Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1174
Gene name
LocationContig_125:511..1995
Strand-
Gene length (bp)1484
Transcript length (bp)1311
Coding sequence length (bp)1311
Protein length (aa) 437

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C9S5C6|MEP1_VERA1 Extracellular metalloprotease VDBG_01143 OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=VDBG_01143 PE=3 SV=1 11 295 5.0E-14
sp|B2AC45|MEP1_PODAN Extracellular metalloprotease PODANS_2_14170 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_2_14170 PE=3 SV=1 35 287 2.0E-12
sp|A4RGT4|MEP1_MAGO7 Extracellular metalloprotease MGG_08041 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_08041 PE=3 SV=1 18 308 3.0E-10
sp|E4USP0|MEP8_ARTGP Extracellular metalloprotease MGYG_03559 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_03559 PE=3 SV=1 15 293 2.0E-09
sp|C5P3X6|MEP1_COCP7 Extracellular metalloprotease 1 OS=Coccidioides posadasii (strain C735) GN=MEP1 PE=1 SV=1 2 266 6.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C9S5C6|MEP1_VERA1 Extracellular metalloprotease VDBG_01143 OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=VDBG_01143 PE=3 SV=1 11 295 5.0E-14
sp|B2AC45|MEP1_PODAN Extracellular metalloprotease PODANS_2_14170 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_2_14170 PE=3 SV=1 35 287 2.0E-12
sp|A4RGT4|MEP1_MAGO7 Extracellular metalloprotease MGG_08041 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_08041 PE=3 SV=1 18 308 3.0E-10
sp|E4USP0|MEP8_ARTGP Extracellular metalloprotease MGYG_03559 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_03559 PE=3 SV=1 15 293 2.0E-09
sp|C5P3X6|MEP1_COCP7 Extracellular metalloprotease 1 OS=Coccidioides posadasii (strain C735) GN=MEP1 PE=1 SV=1 2 266 6.0E-09
sp|E3QJV4|MEP1_COLGM Extracellular metalloprotease GLRG_06286 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=GLRG_06286 PE=3 SV=1 35 266 1.0E-08
sp|E3QKH9|MEP2_COLGM Extracellular metalloprotease GLRG_06511 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=GLRG_06511 PE=3 SV=1 34 256 7.0E-08
sp|D1ZSU8|MEP1_SORMK Extracellular metalloprotease SMAC_06893 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SMAC_06893 PE=3 SV=1 35 257 2.0E-07
sp|E5QZI4|MEP7_ARTGP Extracellular metalloprotease MGYG_00389 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_00389 PE=3 SV=1 5 258 9.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1174
MLPRVFFAAGLLAASASALAAPKSTGTAAANTTTCGDEKPSDELLALLDKFEALDAANVTKRDVIQPHNVGLYFY
IVAKDYSLSGGNLPDDYLRQEVDRLNQYFNTAPQRLFNFYIKNIDRRTGSIPDFNHMSEQQILELPLKQDLNKNR
DYSCLNIYYVHRYQDHGSYNRNHGWQTRGLYGFGVYPRQRVLDDTKWQDGIILSSLTAANTLFAGYRGIPAALAH
EIGHALGLLHTDQGSNATRCDFDNDRIRDTPAHRPLGEWKCSAAAWLGCEGPDRPFPLDNIMTSDATCTQGPAAR
TASPKASFTECGSSIVSCESPLPPQANPRGTAPRRDSLVGSNGLVLSRTGLALPRTGTRVVPGRIGTCTVLGRTG
TGIALSSPRRVLADLGLRARRQLREQRPSSPSQDNCYTSFASQPILVLLSLTSFRFTTSYF*
Coding >Hirsu2|1174
ATGCTTCCTCGGGTCTTCTTCGCCGCCGGCCTTTTGGCCGCGAGCGCTTCGGCCTTGGCCGCGCCGAAGTCGACG
GGCACGGCCGCCGCAAACACCACCACCTGCGGCGACGAAAAACCCAGCGACGAGCTCCTCGCCCTTCTAGACAAG
TTCGAGGCTTTGGACGCGGCCAATGTTACAAAACGCGACGTCATACAACCTCACAACGTCGGATTGTACTTTTAC
ATTGTCGCTAAGGATTATTCTCTTTCTGGCGGCAATCTGCCGGACGATTATCTAAGACAAGAGGTCGACAGGTTG
AATCAATATTTCAATACCGCCCCCCAAAGGCTATTCAACTTTTACATCAAGAATATAGACCGAAGAACTGGATCG
ATACCTGACTTCAACCATATGTCCGAGCAGCAGATCCTGGAACTTCCGCTAAAACAAGACTTAAACAAGAACCGC
GACTACAGCTGTTTGAATATTTACTACGTCCACCGATACCAGGATCACGGTTCCTACAATCGGAATCACGGGTGG
CAAACGAGGGGCTTGTACGGCTTCGGCGTCTATCCCCGGCAGAGGGTGCTGGACGACACGAAATGGCAGGATGGA
ATCATCCTCTCAAGCCTCACAGCTGCGAATACTCTCTTCGCGGGCTACAGAGGCATCCCGGCCGCGCTGGCCCAC
GAGATCGGTCACGCGCTGGGCTTGTTGCACACCGACCAGGGCAGTAACGCAACTCGATGCGACTTTGACAACGAC
AGGATCCGTGACACTCCCGCTCACAGGCCGCTTGGGGAGTGGAAGTGCTCTGCAGCGGCCTGGTTGGGATGTGAA
GGTCCAGACAGGCCATTTCCTCTCGACAACATCATGACTTCCGACGCGACATGCACACAAGGACCTGCGGCGCGA
ACCGCTTCACCCAAGGCCAGCTTTACCGAATGTGGGAGCTCTATCGTGAGCTGCGAAAGCCCTTTGCCCCCACAG
GCCAATCCCAGAGGAACCGCCCCCAGACGGGACAGCCTCGTCGGCAGCAATGGTCTAGTCCTCAGCAGAACCGGG
CTCGCCCTGCCCCGAACTGGAACACGCGTCGTCCCTGGCAGAATTGGAACCTGCACCGTCCTTGGCAGAACGGGA
ACTGGCATCGCTCTTAGTAGTCCTAGACGTGTCCTCGCGGACTTGGGTCTTCGAGCCCGGAGGCAACTGAGAGAG
CAGCGCCCATCTTCCCCCAGCCAGGATAACTGCTACACCTCCTTTGCCTCTCAACCCATTCTTGTCTTACTTTCT
CTCACCTCTTTTCGTTTCACAACCTCTTACTTCTAA
Transcript >Hirsu2|1174
ATGCTTCCTCGGGTCTTCTTCGCCGCCGGCCTTTTGGCCGCGAGCGCTTCGGCCTTGGCCGCGCCGAAGTCGACG
GGCACGGCCGCCGCAAACACCACCACCTGCGGCGACGAAAAACCCAGCGACGAGCTCCTCGCCCTTCTAGACAAG
TTCGAGGCTTTGGACGCGGCCAATGTTACAAAACGCGACGTCATACAACCTCACAACGTCGGATTGTACTTTTAC
ATTGTCGCTAAGGATTATTCTCTTTCTGGCGGCAATCTGCCGGACGATTATCTAAGACAAGAGGTCGACAGGTTG
AATCAATATTTCAATACCGCCCCCCAAAGGCTATTCAACTTTTACATCAAGAATATAGACCGAAGAACTGGATCG
ATACCTGACTTCAACCATATGTCCGAGCAGCAGATCCTGGAACTTCCGCTAAAACAAGACTTAAACAAGAACCGC
GACTACAGCTGTTTGAATATTTACTACGTCCACCGATACCAGGATCACGGTTCCTACAATCGGAATCACGGGTGG
CAAACGAGGGGCTTGTACGGCTTCGGCGTCTATCCCCGGCAGAGGGTGCTGGACGACACGAAATGGCAGGATGGA
ATCATCCTCTCAAGCCTCACAGCTGCGAATACTCTCTTCGCGGGCTACAGAGGCATCCCGGCCGCGCTGGCCCAC
GAGATCGGTCACGCGCTGGGCTTGTTGCACACCGACCAGGGCAGTAACGCAACTCGATGCGACTTTGACAACGAC
AGGATCCGTGACACTCCCGCTCACAGGCCGCTTGGGGAGTGGAAGTGCTCTGCAGCGGCCTGGTTGGGATGTGAA
GGTCCAGACAGGCCATTTCCTCTCGACAACATCATGACTTCCGACGCGACATGCACACAAGGACCTGCGGCGCGA
ACCGCTTCACCCAAGGCCAGCTTTACCGAATGTGGGAGCTCTATCGTGAGCTGCGAAAGCCCTTTGCCCCCACAG
GCCAATCCCAGAGGAACCGCCCCCAGACGGGACAGCCTCGTCGGCAGCAATGGTCTAGTCCTCAGCAGAACCGGG
CTCGCCCTGCCCCGAACTGGAACACGCGTCGTCCCTGGCAGAATTGGAACCTGCACCGTCCTTGGCAGAACGGGA
ACTGGCATCGCTCTTAGTAGTCCTAGACGTGTCCTCGCGGACTTGGGTCTTCGAGCCCGGAGGCAACTGAGAGAG
CAGCGCCCATCTTCCCCCAGCCAGGATAACTGCTACACCTCCTTTGCCTCTCAACCCATTCTTGTCTTACTTTCT
CTCACCTCTTTTCGTTTCACAACCTCTTACTTCTAA
Gene >Hirsu2|1174
ATGCTTCCTCGGGTCTTCTTCGCCGCCGGCCTTTTGGCCGCGAGCGCTTCGGCCTTGGCCGCGCCGAAGTCGACG
GGCACGGCCGCCGCAAACACCACCACCTGCGGCGACGAAAAACCCAGCGACGAGCTCCTCGCCCTTCTAGACAAG
TTCGAGGCTTTGGACGCGGCCAATGTTACAAAACGCGACGTCATACAACCTCACAACGTCGGATTGTACTTTTAC
ATTGTCGCTAAGGATTATTCTCTTTCTGGCGGCAATCTGCCGGTATGACTGCTTGGATTGGAACCTATCTGGCGT
TCCCTTGCTCCGGCCCATATTGCCGGTGCCCTTCCACGAGGATAGAGTGCTGACCCAGTCGCGACGCGAAACAGG
ACGATTATCTAAGACAAGAGGTCGACAGGTTGAATCAATATTTCAATACCGCCCCCCAAAGGCTATTCAACTTTT
ACATCAAGAATATAGACCGAAGAACTGGATCGATACCTGACTTCAACCATATGTCCGAGCAGCAGATCCTGGAAC
TTCCGCTAAAACAAGACTTAAACAAGAACCGCGACTACAGCTGTTTGAATATTTACTACGTCCACCGATACCAGG
ATCACGGTTCCTACAATCGGAATCACGGGTGGCAAACGAGGGGCTTGTACGGCTTCGGCGTCTATCCCCGGCAGA
GGGTGCTGGACGACACGAAATGGCAGGATGGAATCATCCTCTCAAGCCTCACAGCTGCGAATACTCTCTTCGCGG
GCTACAGAGGCATCCCGGCCGCGCTGGCCCACGAGATCGGTCACGCGCTGGGCTTGTTGCACACCGACCAGGGCA
GTAACGCAACTCGATGCGACTTTGACAACGACAGGATCCGTGACACTCCCGCTCACAGGCCGCTTGGGGAGTGGA
AGTGCTCTGCAGCGGCCTGGTTGGGATGTGAAGGTCCAGACAGGCCATTTCCTCTCGACAACATCATGACTTCCG
ACGCGACGTAAGTACACGAGACCACCGCTTCGGGCCCATCGGGCGAACCGGAAGATGAAGGCTGTTCTGACAGAT
GCACACAAGGACCTGCGGCGCGAACCGCTTCACCCAAGGCCAGCTTTACCGAATGTGGGAGCTCTATCGTGAGCT
GCGAAAGCCCTTTGCCCCCACAGGCCAATCCCAGAGGAACCGCCCCCAGACGGGACAGCCTCGTCGGCAGCAATG
GTCTAGTCCTCAGCAGAACCGGGCTCGCCCTGCCCCGAACTGGAACACGCGTCGTCCCTGGCAGAATTGGAACCT
GCACCGTCCTTGGCAGAACGGGAACTGGCATCGCTCTTAGTAGTCCTAGACGTGTCCTCGCGGACTTGGGTCTTC
GAGCCCGGAGGCAACTGAGAGAGCAGCGCCCATCTTCCCCCAGCCAGGATAACTGCTACACCTCCTTTGCCTCTC
AACCCATTCTTGTCTTACTTTCTCTCACCTCTTTTCGTTTCACAACCTCTTACTTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail