Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1176
Gene name
LocationContig_125:9720..11667
Strand+
Gene length (bp)1947
Transcript length (bp)1698
Coding sequence length (bp)1698
Protein length (aa) 566

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00962 A_deaminase Adenosine deaminase 8.2E-20 235 536

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P58781|CEC1A_DANRE Adenosine deaminase CECR1-A OS=Danio rerio GN=cecr1a PE=2 SV=2 104 536 3.0E-59
sp|Q2VQV9|CECR1_XENLA Adenosine deaminase CECR1 OS=Xenopus laevis GN=cecr1 PE=1 SV=1 89 525 8.0E-57
sp|P58780|CECR1_PIG Adenosine deaminase CECR1 OS=Sus scrofa GN=CECR1 PE=2 SV=1 104 525 2.0E-55
sp|P15287|AGSA_APLCA Adenosine deaminase AGSA OS=Aplysia californica PE=1 SV=2 93 529 2.0E-55
sp|Q5RC46|CECR1_PONAB Adenosine deaminase CECR1 OS=Pongo abelii GN=CECR1 PE=2 SV=1 101 525 3.0E-55
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P58781|CEC1A_DANRE Adenosine deaminase CECR1-A OS=Danio rerio GN=cecr1a PE=2 SV=2 104 536 3.0E-59
sp|Q2VQV9|CECR1_XENLA Adenosine deaminase CECR1 OS=Xenopus laevis GN=cecr1 PE=1 SV=1 89 525 8.0E-57
sp|P58780|CECR1_PIG Adenosine deaminase CECR1 OS=Sus scrofa GN=CECR1 PE=2 SV=1 104 525 2.0E-55
sp|P15287|AGSA_APLCA Adenosine deaminase AGSA OS=Aplysia californica PE=1 SV=2 93 529 2.0E-55
sp|Q5RC46|CECR1_PONAB Adenosine deaminase CECR1 OS=Pongo abelii GN=CECR1 PE=2 SV=1 101 525 3.0E-55
sp|Q9NZK5|CECR1_HUMAN Adenosine deaminase CECR1 OS=Homo sapiens GN=CECR1 PE=1 SV=2 101 525 2.0E-54
sp|Q553U5|CECR1_DICDI Adenosine deaminase CECR1 homolog OS=Dictyostelium discoideum GN=DDB_G0275179 PE=2 SV=1 32 538 8.0E-52
sp|O86737|MQNX_STRCO Aminodeoxyfutalosine deaminase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5662 PE=1 SV=1 398 540 3.0E-13
sp|Q82K09|MQNX_STRAW Aminodeoxyfutalosine deaminase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=add2 PE=1 SV=1 398 540 4.0E-13
sp|B3E600|ADE_GEOLS Adenine deaminase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=Glov_1001 PE=3 SV=1 418 540 4.0E-12
sp|Q2TZN9|ADE_ASPOR Adenine deaminase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=aah1 PE=3 SV=1 398 540 4.0E-12
sp|Q4X1Q4|ADE_ASPFU Adenine deaminase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=aah1 PE=3 SV=1 398 550 7.0E-12
sp|Q5NNW5|ADE_ZYMMO Adenine deaminase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=ZMO0971 PE=3 SV=1 398 540 5.0E-11
sp|Q11C48|ADE_CHESB Adenine deaminase OS=Chelativorans sp. (strain BNC1) GN=Meso_3659 PE=3 SV=1 324 485 7.0E-11
sp|Q8UJ05|ADE_AGRFC Adenine deaminase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=Atu0136 PE=3 SV=1 350 485 1.0E-10
sp|Q9RDE5|ADE_STRCO Adenine deaminase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO2546 PE=3 SV=1 418 532 2.0E-10
sp|B9JYP8|ADE_AGRVS Adenine deaminase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=Avi_0230 PE=3 SV=1 356 485 3.0E-10
sp|Q6FCU0|ADE_ACIAD Adenine deaminase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=ACIAD1245 PE=3 SV=1 418 540 4.0E-10
sp|Q7M9R5|ADE_WOLSU Adenine deaminase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=WS0737 PE=3 SV=1 398 539 7.0E-10
sp|B3PXN1|ADE_RHIE6 Adenine deaminase OS=Rhizobium etli (strain CIAT 652) GN=RHECIAT_CH0000242 PE=3 SV=1 356 485 3.0E-09
sp|A5G460|ADE_GEOUR Adenine deaminase OS=Geobacter uraniireducens (strain Rf4) GN=Gura_2399 PE=3 SV=1 418 540 3.0E-09
sp|B9J6V8|ADE_AGRRK Adenine deaminase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=Arad_0352 PE=3 SV=1 324 485 9.0E-09
sp|Q8XXL5|ADE_RALSO Adenine deaminase OS=Ralstonia solanacearum (strain GMI1000) GN=RSc2098 PE=3 SV=1 413 546 1.0E-08
sp|P53909|ADE_YEAST Adenine deaminase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AAH1 PE=1 SV=1 385 540 1.0E-08
sp|Q9L0L6|ADDL_STRCO Putative adenosine/adenine deaminase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO4644 PE=3 SV=1 398 540 1.0E-08
sp|Q98GV2|ADE_RHILO Adenine deaminase OS=Rhizobium loti (strain MAFF303099) GN=mll3163 PE=3 SV=1 400 485 2.0E-08
sp|A4VQI5|ADE_PSEU5 Adenine deaminase OS=Pseudomonas stutzeri (strain A1501) GN=PST_3608 PE=3 SV=1 418 489 3.0E-08
sp|C1DGB0|ADE_AZOVD Adenine deaminase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=Avin_22300 PE=3 SV=1 418 522 3.0E-08
sp|P53984|ADDL_STRVG Putative adenosine/adenine deaminase OS=Streptomyces virginiae PE=3 SV=1 398 540 4.0E-08
sp|Q8X1T6|ADE_EMENI Adenine deaminase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=aah1 PE=1 SV=1 377 540 4.0E-08
sp|Q2KDR5|ADE_RHIEC Adenine deaminase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=RHE_CH00197 PE=3 SV=1 356 485 4.0E-08
sp|Q7MDL6|ADD_VIBVY Adenosine deaminase OS=Vibrio vulnificus (strain YJ016) GN=add PE=3 SV=1 214 487 6.0E-08
sp|Q8D6Q8|ADD_VIBVU Adenosine deaminase OS=Vibrio vulnificus (strain CMCP6) GN=add PE=3 SV=1 214 487 6.0E-08
sp|Q6CM42|ADE_KLULA Adenine deaminase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=AAH1 PE=3 SV=1 377 489 7.0E-08
sp|Q9P6I7|ADE_SCHPO Adenine deaminase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aah1 PE=1 SV=1 398 509 8.0E-08
sp|B2U7U6|ADE_RALPJ Adenine deaminase OS=Ralstonia pickettii (strain 12J) GN=Rpic_2249 PE=3 SV=1 413 540 1.0E-07
sp|Q59ZB1|ADE_CANAL Adenine deaminase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=AAH1 PE=3 SV=1 398 536 1.0E-07
sp|Q0KCW5|ADE_CUPNH Adenine deaminase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=H16_A1014 PE=3 SV=1 398 489 2.0E-07
sp|A6VWL7|ADE_MARMS Adenine deaminase OS=Marinomonas sp. (strain MWYL1) GN=Mmwyl1_1922 PE=3 SV=1 423 530 2.0E-07
sp|Q3B2Q0|ADE_CHLL7 Adenine deaminase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=Plut_1524 PE=3 SV=1 395 489 2.0E-07
sp|Q87TF3|ADD_VIBPA Adenosine deaminase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=add PE=3 SV=1 419 489 2.0E-07
sp|B1WR40|ADE_CYAA5 Adenine deaminase OS=Cyanothece sp. (strain ATCC 51142) GN=cce_0747 PE=3 SV=1 418 489 2.0E-07
sp|Q20YN2|ADE_RHOPB Adenine deaminase OS=Rhodopseudomonas palustris (strain BisB18) GN=RPC_4230 PE=3 SV=1 418 489 2.0E-07
sp|B5XWQ7|ADD_KLEP3 Adenosine deaminase OS=Klebsiella pneumoniae (strain 342) GN=add PE=3 SV=1 419 491 3.0E-07
sp|Q1GRK2|ADE_SPHAL Adenine deaminase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=Sala_2009 PE=3 SV=1 418 540 3.0E-07
sp|Q7WBG5|ADE_BORPA Adenine deaminase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=BPP1038 PE=3 SV=1 392 489 3.0E-07
sp|Q7WMY6|ADE_BORBR Adenine deaminase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=BB1254 PE=3 SV=1 392 489 3.0E-07
sp|A6T9W8|ADD_KLEP7 Adenosine deaminase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=add PE=3 SV=1 419 515 3.0E-07
sp|Q1MMV7|ADE_RHIL3 Adenine deaminase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=RL0206 PE=3 SV=1 356 485 3.0E-07
sp|C3MBH4|ADE_RHISN Adenine deaminase OS=Rhizobium sp. (strain NGR234) GN=NGR_c34590 PE=3 SV=1 317 508 4.0E-07
sp|Q46YJ3|ADE_CUPPJ Adenine deaminase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=Reut_A2428 PE=3 SV=1 415 489 4.0E-07
sp|B2T672|ADE_BURPP Adenine deaminase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=Bphyt_3044 PE=3 SV=1 413 547 4.0E-07
sp|Q8DTN8|ADD_STRMU Adenosine deaminase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=add PE=3 SV=1 268 542 4.0E-07
sp|A6UXT7|ADE_PSEA7 Adenine deaminase OS=Pseudomonas aeruginosa (strain PA7) GN=PSPA7_0226 PE=3 SV=1 418 522 4.0E-07
sp|Q6FP78|ADE_CANGA Adenine deaminase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=AAH1 PE=3 SV=1 384 540 5.0E-07
sp|Q02UT0|ADE_PSEAB Adenine deaminase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=PA14_01830 PE=3 SV=1 418 522 5.0E-07
sp|Q2RWC5|ADE_RHORT Adenine deaminase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=Rru_A0766 PE=3 SV=1 418 489 5.0E-07
sp|Q839J4|ADD_ENTFA Adenosine deaminase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=add PE=3 SV=1 390 487 5.0E-07
sp|Q9I6Y4|ADE_PSEAE Adenine deaminase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA0148 PE=1 SV=1 418 522 5.0E-07
sp|B7V265|ADE_PSEA8 Adenine deaminase OS=Pseudomonas aeruginosa (strain LESB58) GN=PLES_01491 PE=3 SV=1 418 522 5.0E-07
sp|Q1LQ00|ADE_CUPMC Adenine deaminase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=Rmet_0890 PE=3 SV=1 415 540 6.0E-07
sp|A8GE12|ADD_SERP5 Adenosine deaminase OS=Serratia proteamaculans (strain 568) GN=add PE=3 SV=1 419 489 6.0E-07
sp|Q21T97|ADE_RHOFT Adenine deaminase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=Rfer_3297 PE=3 SV=1 418 536 7.0E-07
sp|B5ZXI3|ADE_RHILW Adenine deaminase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=Rleg2_4180 PE=3 SV=1 356 485 9.0E-07
sp|C3K8W2|ADE_PSEFS Adenine deaminase OS=Pseudomonas fluorescens (strain SBW25) GN=PFLU_0667 PE=3 SV=1 418 522 1.0E-06
sp|Q48D01|ADE_PSE14 Adenine deaminase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=PSPPH_4636 PE=3 SV=1 418 522 1.0E-06
sp|Q4ZYP1|ADE_PSEU2 Adenine deaminase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=Psyr_0661 PE=3 SV=1 418 522 1.0E-06
sp|B3R3T1|ADE_CUPTR Adenine deaminase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=RALTA_A0998 PE=3 SV=1 415 540 1.0E-06
sp|Q7N4H5|ADD_PHOLL Adenosine deaminase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=add PE=3 SV=1 419 491 1.0E-06
sp|B4EVZ1|ADD_PROMH Adenosine deaminase OS=Proteus mirabilis (strain HI4320) GN=add PE=3 SV=1 419 489 2.0E-06
sp|Q889J2|ADE_PSESM Adenine deaminase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=PSPTO_0757 PE=3 SV=1 418 489 2.0E-06
sp|A0LRH8|MQNX_ACIC1 Aminodeoxyfutalosine deaminase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=Acel_0264 PE=1 SV=1 386 491 2.0E-06
sp|B3W9T6|ADD_LACCB Adenosine deaminase OS=Lactobacillus casei (strain BL23) GN=add PE=3 SV=1 390 487 2.0E-06
sp|Q97EV1|ADD_CLOAB Adenosine deaminase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=add PE=3 SV=1 347 540 2.0E-06
sp|C5BDE0|ADD_EDWI9 Adenosine deaminase OS=Edwardsiella ictaluri (strain 93-146) GN=add PE=3 SV=1 419 489 2.0E-06
sp|A1JML4|ADD_YERE8 Adenosine deaminase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=add PE=3 SV=1 419 493 3.0E-06
sp|Q2KWR7|ADE_BORA1 Adenine deaminase OS=Bordetella avium (strain 197N) GN=BAV0774 PE=3 SV=1 419 489 3.0E-06
sp|B1KHA6|ADD_SHEWM Adenosine deaminase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=add PE=3 SV=1 397 487 3.0E-06
sp|Q66AF0|ADD_YERPS Adenosine deaminase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=add PE=3 SV=1 419 493 3.0E-06
sp|B2K4L5|ADD_YERPB Adenosine deaminase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=add PE=3 SV=1 419 493 3.0E-06
sp|B1JKL9|ADD_YERPY Adenosine deaminase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=add PE=3 SV=1 419 493 3.0E-06
sp|A7FHX5|ADD_YERP3 Adenosine deaminase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=add PE=3 SV=1 419 493 3.0E-06
sp|Q13V90|ADE_BURXL Adenine deaminase OS=Burkholderia xenovorans (strain LB400) GN=Bxeno_A3461 PE=3 SV=1 386 489 3.0E-06
sp|Q1RBH5|ADD_ECOUT Adenosine deaminase OS=Escherichia coli (strain UTI89 / UPEC) GN=add PE=3 SV=1 419 523 3.0E-06
sp|Q8FH99|ADD_ECOL6 Adenosine deaminase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=add PE=3 SV=1 419 523 3.0E-06
sp|Q0THK5|ADD_ECOL5 Adenosine deaminase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=add PE=3 SV=1 419 523 3.0E-06
sp|A1ABG8|ADD_ECOK1 Adenosine deaminase OS=Escherichia coli O1:K1 / APEC GN=add PE=3 SV=1 419 523 3.0E-06
sp|B7M9X6|ADD_ECO45 Adenosine deaminase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=add PE=3 SV=1 419 523 3.0E-06
sp|A3QJD9|ADD_SHELP Adenosine deaminase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=add PE=3 SV=1 419 514 3.0E-06
sp|Q4KIS2|ADE_PSEF5 Adenine deaminase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=PFL_0719 PE=3 SV=1 418 489 3.0E-06
sp|B7URW2|ADD_ECO27 Adenosine deaminase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=add PE=3 SV=1 419 523 4.0E-06
sp|C3LSH8|ADD_VIBCM Adenosine deaminase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=add PE=3 SV=1 419 489 4.0E-06
sp|Q9KNI7|ADD_VIBCH Adenosine deaminase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=add PE=3 SV=1 419 489 4.0E-06
sp|A5F4Q2|ADD_VIBC3 Adenosine deaminase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=add PE=3 SV=1 419 489 4.0E-06
sp|B7MVA0|ADD_ECO81 Adenosine deaminase OS=Escherichia coli O81 (strain ED1a) GN=add PE=3 SV=1 419 523 4.0E-06
sp|B0KLE3|ADE_PSEPG Adenine deaminase OS=Pseudomonas putida (strain GB-1) GN=PputGB1_0636 PE=3 SV=1 418 489 5.0E-06
sp|B2VK11|ADD_ERWT9 Adenosine deaminase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=add PE=3 SV=1 419 504 5.0E-06
sp|Q92T48|ADE_RHIME Adenine deaminase OS=Rhizobium meliloti (strain 1021) GN=R00132 PE=3 SV=1 329 485 6.0E-06
sp|Q6D4X4|ADD_PECAS Adenosine deaminase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=add PE=3 SV=1 419 489 7.0E-06
sp|A4W9X4|ADD_ENT38 Adenosine deaminase OS=Enterobacter sp. (strain 638) GN=add PE=3 SV=1 419 491 8.0E-06
sp|Q83RC0|ADD_SHIFL Adenosine deaminase OS=Shigella flexneri GN=add PE=3 SV=1 419 523 9.0E-06
sp|Q0T4F4|ADD_SHIF8 Adenosine deaminase OS=Shigella flexneri serotype 5b (strain 8401) GN=add PE=3 SV=1 419 523 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0019239 deaminase activity Yes
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1176
MRFFSLGTALLAGTVSAAQTWDPIPSADSTLVSKHMLARSTMMTLEKRQRQDKHFRDQLSPVAEQADAIVRDIRQ
HEIDNFWRRAATPGNETSERFAGEMFPLARPLIAQTKLWKIVQRMPKGALLHAHLTAMLPFSILLEAIVHTPGMV
VSATHSLYSEEGRHNASVRFFHVNTTVKAGAPLSSSDYVPGTPVHVEDAVAAFPGGKDSFIAYVKSKMVLTPEES
VRHELGVDQIWRNFQTAFGPAGKLLTYEPIVRTFYRQLFERLVDDGVSWVEIRAGGSNRRLVHDGQQDVDPDLDV
WWHVMQEEMTKFKATPKGKRFSGARVIWADFRGLKQEPLTKSMKLALERKVKFPDLFSGYDVVAQEDPGRTLADM
APELLWFQEQANNMNVSMPFFFHAGETLGDGNSTDLNLFDALLLRTRRIGHGFSLYKHPKLIDEVVENAVMVEVC
PISNEVLRLATDILHHPLPAMVAHGVPTAISNDDPAVLGQDAAGVSYDFYQVIQGFDNIGLAGLGALAHNSLRWS
HFEDQSDSDWIKDIDLAEHGHGVKAQRIRDWNRKAASRRD*
Coding >Hirsu2|1176
ATGCGATTCTTCAGTCTTGGGACGGCGCTCCTCGCGGGAACCGTGTCTGCGGCGCAGACATGGGATCCCATTCCC
AGCGCCGACAGCACGCTTGTGTCGAAGCACATGCTTGCTCGGTCCACCATGATGACGCTGGAGAAGAGACAGCGG
CAAGACAAACACTTCCGGGACCAGTTATCCCCCGTGGCCGAGCAGGCGGACGCCATTGTCCGGGACATCCGCCAG
CACGAGATCGACAACTTCTGGCGGCGAGCGGCCACCCCGGGCAATGAGACGAGCGAGCGGTTCGCAGGCGAGATG
TTCCCTCTGGCCCGCCCGCTGATCGCGCAGACCAAGCTGTGGAAGATTGTGCAGCGCATGCCCAAGGGGGCACTG
CTTCATGCCCATCTCACCGCGATGCTGCCCTTTTCCATCCTCCTCGAGGCCATTGTCCACACGCCGGGCATGGTC
GTCTCCGCAACTCACAGCTTGTATAGCGAGGAGGGCCGGCACAACGCGTCCGTCAGGTTCTTCCACGTCAACACC
ACCGTCAAGGCCGGAGCCCCGCTGTCGTCGTCCGACTACGTGCCCGGCACGCCGGTCCACGTCGAAGACGCCGTC
GCCGCCTTCCCGGGCGGCAAGGACAGCTTCATCGCGTACGTCAAGTCCAAGATGGTGCTCACGCCTGAAGAGTCG
GTCCGGCATGAGCTGGGAGTCGACCAGATCTGGCGAAACTTCCAAACCGCCTTTGGCCCGGCCGGCAAGCTGCTC
ACGTACGAGCCCATCGTCCGAACCTTCTATCGGCAGCTCTTCGAGCGGCTGGTCGACGACGGCGTCAGCTGGGTC
GAGATCCGAGCGGGAGGTTCGAACCGCAGGCTGGTCCATGACGGCCAGCAAGACGTGGACCCCGACCTGGACGTC
TGGTGGCACGTGATGCAAGAGGAGATGACCAAGTTCAAGGCCACTCCGAAGGGCAAACGCTTCTCGGGCGCAAGG
GTGATCTGGGCGGACTTCCGAGGCCTGAAACAGGAGCCCTTGACGAAGAGCATGAAGCTTGCCCTGGAGAGAAAG
GTCAAGTTCCCTGACCTGTTCAGCGGATACGACGTCGTCGCCCAGGAGGACCCCGGCCGCACCTTGGCCGACATG
GCGCCCGAGCTTCTCTGGTTCCAGGAGCAGGCCAACAACATGAACGTCTCCATGCCGTTCTTCTTCCACGCTGGC
GAGACGCTCGGCGACGGCAACTCGACCGACCTCAACCTCTTCGACGCCCTGCTGCTCCGCACTCGCCGCATCGGC
CACGGCTTCTCCCTGTACAAGCACCCGAAACTGATCGACGAGGTTGTCGAGAACGCCGTCATGGTCGAAGTCTGC
CCCATTTCCAACGAGGTCCTCCGCCTGGCCACAGACATCCTGCACCACCCTCTTCCGGCCATGGTTGCGCACGGA
GTGCCCACGGCCATTAGCAACGACGATCCCGCCGTGCTCGGCCAGGACGCCGCCGGCGTCAGCTACGACTTCTAT
CAGGTGATTCAGGGCTTCGACAACATCGGACTGGCTGGGCTTGGCGCCCTGGCACACAACAGCCTTCGCTGGTCT
CACTTCGAAGACCAGTCTGACTCGGATTGGATCAAGGACATCGATCTCGCAGAGCACGGGCATGGCGTCAAGGCC
CAGCGCATCCGAGACTGGAATCGCAAGGCGGCATCAAGACGAGACTGA
Transcript >Hirsu2|1176
ATGCGATTCTTCAGTCTTGGGACGGCGCTCCTCGCGGGAACCGTGTCTGCGGCGCAGACATGGGATCCCATTCCC
AGCGCCGACAGCACGCTTGTGTCGAAGCACATGCTTGCTCGGTCCACCATGATGACGCTGGAGAAGAGACAGCGG
CAAGACAAACACTTCCGGGACCAGTTATCCCCCGTGGCCGAGCAGGCGGACGCCATTGTCCGGGACATCCGCCAG
CACGAGATCGACAACTTCTGGCGGCGAGCGGCCACCCCGGGCAATGAGACGAGCGAGCGGTTCGCAGGCGAGATG
TTCCCTCTGGCCCGCCCGCTGATCGCGCAGACCAAGCTGTGGAAGATTGTGCAGCGCATGCCCAAGGGGGCACTG
CTTCATGCCCATCTCACCGCGATGCTGCCCTTTTCCATCCTCCTCGAGGCCATTGTCCACACGCCGGGCATGGTC
GTCTCCGCAACTCACAGCTTGTATAGCGAGGAGGGCCGGCACAACGCGTCCGTCAGGTTCTTCCACGTCAACACC
ACCGTCAAGGCCGGAGCCCCGCTGTCGTCGTCCGACTACGTGCCCGGCACGCCGGTCCACGTCGAAGACGCCGTC
GCCGCCTTCCCGGGCGGCAAGGACAGCTTCATCGCGTACGTCAAGTCCAAGATGGTGCTCACGCCTGAAGAGTCG
GTCCGGCATGAGCTGGGAGTCGACCAGATCTGGCGAAACTTCCAAACCGCCTTTGGCCCGGCCGGCAAGCTGCTC
ACGTACGAGCCCATCGTCCGAACCTTCTATCGGCAGCTCTTCGAGCGGCTGGTCGACGACGGCGTCAGCTGGGTC
GAGATCCGAGCGGGAGGTTCGAACCGCAGGCTGGTCCATGACGGCCAGCAAGACGTGGACCCCGACCTGGACGTC
TGGTGGCACGTGATGCAAGAGGAGATGACCAAGTTCAAGGCCACTCCGAAGGGCAAACGCTTCTCGGGCGCAAGG
GTGATCTGGGCGGACTTCCGAGGCCTGAAACAGGAGCCCTTGACGAAGAGCATGAAGCTTGCCCTGGAGAGAAAG
GTCAAGTTCCCTGACCTGTTCAGCGGATACGACGTCGTCGCCCAGGAGGACCCCGGCCGCACCTTGGCCGACATG
GCGCCCGAGCTTCTCTGGTTCCAGGAGCAGGCCAACAACATGAACGTCTCCATGCCGTTCTTCTTCCACGCTGGC
GAGACGCTCGGCGACGGCAACTCGACCGACCTCAACCTCTTCGACGCCCTGCTGCTCCGCACTCGCCGCATCGGC
CACGGCTTCTCCCTGTACAAGCACCCGAAACTGATCGACGAGGTTGTCGAGAACGCCGTCATGGTCGAAGTCTGC
CCCATTTCCAACGAGGTCCTCCGCCTGGCCACAGACATCCTGCACCACCCTCTTCCGGCCATGGTTGCGCACGGA
GTGCCCACGGCCATTAGCAACGACGATCCCGCCGTGCTCGGCCAGGACGCCGCCGGCGTCAGCTACGACTTCTAT
CAGGTGATTCAGGGCTTCGACAACATCGGACTGGCTGGGCTTGGCGCCCTGGCACACAACAGCCTTCGCTGGTCT
CACTTCGAAGACCAGTCTGACTCGGATTGGATCAAGGACATCGATCTCGCAGAGCACGGGCATGGCGTCAAGGCC
CAGCGCATCCGAGACTGGAATCGCAAGGCGGCATCAAGACGAGACTGA
Gene >Hirsu2|1176
ATGCGATTCTTCAGTCTTGGGACGGCGCTCCTCGCGGGAACCGTGTCTGCGGCGCAGACATGGGATCCCATTCCC
AGCGCCGACAGCACGCTTGTGTCGAAGCACATGCTTGCTCGGTCCACCATGATGACGCTGGAGAAGAGACAGCGG
CAAGGTGACGAGAGCCTCCTGTGAGATCGCTTCAGATCGACCTCGCCGCTGAGACGTGTCCATAGACAAACACTT
CCGGGACCAGTTATCCCCCGTGGCCGAGCAGGCGGACGCCATTGTCCGGGACATCCGCCAGCACGAGATCGACAA
CTTCTGGCGGCGAGCGGCCACCCCGGGCAATGAGACGAGCGAGCGGTTCGCAGGCGAGATGTTCCCTCTGGCCCG
CCCGCTGATCGCGCAGACCAAGCTGTGGAAGATTGTGCAGCGCATGCCCAAGGGGGCACTGCTTCATGCCCATCT
CACCGCGATGCTGCCCTTTTCCATCCTCCTCGAGGCCATTGTCCACACGCCGGGCATGGTCGTCTCCGCAACTCA
CAGCTTGTATAGCGAGGAGGGCCGGCACAACGCGTCCGTCAGGTTCTTCCACGTCAACACCACCGTCAAGGCCGG
AGCCCCGCTGTCGTCGTCCGACTACGTGCCCGGCACGCCGGTCCACGTCGAAGACGCCGTCGCCGCCTTCCCGGG
CGGCAAGGACAGCTTCATCGCGTACGTCAAGTCCAAGATGGTGCTCACGCCTGAAGAGTCGGTCCGGCATGAGCT
GGGAGTCGACCAGATCTGGCGAAACTTCCAAACCGCCTTTGGCCCGGCCGGCAAGCTGCTCACGTACGAGCCCAT
CGTCCGAACCTTCTATCGGCAGCTCTTCGAGCGGCTGGTCGACGACGGCGTCAGCTGGGTCGAGATCCGAGCGGG
AGGTTCGAACCGCAGGCTGGTCCATGACGGCCAGCAAGACGTGGACCCCGACCTGGACGTCTGGTGGCACGTGAT
GCAAGAGGAGATGACCAAGTTCAAGGCCACTCCGAAGGGCAAACGCTTCTCGGGCGCAAGGGTGATCTGGGCGGA
CTTCCGAGGCCTGAAACAGGAGCCCTTGACGAAGAGTAAGTGCTGCATAAATCGTTTGCCTATCGGAGATCAGGG
ACGAGGTCCGATGCTGATCCAAAACCGCAGGCATGAAGCTTGCCCTGGAGAGAAAGGTCAAGTTCCCTGACCTGT
TCAGCGGATACGACGTCGTCGCCCAGGAGGACCCCGGCCGCACCTTGGCCGACATGGCGCCCGAGCTTCTCTGGT
TCCAGGAGCAGGCCAACAACATGAACGTCTCCATGCCGTTCTTCTTCCACGCTGGCGAGACGCTCGGCGACGGCA
ACTCGACCGACCTCAACCTCTTCGACGCCCTGCTGCTCCGCACTCGCCGCATCGGCCACGGCTTCTCCCTGTACA
AGCACCCGAAACTGATCGACGAGGTTGTCGAGAACGCCGTCATGGTCGAAGTCTGCCCCATTTCCAACGAGGTCC
TCCGCCTGGCCACAGACATCCTGCACCACCCTCTTCCGGCCATGGTTGCGCACGGAGTGCCCACGGCCATTAGCA
ACGACGATCCCGCCGTGCTCGGCCAGGACGCCGCCGGCGTCAGCTACGACTTCTATCAGGTGATTCAGGGCTTCG
ACAACATCGGACTGGCTGGGCTTGTAAGTACACAGTTCCCGCGCTACGCCCTCTGGCTATGCGTTCAGGCTGACA
CCGCGGCAATAGGGCGCCCTGGCACACAACAGCCTTCGCTGGTCTCACTTCGAAGACCAGTCTGACTCGGATTGG
ATCAAGGACATCGATCTCGCAGAGCACGGGCATGGCGTCAAGGCCCAGCGCATCCGAGACTGGAATCGTCAGTGG
GAGGAATTTTGCCAATGGGTTGTGGCTGAGTACGGACCACGGCCAGGCAAGGCGGCATCAAGACGAGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail