGTCCGACGGC
AACGTTGACCACCCGCGCGAGAACGGCGTCTTCTCGGACGTGACGCAGGACACGCTCAAGGAGCCGCACTGGGAG
CACATACTGTACCTCTTCCACCGCCTGTTCGAGGCGCACTTCCTGCCGGTGCACATGACGATCCTGGTCCTGGCC
TCGGCGCTGTACGTGTGGGCGACGGACGGCAAGGACGACCCCAACAACCTGGGCTGGATCTTCTCGCTCTGCAAC
GTGCTGCGGACGCTGGGCTTCATCGAGGTGGCCTGCTACCTGTTCCTCTACGAAAGCTTCCACCGGATATGCGTG
ACGACGCGCGAGCGGGAGATGACCAAGGCGGGCCTCGCCGACGGCATGTGCTTCTCGCACCGATCCATCAAGCGC
AACATGATTGACTACGTCCTGGTGCCGCTGGTGGCGCCGCTGTACGGCGCGATACCGTGCGCCCAGGCCGAGATT
TCGCACTTTTGGACGGTCGACTTGATCTACACGGTCAGCAAGAAGGTGACGCGACAACGAGCCCGGTCGATGGTG
GCCGACGACATGGCATGA
Gene >Hirsu2|1190
ATGTCTCTGTTCGCATGGTGCTCGCGACGGGCGGGCGGCCTCAGCATGATGGCCCTGCTCGGCCTCTGCTACTGG
GTCATTTCACAGGAATCGACGCTCCAACGGCACGGCTACAAGTTTGAGCGGCCGGGGACGCCTGGCGCATCCTAC
TCGTCCACCTCGACGTCGGGCGCCGGCGTCTGGACCTTCGTCTTCGCCTACTACTGCCTGCTCATCCACGTCCTC
GTCTTCATCTTCCCCCTCCGCGCTTGCTGGTCCGTCTGGGACATCACTCAGGCCCTGCGCCGCTCCGTCCACTGC
CGCGTTAGCGAGAATTTCAAGATGGCCCTGCGCCGCCGCGGTTCCAGCACCTCCATCTCGAGCTCCGAGACGCTG
ACGTCGGAAACGCTCACCTCGTCCGACGGCAACGCCTACTCGTCGACGGCCAGCGAGGCCAGCGACGTCGAGCCG
GACATGTACACCGACGCCGCCGACGCCGCCCTCGACCCCGTCATTCACGCCATCGTCGTCCCCAACTACAAGGAG
GAAATGGACACGCTCAGGGAGACGCTCGAGGTCCTGGCTTCGCACCCCCAGGCGCATTCTTCCTACGATGTGAGT
CGAGGCGGCCCCCTCCCTCCGCGACGGCGGCCCTCTGCGCTGGCTGCCTGGCCGGCCGGCCCCCTCTGGTGGGGG
CTTTACTCGGGGCGCGCTGCGCACCACGCGCAGACCCCGCGGCCCGGGCCAAAGCTTGCTGACGGCCGGCGCGCT
AGATTTATCTCGGCATGGAGCAGCGCGAGGCGCATGGCGAATCAAAGGCCCTCAACCTCATCCAAGAATTCGTCA
AGAAGTTCCGCTCCATCGACTACACCCTCCACCCCGCCGACATCCCGGGCGAGTCCGCCGGCAAGGGCAGCAACC
TCGGGTGGGCCGCGAGGAAGCTCAGCGCCAAGTACTCGATGGCGGTTCGGAAGAATGTCATTGTCACGGGAATCG
ACGGTACGGCCGTCCTCATCATCTCCCCCCCTCCCTTCGGGGGGCTGCCGTGTCACGCCCGCGCGGGCGTTGTGC
GACGCGAGGCTGGGATCCGCCTCACCCTGCCCTTGGGCCCTCCGCTAACTAACTGCCTCCCGCAGCCGATAGCCA
CCTCTCGCCAAGGTACTTCGCCAACGTCAGCATGATGCACCTGTCTCACCCGGAGACGGCGACGACGACACTGTA
CGCCGCGCCCATCGTCTTCGACCGCAACGCCCACAACGTGCCCGCCATCGTCCGCGTCGCCGACATCCTCTGGTG
CGCCGCCGGCATCTCGGGCCTGTACCGGGGCTCGTCGATTGCGCCGCCCACGTCCGTCTACTCGCTGCCGCTCGA
GCTCGTCGACCGCGTCGGCGGCTGGGACTGCGACGCCGAGGCCATCGGCGAGGACCTGCACATGTACCTCAAGTG
CTTCTTCGCCCTCAACGGCAACCTCACCTGCCGCACCATCCTGAGCCCCGTGAGCCAGAGCAACGTGACGGGCGG
CGGCAAGGGCGGCATCCGCGGCACCATCATCGACATGCAGGCCCGGTACAAGCAGGCCCTGCGGCACATGTGGGG
GGCCCTCGACACGGGCTTCGCCCTGCGCCAGGCGGCCGAGATGTGGCAGGAGCGCAAGCACACGTCGAGGGCCTT
TCGCCCGCTGCACCGCAGCCAGGGCGACAGCTCCAACTGCTACTTCCCCATCAACCACGCGTCCGACGGCAACGT
TGACCACCCGCGCGAGAACGGCGTCTTCTCGGACGTGACGCAGGACACGCTCAAGGAGCCGCACTGGGAGCACAT
ACTGTACCTCTTCCACCGCCTGTTCGAGGCGCACTTCCTGCCGGTGCACATGACGATCCTGGTCCTGGCCTCGGC
GCTGTACGTGTGGGCGACGGACGGCAAGGACGACCCCAACAACCTGGGCTGGATCTTCTCGCTCTGCAACGTGCT
GCGGACGCTGGGCTTCATCGAGGTGGCCTGCTACCTGTTCCTCTACGAAAGCTTCCACCGGATATGCGTGACGAC
GCGCGAGCGGGAGATGACCAAGGCGGGCCTCGCCGACGGCATGTGCTTCTCGCACCGATCCATCAAGCGCAACAT
GATTGACTACGTCCTGGTGCCGCTGGTGGCGCCGCTGTACGGCGCGATACCGTGCGCCCAGGCCGAGATTTCGCA
CTTTTGGACGGTCGACTTGATCTACACGGTCAGCAAGAAGGTGACGCGACAACGAGCCCGGTCGATGGTGGCCGA
CGACATGGCATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail