Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1171
Gene name
LocationContig_1249:2748..4736
Strand+
Gene length (bp)1988
Transcript length (bp)1668
Coding sequence length (bp)1668
Protein length (aa) 556

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00096 zf-C2H2 Zinc finger, C2H2 type 4.2E-05 434 457
PF00096 zf-C2H2 Zinc finger, C2H2 type 1.9E-06 463 485
PF12874 zf-met Zinc-finger of C2H2 type 1.1E-04 434 455

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P39959|YEW0_YEAST Zinc finger protein YER130C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YER130C PE=3 SV=2 420 486 3.0E-23
sp|Q59RR3|MNL1_CANAL Transcriptional regulator MNL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNL1 PE=3 SV=1 409 485 3.0E-21
sp|P33749|MSN4_YEAST Zinc finger protein MSN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSN4 PE=1 SV=1 389 485 8.0E-18
sp|Q10076|HSR1_SCHPO Hydrogen peroxide stress regulator 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hsr1 PE=2 SV=1 421 489 5.0E-17
sp|P33748|MSN2_YEAST Zinc finger protein MSN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSN2 PE=1 SV=1 424 485 3.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P39959|YEW0_YEAST Zinc finger protein YER130C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YER130C PE=3 SV=2 420 486 3.0E-23
sp|Q59RR3|MNL1_CANAL Transcriptional regulator MNL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNL1 PE=3 SV=1 409 485 3.0E-21
sp|P33749|MSN4_YEAST Zinc finger protein MSN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSN4 PE=1 SV=1 389 485 8.0E-18
sp|Q10076|HSR1_SCHPO Hydrogen peroxide stress regulator 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hsr1 PE=2 SV=1 421 489 5.0E-17
sp|P33748|MSN2_YEAST Zinc finger protein MSN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSN2 PE=1 SV=1 424 485 3.0E-16
sp|P07248|ADR1_YEAST Regulatory protein ADR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADR1 PE=1 SV=2 360 488 2.0E-14
sp|O74252|STE12_EMENI Transcription factor steA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=steA PE=2 SV=1 419 485 1.0E-13
sp|Q62445|SP4_MOUSE Transcription factor Sp4 OS=Mus musculus GN=Sp4 PE=2 SV=2 434 507 3.0E-13
sp|Q02446|SP4_HUMAN Transcription factor Sp4 OS=Homo sapiens GN=SP4 PE=1 SV=2 434 507 3.0E-13
sp|Q9P7D9|RSV1_SCHPO Zinc finger protein rsv1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsv1 PE=2 SV=1 432 491 9.0E-13
sp|Q5AF56|ADR1_CANAL Transcriptional regulator ADR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADR1 PE=2 SV=1 432 487 1.0E-12
sp|Q04545|TDA9_YEAST Probable transcription factor TDA9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TDA9 PE=1 SV=1 413 507 1.0E-11
sp|Q5XJQ7|OSR1_DANRE Protein odd-skipped-related 1 OS=Danio rerio GN=osr1 PE=2 SV=1 375 485 2.0E-11
sp|A4II20|EGR1_XENTR Early growth response protein 1 OS=Xenopus tropicalis GN=egr1 PE=2 SV=2 421 487 2.0E-11
sp|P26632|EGR1_DANRE Early growth response protein 1 OS=Danio rerio GN=egr1 PE=2 SV=2 422 487 3.0E-11
sp|Q5AMH6|CAS5_CANAL Cell wall integrity transcriptional regulator CAS5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAS5 PE=3 SV=1 410 487 3.0E-11
sp|Q6ZN79|Z705A_HUMAN Zinc finger protein 705A OS=Homo sapiens GN=ZNF705A PE=2 SV=1 340 487 3.0E-11
sp|P78871|RST2_SCHPO Zinc finger protein rst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rst2 PE=2 SV=2 390 483 3.0E-11
sp|Q6NTY6|EGR1B_XENLA Early growth response protein 1-B OS=Xenopus laevis GN=egr1-b PE=2 SV=1 421 487 3.0E-11
sp|P18146|EGR1_HUMAN Early growth response protein 1 OS=Homo sapiens GN=EGR1 PE=1 SV=1 422 487 3.0E-11
sp|O73694|EGR1_SERCA Early growth response protein 1 (Fragment) OS=Serinus canaria GN=EGR1 PE=3 SV=1 439 487 4.0E-11
sp|P08046|EGR1_MOUSE Early growth response protein 1 OS=Mus musculus GN=Egr1 PE=1 SV=2 422 487 4.0E-11
sp|Q01793|KRUP_TRICA Protein krueppel (Fragment) OS=Tribolium castaneum GN=Kr PE=3 SV=1 427 487 5.0E-11
sp|Q02086|SP2_HUMAN Transcription factor Sp2 OS=Homo sapiens GN=SP2 PE=1 SV=3 416 487 5.0E-11
sp|Q9D2H6|SP2_MOUSE Transcription factor Sp2 OS=Mus musculus GN=Sp2 PE=2 SV=2 416 487 5.0E-11
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 422 487 5.0E-11
sp|Q0IHB8|OSR2B_XENLA Protein odd-skipped-related 2-B OS=Xenopus laevis GN=osr2-b PE=2 SV=1 427 485 6.0E-11
sp|P08154|EGR1_RAT Early growth response protein 1 OS=Rattus norvegicus GN=Egr1 PE=1 SV=2 422 487 6.0E-11
sp|O70494|SP3_MOUSE Transcription factor Sp3 OS=Mus musculus GN=Sp3 PE=1 SV=2 434 491 6.0E-11
sp|Q08DS3|OSR1_BOVIN Protein odd-skipped-related 1 OS=Bos taurus GN=OSR1 PE=2 SV=2 427 486 6.0E-11
sp|Q32NK7|OSR2A_XENLA Protein odd-skipped-related 2-A OS=Xenopus laevis GN=osr2-a PE=2 SV=1 427 485 6.0E-11
sp|A0PJY2|FEZF1_HUMAN Fez family zinc finger protein 1 OS=Homo sapiens GN=FEZF1 PE=1 SV=1 301 487 6.0E-11
sp|P26633|EGR2_CRIGR E3 SUMO-protein ligase EGR2 (Fragment) OS=Cricetulus griseus GN=EGR2 PE=2 SV=1 437 487 7.0E-11
sp|B0K011|OSR1_RAT Protein odd-skipped-related 1 OS=Rattus norvegicus GN=Osr1 PE=2 SV=1 427 486 7.0E-11
sp|Q9WVG7|OSR1_MOUSE Protein odd-skipped-related 1 OS=Mus musculus GN=Osr1 PE=2 SV=1 427 486 7.0E-11
sp|Q8TAX0|OSR1_HUMAN Protein odd-skipped-related 1 OS=Homo sapiens GN=OSR1 PE=2 SV=1 427 486 7.0E-11
sp|Q2VWH6|FEZF2_BOVIN Fez family zinc finger protein 2 OS=Bos taurus GN=FEZF2 PE=2 SV=2 431 487 8.0E-11
sp|Q5E9U0|SP2_BOVIN Transcription factor Sp2 OS=Bos taurus GN=SP2 PE=2 SV=1 428 487 8.0E-11
sp|P18738|ZG9_XENLA Gastrula zinc finger protein XlCGF9.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 432 487 8.0E-11
sp|Q90WR8|SP3_CHICK Transcription factor Sp3 OS=Gallus gallus GN=SP3 PE=1 SV=1 434 485 8.0E-11
sp|Q6NTY6|EGR1B_XENLA Early growth response protein 1-B OS=Xenopus laevis GN=egr1-b PE=2 SV=1 346 485 9.0E-11
sp|Q9ESP5|FEZF2_MOUSE Fez family zinc finger protein 2 OS=Mus musculus GN=Fezf2 PE=1 SV=1 434 487 9.0E-11
sp|A4II20|EGR1_XENTR Early growth response protein 1 OS=Xenopus tropicalis GN=egr1 PE=2 SV=2 432 485 1.0E-10
sp|P18146|EGR1_HUMAN Early growth response protein 1 OS=Homo sapiens GN=EGR1 PE=1 SV=1 432 485 1.0E-10
sp|P08046|EGR1_MOUSE Early growth response protein 1 OS=Mus musculus GN=Egr1 PE=1 SV=2 432 485 1.0E-10
sp|Q8TBJ5|FEZF2_HUMAN Fez family zinc finger protein 2 OS=Homo sapiens GN=FEZF2 PE=2 SV=2 431 487 1.0E-10
sp|Q6AY34|OSR2_RAT Protein odd-skipped-related 2 OS=Rattus norvegicus GN=Osr2 PE=2 SV=1 427 485 1.0E-10
sp|Q6GQH4|EGR1A_XENLA Early growth response protein 1-A OS=Xenopus laevis GN=egr1-a PE=2 SV=1 436 487 1.0E-10
sp|Q8BXX2|ZBT49_MOUSE Zinc finger and BTB domain-containing protein 49 OS=Mus musculus GN=Zbtb49 PE=2 SV=1 429 487 1.0E-10
sp|Q03833|GIS1_YEAST Transcriptional activator/repressor GIS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIS1 PE=1 SV=1 415 481 1.0E-10
sp|Q3T135|OSR2_BOVIN Protein odd-skipped-related 2 OS=Bos taurus GN=OSR2 PE=2 SV=1 427 485 1.0E-10
sp|Q01871|KRUP_EUSPL Protein krueppel (Fragment) OS=Euscelis plebejus GN=Kr PE=3 SV=1 427 487 1.0E-10
sp|Q02447|SP3_HUMAN Transcription factor Sp3 OS=Homo sapiens GN=SP3 PE=1 SV=3 434 485 1.0E-10
sp|Q01779|KRUP_MUSDO Protein krueppel (Fragment) OS=Musca domestica GN=Kr PE=3 SV=1 427 487 1.0E-10
sp|P53035|MIG2_YEAST Regulatory protein MIG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIG2 PE=1 SV=1 427 487 1.0E-10
sp|P26632|EGR1_DANRE Early growth response protein 1 OS=Danio rerio GN=egr1 PE=2 SV=2 432 485 2.0E-10
sp|P08154|EGR1_RAT Early growth response protein 1 OS=Rattus norvegicus GN=Egr1 PE=1 SV=2 432 485 2.0E-10
sp|Q6GQH4|EGR1A_XENLA Early growth response protein 1-A OS=Xenopus laevis GN=egr1-a PE=2 SV=1 432 485 2.0E-10
sp|Q00911|EGR4_RAT Early growth response protein 4 OS=Rattus norvegicus GN=Egr4 PE=2 SV=1 395 487 2.0E-10
sp|Q00911|EGR4_RAT Early growth response protein 4 OS=Rattus norvegicus GN=Egr4 PE=2 SV=1 387 485 2.0E-10
sp|Q9WUF2|EGR4_MOUSE Early growth response protein 4 OS=Mus musculus GN=Egr4 PE=3 SV=1 387 485 2.0E-10
sp|Q9WUF2|EGR4_MOUSE Early growth response protein 4 OS=Mus musculus GN=Egr4 PE=3 SV=1 396 487 2.0E-10
sp|Q0P4W9|FEZF1_XENTR Fez family zinc finger protein 1 OS=Xenopus tropicalis GN=fezf1 PE=2 SV=1 434 487 2.0E-10
sp|Q28G88|FEZF2_XENTR Fez family zinc finger protein 2 OS=Xenopus tropicalis GN=fezf2 PE=2 SV=1 434 487 2.0E-10
sp|Q02035|KRUP_PSYCI Protein krueppel (Fragment) OS=Psychoda cinerea GN=Kr PE=3 SV=1 427 487 2.0E-10
sp|P31507|KRUP_APIME Protein krueppel (Fragment) OS=Apis mellifera GN=Kr PE=3 SV=1 427 487 2.0E-10
sp|O73693|EGR1_TAEGU Early growth response protein 1 (Fragment) OS=Taeniopygia guttata GN=EGR1 PE=3 SV=1 439 487 2.0E-10
sp|Q2TAR3|FEZF2_XENLA Fez family zinc finger protein 2 OS=Xenopus laevis GN=fezf2 PE=2 SV=1 434 487 2.0E-10
sp|Q567J8|OSR2_DANRE Protein odd-skipped-related 2 OS=Danio rerio GN=osr2 PE=2 SV=1 427 485 2.0E-10
sp|Q25C93|FEZF1_DANRE Fez family zinc finger protein 1 OS=Danio rerio GN=fezf1 PE=2 SV=1 431 487 2.0E-10
sp|P86413|OSR1_XENLA Protein odd-skipped-related 1 OS=Xenopus laevis GN=osr1 PE=2 SV=1 427 486 2.0E-10
sp|Q9GL32|EGR4_BOVIN Early growth response protein 4 OS=Bos taurus GN=EGR4 PE=2 SV=1 387 485 2.0E-10
sp|Q66JF8|OSR1_XENTR Protein odd-skipped-related 1 OS=Xenopus tropicalis GN=osr1 PE=2 SV=1 427 486 2.0E-10
sp|Q0VDQ9|FEZF1_MOUSE Fez family zinc finger protein 1 OS=Mus musculus GN=Fezf1 PE=2 SV=1 434 487 2.0E-10
sp|A1XSY8|EGR2_PIG E3 SUMO-protein ligase EGR2 OS=Sus scrofa GN=EGR2 PE=2 SV=1 432 485 2.0E-10
sp|Q9IAJ2|FEZF1_XENLA Fez family zinc finger protein 1 OS=Xenopus laevis GN=fezf1 PE=2 SV=1 434 487 2.0E-10
sp|Q01792|KRUP_BRACO Protein krueppel (Fragment) OS=Bradysia coprophila GN=Kr PE=3 SV=1 427 487 2.0E-10
sp|Q804Q5|FEZF2_DANRE Fez family zinc finger protein 2 OS=Danio rerio GN=fezf2 PE=1 SV=2 434 487 2.0E-10
sp|P43301|EGR3_RAT Early growth response protein 3 OS=Rattus norvegicus GN=Egr3 PE=2 SV=1 432 485 2.0E-10
sp|Q06889|EGR3_HUMAN Early growth response protein 3 OS=Homo sapiens GN=EGR3 PE=2 SV=1 432 485 2.0E-10
sp|P51774|EGR2_RAT E3 SUMO-protein ligase EGR2 OS=Rattus norvegicus GN=Egr2 PE=2 SV=2 432 485 2.0E-10
sp|O73692|EGR1_COTJA Early growth response protein 1 (Fragment) OS=Coturnix coturnix japonica GN=EGR1 PE=3 SV=1 439 487 2.0E-10
sp|P43300|EGR3_MOUSE Early growth response protein 3 OS=Mus musculus GN=Egr3 PE=2 SV=2 432 485 2.0E-10
sp|P08152|EGR2_MOUSE E3 SUMO-protein ligase EGR2 OS=Mus musculus GN=Egr2 PE=1 SV=3 432 485 2.0E-10
sp|Q9JHX2|SP5_MOUSE Transcription factor Sp5 OS=Mus musculus GN=Sp5 PE=2 SV=1 432 485 2.0E-10
sp|P49910|ZN165_HUMAN Zinc finger protein 165 OS=Homo sapiens GN=ZNF165 PE=1 SV=1 432 492 2.0E-10
sp|O73693|EGR1_TAEGU Early growth response protein 1 (Fragment) OS=Taeniopygia guttata GN=EGR1 PE=3 SV=1 432 485 3.0E-10
sp|Q6BEB4|SP5_HUMAN Transcription factor Sp5 OS=Homo sapiens GN=SP5 PE=2 SV=1 432 485 3.0E-10
sp|Q62396|ZFP92_MOUSE Zinc finger protein 92 OS=Mus musculus GN=Zfp92 PE=2 SV=2 434 487 3.0E-10
sp|P11161|EGR2_HUMAN E3 SUMO-protein ligase EGR2 OS=Homo sapiens GN=EGR2 PE=1 SV=3 432 485 3.0E-10
sp|Q5A4H5|CRZ1_CANAL Transcriptional regulator CRZ1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRZ1 PE=1 SV=1 413 487 3.0E-10
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 423 487 3.0E-10
sp|Q9D2H6|SP2_MOUSE Transcription factor Sp2 OS=Mus musculus GN=Sp2 PE=2 SV=2 434 487 4.0E-10
sp|P43301|EGR3_RAT Early growth response protein 3 OS=Rattus norvegicus GN=Egr3 PE=2 SV=1 410 487 4.0E-10
sp|Q06889|EGR3_HUMAN Early growth response protein 3 OS=Homo sapiens GN=EGR3 PE=2 SV=1 410 487 4.0E-10
sp|P43300|EGR3_MOUSE Early growth response protein 3 OS=Mus musculus GN=Egr3 PE=2 SV=2 410 487 4.0E-10
sp|Q6ZSB9|ZBT49_HUMAN Zinc finger and BTB domain-containing protein 49 OS=Homo sapiens GN=ZBTB49 PE=1 SV=3 424 487 4.0E-10
sp|Q5ANC8|TRY4_CANAL Transcriptional regulator of yeast form adherence 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TRY4 PE=2 SV=1 432 496 4.0E-10
sp|P18724|ZG49_XENLA Gastrula zinc finger protein XlCGF49.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 432 485 4.0E-10
sp|Q24266|BTD_DROME Transcription factor btd OS=Drosophila melanogaster GN=btd PE=2 SV=1 412 485 4.0E-10
sp|A1XSY8|EGR2_PIG E3 SUMO-protein ligase EGR2 OS=Sus scrofa GN=EGR2 PE=2 SV=1 422 487 5.0E-10
sp|P51774|EGR2_RAT E3 SUMO-protein ligase EGR2 OS=Rattus norvegicus GN=Egr2 PE=2 SV=2 422 487 5.0E-10
sp|O73692|EGR1_COTJA Early growth response protein 1 (Fragment) OS=Coturnix coturnix japonica GN=EGR1 PE=3 SV=1 432 485 5.0E-10
sp|P08152|EGR2_MOUSE E3 SUMO-protein ligase EGR2 OS=Mus musculus GN=Egr2 PE=1 SV=3 422 487 5.0E-10
sp|P19544|WT1_HUMAN Wilms tumor protein OS=Homo sapiens GN=WT1 PE=1 SV=2 432 487 5.0E-10
sp|O62651|WT1_PIG Wilms tumor protein homolog OS=Sus scrofa GN=WT1 PE=2 SV=1 432 487 5.0E-10
sp|O73691|EGR1_CHICK Early growth response protein 1 (Fragment) OS=Gallus gallus GN=EGR1 PE=3 SV=1 439 487 5.0E-10
sp|Q91ZD1|OSR2_MOUSE Protein odd-skipped-related 2 OS=Mus musculus GN=Osr2 PE=1 SV=1 427 485 5.0E-10
sp|Q05215|EGR4_HUMAN Early growth response protein 4 OS=Homo sapiens GN=EGR4 PE=2 SV=3 387 485 5.0E-10
sp|Q8N2R0|OSR2_HUMAN Protein odd-skipped-related 2 OS=Homo sapiens GN=OSR2 PE=1 SV=2 427 485 5.0E-10
sp|P39943|MIG3_YEAST Transcription corepressor MIG3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIG3 PE=1 SV=1 434 489 5.0E-10
sp|P11161|EGR2_HUMAN E3 SUMO-protein ligase EGR2 OS=Homo sapiens GN=EGR2 PE=1 SV=3 422 487 6.0E-10
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 427 486 6.0E-10
sp|Q8TDD2|SP7_HUMAN Transcription factor Sp7 OS=Homo sapiens GN=SP7 PE=1 SV=1 432 485 6.0E-10
sp|Q9UNY5|ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens GN=ZNF232 PE=1 SV=1 432 487 6.0E-10
sp|A8MWA4|Z705E_HUMAN Putative zinc finger protein 705E OS=Homo sapiens GN=ZNF705E PE=3 SV=1 340 487 7.0E-10
sp|P49952|WT1_RAT Wilms tumor protein homolog OS=Rattus norvegicus GN=Wt1 PE=2 SV=1 432 487 7.0E-10
sp|P22561|WT1_MOUSE Wilms tumor protein homolog OS=Mus musculus GN=Wt1 PE=1 SV=1 432 487 7.0E-10
sp|B7ZSG3|WT1A_XENLA Wilms tumor protein homolog A OS=Xenopus laevis GN=wt1-a PE=2 SV=1 432 487 7.0E-10
sp|Q08427|EGR2_XENLA Early growth response protein 2 OS=Xenopus laevis GN=egr2 PE=2 SV=1 432 485 7.0E-10
sp|Q9UDV7|ZN282_HUMAN Zinc finger protein 282 OS=Homo sapiens GN=ZNF282 PE=2 SV=3 423 487 7.0E-10
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 432 487 7.0E-10
sp|Q9GL32|EGR4_BOVIN Early growth response protein 4 OS=Bos taurus GN=EGR4 PE=2 SV=1 431 487 8.0E-10
sp|Q8VI67|SP7_MOUSE Transcription factor Sp7 OS=Mus musculus GN=Sp7 PE=1 SV=1 432 485 8.0E-10
sp|P0CI00|Z705B_HUMAN Putative zinc finger protein 705B OS=Homo sapiens GN=ZNF705B PE=5 SV=1 422 487 8.0E-10
sp|P07247|KRUP_DROME Protein krueppel OS=Drosophila melanogaster GN=Kr PE=1 SV=2 426 487 8.0E-10
sp|Q05159|EGR2B_DANRE Early growth response protein 2b OS=Danio rerio GN=egr2b PE=2 SV=1 432 485 9.0E-10
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 432 487 9.0E-10
sp|P18735|ZG7_XENLA Gastrula zinc finger protein XlCGF7.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 432 487 9.0E-10
sp|Q02086|SP2_HUMAN Transcription factor Sp2 OS=Homo sapiens GN=SP2 PE=1 SV=3 434 485 1.0E-09
sp|Q5E9U0|SP2_BOVIN Transcription factor Sp2 OS=Bos taurus GN=SP2 PE=2 SV=1 434 485 1.0E-09
sp|O73691|EGR1_CHICK Early growth response protein 1 (Fragment) OS=Gallus gallus GN=EGR1 PE=3 SV=1 432 485 1.0E-09
sp|P26635|EGR2_POERE Early growth response protein 2 (Fragment) OS=Poecilia reticulata GN=egr2 PE=3 SV=1 437 487 1.0E-09
sp|P0CH99|Z705D_HUMAN Zinc finger protein 705D OS=Homo sapiens GN=ZNF705D PE=2 SV=1 422 487 1.0E-09
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 432 487 1.0E-09
sp|A8MVS1|Z705F_HUMAN Zinc finger protein 705F OS=Homo sapiens GN=ZNF705F PE=3 SV=1 422 487 1.0E-09
sp|Q9HBT8|Z286A_HUMAN Zinc finger protein 286A OS=Homo sapiens GN=ZNF286A PE=1 SV=1 432 487 1.0E-09
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 423 487 1.0E-09
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 423 487 1.0E-09
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 423 487 1.0E-09
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 423 487 1.0E-09
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 432 487 1.0E-09
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 423 487 1.0E-09
sp|P50902|WT1_ALLMI Wilms tumor protein homolog (Fragment) OS=Alligator mississippiensis GN=WT1 PE=2 SV=1 432 487 1.0E-09
sp|P49953|WT1_SMIMA Wilms tumor protein homolog (Fragment) OS=Sminthopsis macroura GN=WT1 PE=2 SV=1 432 487 1.0E-09
sp|Q62445|SP4_MOUSE Transcription factor Sp4 OS=Mus musculus GN=Sp4 PE=2 SV=2 432 487 2.0E-09
sp|Q05215|EGR4_HUMAN Early growth response protein 4 OS=Homo sapiens GN=EGR4 PE=2 SV=3 431 487 2.0E-09
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 432 487 2.0E-09
sp|Q08427|EGR2_XENLA Early growth response protein 2 OS=Xenopus laevis GN=egr2 PE=2 SV=1 422 487 2.0E-09
sp|Q05159|EGR2B_DANRE Early growth response protein 2b OS=Danio rerio GN=egr2b PE=2 SV=1 437 487 2.0E-09
sp|O89090|SP1_MOUSE Transcription factor Sp1 OS=Mus musculus GN=Sp1 PE=1 SV=2 408 487 2.0E-09
sp|O89090|SP1_MOUSE Transcription factor Sp1 OS=Mus musculus GN=Sp1 PE=1 SV=2 434 485 2.0E-09
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 436 487 2.0E-09
sp|Q14119|VEZF1_HUMAN Vascular endothelial zinc finger 1 OS=Homo sapiens GN=VEZF1 PE=1 SV=2 436 488 2.0E-09
sp|Q01714|SP1_RAT Transcription factor Sp1 OS=Rattus norvegicus GN=Sp1 PE=1 SV=2 397 487 2.0E-09
sp|Q01714|SP1_RAT Transcription factor Sp1 OS=Rattus norvegicus GN=Sp1 PE=1 SV=2 434 485 2.0E-09
sp|P39956|RPH1_YEAST DNA damage-responsive transcriptional repressor RPH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPH1 PE=1 SV=1 390 481 2.0E-09
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 422 487 2.0E-09
sp|P26634|EGR2_CERTH E3 SUMO-protein ligase EGR2 (Fragment) OS=Cerdocyon thous GN=EGR2 PE=3 SV=1 437 487 2.0E-09
sp|P08047|SP1_HUMAN Transcription factor Sp1 OS=Homo sapiens GN=SP1 PE=1 SV=3 434 485 2.0E-09
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 418 485 2.0E-09
sp|P18712|ZG16_XENLA Gastrula zinc finger protein XlCGF16.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 423 487 2.0E-09
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 422 487 2.0E-09
sp|P52288|MIG1_KLUMA Regulatory protein MIG1 OS=Kluyveromyces marxianus GN=MIG1 PE=3 SV=1 415 485 2.0E-09
sp|Q00453|RGM1_YEAST Probable transcription repressor protein RGM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGM1 PE=1 SV=2 439 494 2.0E-09
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 432 487 2.0E-09
sp|P41696|AZF1_YEAST Asparagine-rich zinc finger protein AZF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZF1 PE=1 SV=1 432 485 2.0E-09
sp|Q3SXZ3|ZN718_HUMAN Zinc finger protein 718 OS=Homo sapiens GN=ZNF718 PE=2 SV=1 418 490 2.0E-09
sp|Q07231|ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus GN=Zscan21 PE=2 SV=2 337 485 2.0E-09
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 334 487 2.0E-09
sp|Q9VQU9|BOWEL_DROME Protein bowel OS=Drosophila melanogaster GN=bowl PE=1 SV=1 427 485 2.0E-09
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 423 487 2.0E-09
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 383 487 2.0E-09
sp|Q02446|SP4_HUMAN Transcription factor Sp4 OS=Homo sapiens GN=SP4 PE=1 SV=2 432 487 3.0E-09
sp|Q49AA0|ZFP69_HUMAN Zinc finger protein ZFP69 OS=Homo sapiens GN=ZFP69 PE=2 SV=2 415 487 3.0E-09
sp|A1DH89|CREA_NEOFI Probable DNA-binding protein creA OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=creA PE=3 SV=1 390 485 3.0E-09
sp|P46974|RSF2_YEAST Respiration factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSF2 PE=1 SV=1 413 499 3.0E-09
sp|Q8NB42|ZN527_HUMAN Zinc finger protein 527 OS=Homo sapiens GN=ZNF527 PE=2 SV=2 427 487 3.0E-09
sp|P23803|ODD_DROME Protein odd-skipped OS=Drosophila melanogaster GN=odd PE=2 SV=3 427 485 3.0E-09
sp|Q9NR11|ZN302_HUMAN Zinc finger protein 302 OS=Homo sapiens GN=ZNF302 PE=1 SV=1 335 487 3.0E-09
sp|Q9VQS7|SOB_DROME Protein sister of odd and bowel OS=Drosophila melanogaster GN=sob PE=2 SV=1 434 485 3.0E-09
sp|O14335|SCR1_SCHPO DNA-binding protein scr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=scr1 PE=3 SV=1 421 485 3.0E-09
sp|Q25515|KRUP_MANSE Protein krueppel (Fragment) OS=Manduca sexta GN=Kr PE=2 SV=1 427 487 3.0E-09
sp|P41995|ODD1_CAEEL Zinc finger protein odd-1 OS=Caenorhabditis elegans GN=odd-1 PE=2 SV=2 390 486 3.0E-09
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 434 487 4.0E-09
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 434 487 4.0E-09
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 428 487 4.0E-09
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 428 487 4.0E-09
sp|Q9UJL9|ZF69B_HUMAN Zinc finger protein ZFP69B OS=Homo sapiens GN=ZFP69B PE=1 SV=2 432 487 4.0E-09
sp|O94166|CREA_ASPAC DNA-binding protein creA OS=Aspergillus aculeatus GN=creA PE=3 SV=1 420 485 4.0E-09
sp|Q61624|ZN148_MOUSE Zinc finger protein 148 OS=Mus musculus GN=Znf148 PE=1 SV=2 417 487 4.0E-09
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 434 488 4.0E-09
sp|O94131|CREA_GIBFU DNA-binding protein creA OS=Gibberella fujikuroi GN=CREA PE=3 SV=1 408 485 4.0E-09
sp|Q62806|ZN148_RAT Zinc finger protein 148 OS=Rattus norvegicus GN=Znf148 PE=1 SV=1 417 487 5.0E-09
sp|A3KN36|ZNF19_BOVIN Zinc finger protein 19 OS=Bos taurus GN=ZNF19 PE=2 SV=1 408 487 5.0E-09
sp|A0MS83|ZN148_DANRE Zinc finger protein 148 OS=Danio rerio GN=znf148 PE=2 SV=2 417 487 5.0E-09
sp|Q90850|HIC1_CHICK Hypermethylated in cancer 1 protein (Fragment) OS=Gallus gallus GN=HIC1 PE=2 SV=2 432 488 5.0E-09
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 432 487 5.0E-09
sp|Q9UQR1|ZN148_HUMAN Zinc finger protein 148 OS=Homo sapiens GN=ZNF148 PE=1 SV=2 417 487 5.0E-09
sp|Q5R782|ZN148_PONAB Zinc finger protein 148 OS=Pongo abelii GN=ZNF148 PE=2 SV=1 417 487 5.0E-09
sp|Q96CX3|ZN501_HUMAN Zinc finger protein 501 OS=Homo sapiens GN=ZNF501 PE=2 SV=2 427 487 5.0E-09
sp|Q05620|CREA_ASPNG DNA-binding protein creA OS=Aspergillus niger GN=creA PE=3 SV=1 424 485 5.0E-09
sp|A2QCJ9|CREA_ASPNC Probable DNA-binding protein creA OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=creA PE=3 SV=1 424 485 5.0E-09
sp|Q5RF70|ZN501_PONAB Zinc finger protein 501 OS=Pongo abelii GN=ZNF501 PE=2 SV=3 427 487 5.0E-09
sp|Q9Y2Y9|KLF13_HUMAN Krueppel-like factor 13 OS=Homo sapiens GN=KLF13 PE=1 SV=1 427 486 5.0E-09
sp|Q3Y4E1|ZN148_BOVIN Zinc finger protein 148 OS=Bos taurus GN=ZNF148 PE=2 SV=1 417 487 5.0E-09
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 419 487 6.0E-09
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 419 487 6.0E-09
sp|Q8NB42|ZN527_HUMAN Zinc finger protein 527 OS=Homo sapiens GN=ZNF527 PE=2 SV=2 432 487 6.0E-09
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 434 488 6.0E-09
sp|Q9JJZ6|KLF13_MOUSE Krueppel-like factor 13 OS=Mus musculus GN=Klf13 PE=1 SV=2 427 501 6.0E-09
sp|Q8TD94|KLF14_HUMAN Krueppel-like factor 14 OS=Homo sapiens GN=KLF14 PE=2 SV=1 422 485 6.0E-09
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 432 487 6.0E-09
sp|O93567|ZBT7A_CHICK Zinc finger and BTB domain-containing protein 7A OS=Gallus gallus GN=ZBTB7A PE=2 SV=1 427 487 6.0E-09
sp|Q19A41|KLF14_MOUSE Krueppel-like factor 14 OS=Mus musculus GN=Klf14 PE=2 SV=1 411 487 6.0E-09
sp|Q5EXX3|ZBT38_RAT Zinc finger and BTB domain-containing protein 38 OS=Rattus norvegicus GN=Zbtb38 PE=2 SV=1 424 487 6.0E-09
sp|Q9H963|ZN702_HUMAN Putative zinc finger protein 702 OS=Homo sapiens GN=ZNF702P PE=5 SV=2 432 487 6.0E-09
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 432 487 6.0E-09
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 428 487 6.0E-09
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 434 487 7.0E-09
sp|Q01981|CREA_EMENI DNA-binding protein creA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=creA PE=1 SV=1 428 485 7.0E-09
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 432 487 7.0E-09
sp|P18731|ZG62_XENLA Gastrula zinc finger protein XlCGF62.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 427 487 7.0E-09
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 434 487 7.0E-09
sp|Q5A0E5|NRG1_CANAL Transcriptional regulator NRG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NRG1 PE=2 SV=1 427 509 7.0E-09
sp|O75626|PRDM1_HUMAN PR domain zinc finger protein 1 OS=Homo sapiens GN=PRDM1 PE=1 SV=2 434 487 7.0E-09
sp|Q90WR8|SP3_CHICK Transcription factor Sp3 OS=Gallus gallus GN=SP3 PE=1 SV=1 432 487 8.0E-09
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 434 487 8.0E-09
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 419 487 8.0E-09
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 419 487 8.0E-09
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 432 487 8.0E-09
sp|Q19A40|KLF14_PANTR Krueppel-like factor 14 OS=Pan troglodytes GN=KLF14 PE=3 SV=1 422 485 8.0E-09
sp|Q14V87|KLF14_GORGO Krueppel-like factor 14 OS=Gorilla gorilla gorilla GN=KLF14 PE=3 SV=1 422 485 8.0E-09
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 432 487 8.0E-09
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 432 487 8.0E-09
sp|Q802Y8|ZB16A_DANRE Zinc finger and BTB domain-containing protein 16-A OS=Danio rerio GN=zbtb16a PE=1 SV=1 434 487 8.0E-09
sp|Q60636|PRDM1_MOUSE PR domain zinc finger protein 1 OS=Mus musculus GN=Prdm1 PE=1 SV=1 434 487 8.0E-09
sp|Q05516|ZBT16_HUMAN Zinc finger and BTB domain-containing protein 16 OS=Homo sapiens GN=ZBTB16 PE=1 SV=2 434 487 8.0E-09
sp|P17098|ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens GN=ZNF8 PE=2 SV=2 423 487 8.0E-09
sp|Q6NW96|SP9_DANRE Transcription factor Sp9 OS=Danio rerio GN=sp9 PE=2 SV=1 434 485 8.0E-09
sp|Q16587|ZNF74_HUMAN Zinc finger protein 74 OS=Homo sapiens GN=ZNF74 PE=2 SV=3 402 487 8.0E-09
sp|Q9P889|CREA_ASPOR DNA-binding protein creA OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=creA PE=3 SV=1 428 485 8.0E-09
sp|B8NGC8|CREA_ASPFN Probable DNA-binding protein creA OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=creA PE=3 SV=1 428 485 8.0E-09
sp|Q2KI58|ZN181_BOVIN Zinc finger protein 181 OS=Bos taurus GN=ZNF181 PE=2 SV=1 366 487 8.0E-09
sp|B0XSK6|CREA_ASPFC Probable DNA-binding protein creA OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=creA PE=3 SV=1 428 485 8.0E-09
sp|Q9UDV7|ZN282_HUMAN Zinc finger protein 282 OS=Homo sapiens GN=ZNF282 PE=2 SV=3 431 488 9.0E-09
sp|Q64HY5|SP8_CHICK Transcription factor Sp8 OS=Gallus gallus GN=SP8 PE=2 SV=1 432 486 9.0E-09
sp|Q8IXZ3|SP8_HUMAN Transcription factor Sp8 OS=Homo sapiens GN=SP8 PE=2 SV=3 432 485 9.0E-09
sp|Q6P0J3|SP8_DANRE Transcription factor Sp8 OS=Danio rerio GN=sp8b PE=2 SV=1 434 485 9.0E-09
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 432 487 9.0E-09
sp|Q8BMJ8|SP8_MOUSE Transcription factor Sp8 OS=Mus musculus GN=Sp8 PE=2 SV=1 432 485 9.0E-09
sp|P08155|KRH1_DROME Krueppel homolog 1 OS=Drosophila melanogaster GN=Kr-h1 PE=2 SV=2 358 487 9.0E-09
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 432 487 9.0E-09
sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=ZNF3 PE=1 SV=3 436 487 9.0E-09
sp|Q4X0Z3|CREA_ASPFU Probable DNA-binding protein creA OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=creA PE=3 SV=1 428 485 9.0E-09
sp|A1YG60|ZKSC8_PANPA Zinc finger protein with KRAB and SCAN domains 8 OS=Pan paniscus GN=ZKSCAN8 PE=3 SV=1 432 487 9.0E-09
sp|A2T736|ZKSC8_PANTR Zinc finger protein with KRAB and SCAN domains 8 OS=Pan troglodytes GN=ZKSCAN8 PE=3 SV=1 432 487 9.0E-09
sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 427 487 9.0E-09
sp|A1L1L7|ZN426_RAT Zinc finger protein 426 OS=Rattus norvegicus GN=Znf426 PE=2 SV=1 427 487 9.0E-09
sp|Q02447|SP3_HUMAN Transcription factor Sp3 OS=Homo sapiens GN=SP3 PE=1 SV=3 432 487 1.0E-08
sp|Q9JHX2|SP5_MOUSE Transcription factor Sp5 OS=Mus musculus GN=Sp5 PE=2 SV=1 432 487 1.0E-08
sp|P18724|ZG49_XENLA Gastrula zinc finger protein XlCGF49.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 432 487 1.0E-08
sp|P18724|ZG49_XENLA Gastrula zinc finger protein XlCGF49.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 432 487 1.0E-08
sp|P18735|ZG7_XENLA Gastrula zinc finger protein XlCGF7.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 416 485 1.0E-08
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 432 487 1.0E-08
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 420 487 1.0E-08
sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=ZNF3 PE=1 SV=3 432 487 1.0E-08
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 422 487 1.0E-08
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 432 487 1.0E-08
sp|P39413|AEF1_DROME Adult enhancer factor 1 OS=Drosophila melanogaster GN=Aef1 PE=2 SV=1 429 487 1.0E-08
sp|Q15776|ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens GN=ZKSCAN8 PE=1 SV=2 432 487 1.0E-08
sp|Q3U3I9|ZN865_MOUSE Zinc finger protein 865 OS=Mus musculus GN=Znf865 PE=2 SV=1 431 485 1.0E-08
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 432 487 1.0E-08
sp|Q64HY3|SP9_MOUSE Transcription factor Sp9 OS=Mus musculus GN=Sp9 PE=1 SV=1 434 485 1.0E-08
sp|P0CG40|SP9_HUMAN Transcription factor Sp9 OS=Homo sapiens GN=SP9 PE=3 SV=1 434 485 1.0E-08
sp|Q0VA40|SP9_XENTR Transcription factor Sp9 OS=Xenopus tropicalis GN=sp9 PE=2 SV=1 434 485 1.0E-08
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 423 487 1.0E-08
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 423 487 1.0E-08
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 334 487 1.0E-08
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 435 487 1.0E-08
sp|Q3B7M4|ZN746_BOVIN Zinc finger protein 746 OS=Bos taurus GN=ZNF746 PE=2 SV=1 432 489 1.0E-08
sp|A1C6L9|CREA_ASPCL Probable DNA-binding protein creA OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=creA PE=3 SV=1 428 485 1.0E-08
sp|Q9Z2K3|ZN394_RAT Zinc finger protein 394 OS=Rattus norvegicus GN=Znf394 PE=2 SV=1 434 487 1.0E-08
sp|Q8R1D1|ZN426_MOUSE Zinc finger protein 426 OS=Mus musculus GN=Znf426 PE=2 SV=1 427 487 1.0E-08
sp|Q5XGT8|SP8_XENLA Transcription factor Sp8 OS=Xenopus laevis GN=sp8 PE=2 SV=1 432 485 1.0E-08
sp|Q8BIF9|ZN787_MOUSE Zinc finger protein 787 OS=Mus musculus GN=Znf787 PE=2 SV=3 436 487 1.0E-08
sp|Q15973|ZN124_HUMAN Zinc finger protein 124 OS=Homo sapiens GN=ZNF124 PE=1 SV=2 328 487 1.0E-08
sp|Q9Y2Q1|ZN257_HUMAN Zinc finger protein 257 OS=Homo sapiens GN=ZNF257 PE=2 SV=2 423 485 1.0E-08
sp|Q6NUN9|ZN746_HUMAN Zinc finger protein 746 OS=Homo sapiens GN=ZNF746 PE=1 SV=1 432 489 1.0E-08
sp|Q58DK7|ZN205_BOVIN Zinc finger protein 205 OS=Bos taurus GN=ZNF205 PE=2 SV=1 427 487 1.0E-08
sp|Q15929|ZNF56_HUMAN Putative zinc finger protein 56 OS=Homo sapiens GN=ZNF56 PE=5 SV=2 432 488 1.0E-08
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 427 487 1.0E-08
sp|Q9Z1D9|ZN394_MOUSE Zinc finger protein 394 OS=Mus musculus GN=Znf394 PE=2 SV=3 432 487 1.0E-08
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 383 487 1.0E-08
sp|Q9Z1D8|ZKSC5_MOUSE Zinc finger protein with KRAB and SCAN domains 5 OS=Mus musculus GN=Zkscan5 PE=2 SV=2 432 486 1.0E-08
sp|Q9BXK1|KLF16_HUMAN Krueppel-like factor 16 OS=Homo sapiens GN=KLF16 PE=1 SV=1 427 487 1.0E-08
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 434 487 1.0E-08
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 432 487 2.0E-08
sp|P18738|ZG9_XENLA Gastrula zinc finger protein XlCGF9.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 432 487 2.0E-08
sp|P49910|ZN165_HUMAN Zinc finger protein 165 OS=Homo sapiens GN=ZNF165 PE=1 SV=1 420 487 2.0E-08
sp|Q6BEB4|SP5_HUMAN Transcription factor Sp5 OS=Homo sapiens GN=SP5 PE=2 SV=1 432 487 2.0E-08
sp|Q62396|ZFP92_MOUSE Zinc finger protein 92 OS=Mus musculus GN=Zfp92 PE=2 SV=2 396 487 2.0E-08
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 432 494 2.0E-08
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 432 494 2.0E-08
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 432 487 2.0E-08
sp|P23803|ODD_DROME Protein odd-skipped OS=Drosophila melanogaster GN=odd PE=2 SV=3 430 486 2.0E-08
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 427 487 2.0E-08
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 427 487 2.0E-08
sp|A0MS83|ZN148_DANRE Zinc finger protein 148 OS=Danio rerio GN=znf148 PE=2 SV=2 432 487 2.0E-08
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 432 487 2.0E-08
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 432 487 2.0E-08
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 423 487 2.0E-08
sp|O43829|ZBT14_HUMAN Zinc finger and BTB domain-containing protein 14 OS=Homo sapiens GN=ZBTB14 PE=1 SV=2 420 487 2.0E-08
sp|P0CJ78|ZN865_HUMAN Zinc finger protein 865 OS=Homo sapiens GN=ZNF865 PE=3 SV=1 430 485 2.0E-08
sp|A6NGD5|ZSA5C_HUMAN Putative zinc finger and SCAN domain-containing protein 5C OS=Homo sapiens GN=ZSCAN5CP PE=5 SV=1 434 487 2.0E-08
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 434 487 2.0E-08
sp|Q9UC06|ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens GN=ZNF70 PE=2 SV=2 436 487 2.0E-08
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 423 487 2.0E-08
sp|O59958|CRE1_NEUCR DNA-binding protein cre-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cre-1 PE=2 SV=2 432 486 2.0E-08
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 432 487 2.0E-08
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 432 487 2.0E-08
sp|Q92010|ZBT14_CHICK Zinc finger and BTB domain-containing protein 14 OS=Gallus gallus GN=ZBTB14 PE=2 SV=1 420 487 2.0E-08
sp|Q08376|ZBT14_MOUSE Zinc finger and BTB domain-containing protein 14 OS=Mus musculus GN=Zbtb14 PE=2 SV=1 420 487 2.0E-08
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 432 487 2.0E-08
sp|P17039|ZNF30_HUMAN Zinc finger protein 30 OS=Homo sapiens GN=ZNF30 PE=2 SV=5 432 487 2.0E-08
sp|Q8K1S5|KLF11_MOUSE Krueppel-like factor 11 OS=Mus musculus GN=Klf11 PE=2 SV=3 432 487 2.0E-08
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 432 487 2.0E-08
sp|O88939|ZBT7A_MOUSE Zinc finger and BTB domain-containing protein 7A OS=Mus musculus GN=Zbtb7a PE=1 SV=2 427 487 2.0E-08
sp|P18740|ZO14_XENLA Oocyte zinc finger protein XlCOF14 (Fragment) OS=Xenopus laevis PE=3 SV=1 433 487 2.0E-08
sp|Q8SUR9|Z856_ENCCU Zinc finger C2H2 protein ECU08_0560 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_0560 PE=3 SV=2 420 486 2.0E-08
sp|Q9QZ48|ZBT7A_RAT Zinc finger and BTB domain-containing protein 7A OS=Rattus norvegicus GN=Zbtb7a PE=1 SV=1 427 487 2.0E-08
sp|Q5RJR4|ZN467_RAT Zinc finger protein 467 OS=Rattus norvegicus GN=Znf467 PE=2 SV=1 432 487 2.0E-08
sp|Q3KNS6|ZN829_HUMAN Zinc finger protein 829 OS=Homo sapiens GN=ZNF829 PE=2 SV=1 432 487 2.0E-08
sp|O14901|KLF11_HUMAN Krueppel-like factor 11 OS=Homo sapiens GN=KLF11 PE=1 SV=2 432 487 2.0E-08
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 427 487 2.0E-08
sp|Q29W20|EGR1_BOVIN Early growth response protein 1 OS=Bos taurus GN=EGR1 PE=2 SV=1 436 485 2.0E-08
sp|Q66K89|E4F1_HUMAN Transcription factor E4F1 OS=Homo sapiens GN=E4F1 PE=1 SV=2 405 499 2.0E-08
sp|Q9ULD5|ZN777_HUMAN Zinc finger protein 777 OS=Homo sapiens GN=ZNF777 PE=1 SV=2 433 486 2.0E-08
sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens GN=ZNF606 PE=2 SV=1 383 487 2.0E-08
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 432 487 2.0E-08
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 423 487 2.0E-08
sp|Q5A4K7|TRY5_CANAL Transcriptional regulator of yeast form adherence 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TRY5 PE=3 SV=1 432 484 2.0E-08
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 427 487 2.0E-08
sp|Q8NDX6|ZN740_HUMAN Zinc finger protein 740 OS=Homo sapiens GN=ZNF740 PE=1 SV=1 432 487 2.0E-08
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 422 487 2.0E-08
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 432 487 2.0E-08
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 432 487 2.0E-08
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 427 487 2.0E-08
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 432 487 2.0E-08
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 434 487 2.0E-08
sp|Q9UL36|ZN236_HUMAN Zinc finger protein 236 OS=Homo sapiens GN=ZNF236 PE=2 SV=2 428 487 2.0E-08
sp|O95365|ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A OS=Homo sapiens GN=ZBTB7A PE=1 SV=1 427 487 2.0E-08
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 432 487 2.0E-08
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 423 487 2.0E-08
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 432 487 2.0E-08
sp|Q6ZMY9|ZN517_HUMAN Zinc finger protein 517 OS=Homo sapiens GN=ZNF517 PE=2 SV=2 423 487 2.0E-08
sp|Q6ZNG1|ZN600_HUMAN Zinc finger protein 600 OS=Homo sapiens GN=ZNF600 PE=1 SV=2 383 491 2.0E-08
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 432 487 3.0E-08
sp|Q9UNY5|ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens GN=ZNF232 PE=1 SV=1 432 487 3.0E-08
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 432 487 3.0E-08
sp|Q9VQU9|BOWEL_DROME Protein bowel OS=Drosophila melanogaster GN=bowl PE=1 SV=1 430 486 3.0E-08
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 422 490 3.0E-08
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 392 487 3.0E-08
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 432 487 3.0E-08
sp|Q9JJZ6|KLF13_MOUSE Krueppel-like factor 13 OS=Mus musculus GN=Klf13 PE=1 SV=2 428 487 3.0E-08
sp|Q19A41|KLF14_MOUSE Krueppel-like factor 14 OS=Mus musculus GN=Klf14 PE=2 SV=1 434 485 3.0E-08
sp|Q15929|ZNF56_HUMAN Putative zinc finger protein 56 OS=Homo sapiens GN=ZNF56 PE=5 SV=2 432 487 3.0E-08
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 432 487 3.0E-08
sp|Q8NDX6|ZN740_HUMAN Zinc finger protein 740 OS=Homo sapiens GN=ZNF740 PE=1 SV=1 422 487 3.0E-08
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 427 487 3.0E-08
sp|P18722|ZG46_XENLA Gastrula zinc finger protein XlCGF46.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 434 487 3.0E-08
sp|P50898|MIG1_KLULA Regulatory protein MIG1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MIG1 PE=3 SV=1 415 485 3.0E-08
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 432 487 3.0E-08
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 432 487 3.0E-08
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 432 487 3.0E-08
sp|Q9HFS2|CREA_COCCA DNA-binding protein creA OS=Cochliobolus carbonum GN=CREA PE=2 SV=1 428 485 3.0E-08
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 432 487 3.0E-08
sp|O89091|KLF10_MOUSE Krueppel-like factor 10 OS=Mus musculus GN=Klf10 PE=1 SV=1 432 494 3.0E-08
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 423 487 3.0E-08
sp|Q1LZC0|ZNF22_BOVIN Zinc finger protein 22 OS=Bos taurus GN=ZNF22 PE=2 SV=1 432 487 3.0E-08
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 434 487 3.0E-08
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 423 487 3.0E-08
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 427 490 3.0E-08
sp|Q921B4|NRIF2_MOUSE Neurotrophin receptor-interacting factor 2 OS=Mus musculus GN=Nrif2 PE=1 SV=1 427 485 3.0E-08
sp|Q96GC6|ZN274_HUMAN Neurotrophin receptor-interacting factor homolog OS=Homo sapiens GN=ZNF274 PE=1 SV=2 431 485 3.0E-08
sp|Q7Z7K2|ZN467_HUMAN Zinc finger protein 467 OS=Homo sapiens GN=ZNF467 PE=2 SV=1 432 487 3.0E-08
sp|Q6AZW8|ZN660_HUMAN Zinc finger protein 660 OS=Homo sapiens GN=ZNF660 PE=1 SV=1 432 490 3.0E-08
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 386 487 3.0E-08
sp|Q4R8H9|ZN274_MACFA Neurotrophin receptor-interacting factor homolog OS=Macaca fascicularis GN=ZNF274 PE=2 SV=1 431 485 3.0E-08
sp|Q96JB3|HIC2_HUMAN Hypermethylated in cancer 2 protein OS=Homo sapiens GN=HIC2 PE=1 SV=2 432 485 3.0E-08
sp|O75290|Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens GN=ZNF780A PE=2 SV=3 432 487 3.0E-08
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 427 487 3.0E-08
sp|Q9JLZ6|HIC2_MOUSE Hypermethylated in cancer 2 protein OS=Mus musculus GN=Hic2 PE=2 SV=4 432 485 3.0E-08
sp|O08876|KLF10_RAT Krueppel-like factor 10 OS=Rattus norvegicus GN=Klf10 PE=2 SV=1 432 494 3.0E-08
sp|Q571J5|Z354C_MOUSE Zinc finger protein 354C OS=Mus musculus GN=Znf354c PE=2 SV=2 432 503 3.0E-08
sp|P58334|KLF16_MOUSE Krueppel-like factor 16 OS=Mus musculus GN=Klf16 PE=1 SV=2 427 487 3.0E-08
sp|Q3U133|ZN746_MOUSE Zinc finger protein 746 OS=Mus musculus GN=Znf746 PE=1 SV=3 431 487 3.0E-08
sp|Q59U10|BCR1_CANAL Biofilm and cell wall regulator 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BCR1 PE=1 SV=1 439 484 3.0E-08
sp|Q8N143|BCL6B_HUMAN B-cell CLL/lymphoma 6 member B protein OS=Homo sapiens GN=BCL6B PE=2 SV=2 429 487 3.0E-08
sp|Q9BWM5|ZN416_HUMAN Zinc finger protein 416 OS=Homo sapiens GN=ZNF416 PE=2 SV=1 434 487 3.0E-08
sp|Q92766|RREB1_HUMAN Ras-responsive element-binding protein 1 OS=Homo sapiens GN=RREB1 PE=1 SV=3 366 485 3.0E-08
sp|A6NHJ4|ZN860_HUMAN Zinc finger protein 860 OS=Homo sapiens GN=ZNF860 PE=2 SV=3 422 487 3.0E-08
sp|O62651|WT1_PIG Wilms tumor protein homolog OS=Sus scrofa GN=WT1 PE=2 SV=1 367 487 4.0E-08
sp|P18735|ZG7_XENLA Gastrula zinc finger protein XlCGF7.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 432 487 4.0E-08
sp|Q8TD94|KLF14_HUMAN Krueppel-like factor 14 OS=Homo sapiens GN=KLF14 PE=2 SV=1 422 487 4.0E-08
sp|Q6NW96|SP9_DANRE Transcription factor Sp9 OS=Danio rerio GN=sp9 PE=2 SV=1 439 487 4.0E-08
sp|Q9Y2Q1|ZN257_HUMAN Zinc finger protein 257 OS=Homo sapiens GN=ZNF257 PE=2 SV=2 423 485 4.0E-08
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 427 487 4.0E-08
sp|Q9UL36|ZN236_HUMAN Zinc finger protein 236 OS=Homo sapiens GN=ZNF236 PE=2 SV=2 434 498 4.0E-08
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 427 487 4.0E-08
sp|Q96N58|ZN578_HUMAN Zinc finger protein 578 OS=Homo sapiens GN=ZNF578 PE=2 SV=2 432 487 4.0E-08
sp|Q9Y6Q3|ZFP37_HUMAN Zinc finger protein 37 homolog OS=Homo sapiens GN=ZFP37 PE=2 SV=3 434 487 4.0E-08
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 422 487 4.0E-08
sp|Q13118|KLF10_HUMAN Krueppel-like factor 10 OS=Homo sapiens GN=KLF10 PE=1 SV=1 432 494 4.0E-08
sp|P28166|ZFH1_DROME Zinc finger protein 1 OS=Drosophila melanogaster GN=zfh1 PE=1 SV=2 379 487 4.0E-08
sp|Q9BS34|ZN670_HUMAN Zinc finger protein 670 OS=Homo sapiens GN=ZNF670 PE=1 SV=1 422 487 4.0E-08
sp|Q90W33|HIC2_DANRE Hypermethylated in cancer 2 protein OS=Danio rerio GN=hic2 PE=2 SV=1 432 486 4.0E-08
sp|P18744|ZO20_XENLA Oocyte zinc finger protein XlCOF20 (Fragment) OS=Xenopus laevis PE=3 SV=1 432 487 4.0E-08
sp|P10075|GLI4_HUMAN Zinc finger protein GLI4 OS=Homo sapiens GN=GLI4 PE=1 SV=2 423 487 4.0E-08
sp|Q6PDB4|ZN880_HUMAN Zinc finger protein 880 OS=Homo sapiens GN=ZNF880 PE=2 SV=2 432 487 4.0E-08
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 434 487 4.0E-08
sp|Q12132|USV1_YEAST Nutrient and stress factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=USV1 PE=1 SV=1 398 481 4.0E-08
sp|Q9EPU7|Z354C_RAT Zinc finger protein 354C OS=Rattus norvegicus GN=Znf354c PE=1 SV=1 432 503 4.0E-08
sp|A6NM28|ZFP92_HUMAN Zinc finger protein 92 homolog OS=Homo sapiens GN=ZFP92 PE=2 SV=3 423 487 4.0E-08
sp|Q13351|KLF1_HUMAN Krueppel-like factor 1 OS=Homo sapiens GN=KLF1 PE=1 SV=1 427 485 4.0E-08
sp|Q9Y7G2|MIG1_CANAX Regulatory protein MIG1 OS=Candida albicans GN=MIG1 PE=3 SV=1 411 487 4.0E-08
sp|Q8TD17|ZN398_HUMAN Zinc finger protein 398 OS=Homo sapiens GN=ZNF398 PE=1 SV=1 423 487 4.0E-08
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 422 487 4.0E-08
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 422 487 4.0E-08
sp|A7MBI1|ZFP69_BOVIN Zinc finger protein ZFP69 OS=Bos taurus GN=ZFP69 PE=2 SV=1 432 487 4.0E-08
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 432 487 4.0E-08
sp|Q6ZS27|ZN662_HUMAN Zinc finger protein 662 OS=Homo sapiens GN=ZNF662 PE=1 SV=1 432 487 4.0E-08
sp|Q6DD87|ZN787_HUMAN Zinc finger protein 787 OS=Homo sapiens GN=ZNF787 PE=1 SV=3 423 487 4.0E-08
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 432 487 5.0E-08
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 434 490 5.0E-08
sp|Q3B7M4|ZN746_BOVIN Zinc finger protein 746 OS=Bos taurus GN=ZNF746 PE=2 SV=1 436 487 5.0E-08
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 434 487 5.0E-08
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 432 486 5.0E-08
sp|Q9Y6Q3|ZFP37_HUMAN Zinc finger protein 37 homolog OS=Homo sapiens GN=ZFP37 PE=2 SV=3 432 487 5.0E-08
sp|P10075|GLI4_HUMAN Zinc finger protein GLI4 OS=Homo sapiens GN=GLI4 PE=1 SV=2 381 487 5.0E-08
sp|Q9HBE1|PATZ1_HUMAN POZ-, AT hook-, and zinc finger-containing protein 1 OS=Homo sapiens GN=PATZ1 PE=1 SV=1 422 487 5.0E-08
sp|P0CG31|Z286B_HUMAN Putative zinc finger protein 286B OS=Homo sapiens GN=ZNF286B PE=5 SV=1 432 487 5.0E-08
sp|Q9H0M5|ZN700_HUMAN Zinc finger protein 700 OS=Homo sapiens GN=ZNF700 PE=2 SV=1 422 487 5.0E-08
sp|Q5R7I8|ZNF19_PONAB Zinc finger protein 19 OS=Pongo abelii GN=ZNF19 PE=2 SV=1 358 487 5.0E-08
sp|P52736|ZN133_HUMAN Zinc finger protein 133 OS=Homo sapiens GN=ZNF133 PE=1 SV=2 427 487 5.0E-08
sp|Q86W11|ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens GN=ZSCAN30 PE=1 SV=1 432 487 5.0E-08
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 418 487 5.0E-08
sp|Q8IW36|ZN695_HUMAN Zinc finger protein 695 OS=Homo sapiens GN=ZNF695 PE=1 SV=4 432 487 5.0E-08
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 407 487 5.0E-08
sp|O75840|KLF7_HUMAN Krueppel-like factor 7 OS=Homo sapiens GN=KLF7 PE=2 SV=1 437 485 5.0E-08
sp|P51815|ZN75D_HUMAN Zinc finger protein 75D OS=Homo sapiens GN=ZNF75D PE=2 SV=2 423 487 5.0E-08
sp|Q68DY9|ZN772_HUMAN Zinc finger protein 772 OS=Homo sapiens GN=ZNF772 PE=1 SV=2 374 487 5.0E-08
sp|Q99JB0|KLF7_MOUSE Krueppel-like factor 7 OS=Mus musculus GN=Klf7 PE=2 SV=1 437 485 5.0E-08
sp|P13682|ZNF35_HUMAN Zinc finger protein 35 OS=Homo sapiens GN=ZNF35 PE=2 SV=4 420 487 5.0E-08
sp|Q9R1Y5|HIC1_MOUSE Hypermethylated in cancer 1 protein OS=Mus musculus GN=Hic1 PE=1 SV=4 432 485 5.0E-08
sp|O88282|BCL6B_MOUSE B-cell CLL/lymphoma 6 member B protein OS=Mus musculus GN=Bcl6b PE=1 SV=1 429 487 5.0E-08
sp|P18719|ZG32_XENLA Gastrula zinc finger protein XlCGF32.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 432 487 5.0E-08
sp|P18735|ZG7_XENLA Gastrula zinc finger protein XlCGF7.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 422 487 6.0E-08
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 432 487 6.0E-08
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 383 487 6.0E-08
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 432 487 6.0E-08
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 392 487 6.0E-08
sp|Q6P0J3|SP8_DANRE Transcription factor Sp8 OS=Danio rerio GN=sp8b PE=2 SV=1 439 487 6.0E-08
sp|Q0VA40|SP9_XENTR Transcription factor Sp9 OS=Xenopus tropicalis GN=sp9 PE=2 SV=1 439 487 6.0E-08
sp|Q6NUN9|ZN746_HUMAN Zinc finger protein 746 OS=Homo sapiens GN=ZNF746 PE=1 SV=1 436 487 6.0E-08
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 425 487 6.0E-08
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 427 487 6.0E-08
sp|Q5R7I8|ZNF19_PONAB Zinc finger protein 19 OS=Pongo abelii GN=ZNF19 PE=2 SV=1 432 487 6.0E-08
sp|Q8CCE9|E4F1_MOUSE Transcription factor E4F1 OS=Mus musculus GN=E4f1 PE=1 SV=2 405 487 6.0E-08
sp|Q8N859|ZN713_HUMAN Zinc finger protein 713 OS=Homo sapiens GN=ZNF713 PE=2 SV=1 432 487 6.0E-08
sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 432 487 6.0E-08
sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 432 487 6.0E-08
sp|Q9HCL3|ZFP14_HUMAN Zinc finger protein 14 homolog OS=Homo sapiens GN=ZFP14 PE=2 SV=2 432 487 6.0E-08
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 432 487 6.0E-08
sp|Q49A33|Z876P_HUMAN Putative zinc finger protein 876 OS=Homo sapiens GN=ZNF876P PE=5 SV=3 404 487 6.0E-08
sp|P18734|ZG67_XENLA Gastrula zinc finger protein XlCGF67.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 432 487 6.0E-08
sp|Q14526|HIC1_HUMAN Hypermethylated in cancer 1 protein OS=Homo sapiens GN=HIC1 PE=1 SV=5 432 485 6.0E-08
sp|Q96N20|ZN75A_HUMAN Zinc finger protein 75A OS=Homo sapiens GN=ZNF75A PE=2 SV=1 423 487 6.0E-08
sp|P17014|ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens GN=ZNF12 PE=1 SV=3 418 487 6.0E-08
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 430 487 6.0E-08
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 432 487 6.0E-08
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 432 487 6.0E-08
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 420 487 6.0E-08
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 425 487 6.0E-08
sp|Q9BUY5|ZN426_HUMAN Zinc finger protein 426 OS=Homo sapiens GN=ZNF426 PE=1 SV=1 427 487 6.0E-08
sp|Q8N587|ZN561_HUMAN Zinc finger protein 561 OS=Homo sapiens GN=ZNF561 PE=2 SV=2 417 487 6.0E-08
sp|Q8N823|ZN611_HUMAN Zinc finger protein 611 OS=Homo sapiens GN=ZNF611 PE=2 SV=2 432 487 6.0E-08
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 432 487 6.0E-08
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 383 487 7.0E-08
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 383 487 7.0E-08
sp|P18731|ZG62_XENLA Gastrula zinc finger protein XlCGF62.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 430 485 7.0E-08
sp|Q64HY5|SP8_CHICK Transcription factor Sp8 OS=Gallus gallus GN=SP8 PE=2 SV=1 439 487 7.0E-08
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 432 487 7.0E-08
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 432 487 7.0E-08
sp|Q86W11|ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens GN=ZSCAN30 PE=1 SV=1 432 487 7.0E-08
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 432 487 7.0E-08
sp|Q60793|KLF4_MOUSE Krueppel-like factor 4 OS=Mus musculus GN=Klf4 PE=1 SV=3 416 487 7.0E-08
sp|O70237|GFI1B_MOUSE Zinc finger protein Gfi-1b OS=Mus musculus GN=Gfi1b PE=1 SV=1 426 487 7.0E-08
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 427 487 7.0E-08
sp|C7EMF5|KLF17_PIG Krueppel-like factor 17 OS=Sus scrofa GN=KLF17 PE=2 SV=1 422 485 7.0E-08
sp|Q4R882|ZN561_MACFA Zinc finger protein 561 OS=Macaca fascicularis GN=ZNF561 PE=2 SV=1 417 487 7.0E-08
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 432 487 7.0E-08
sp|Q3TDE8|ZN691_MOUSE Zinc finger protein 691 OS=Mus musculus GN=Znf691 PE=2 SV=1 428 485 7.0E-08
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 432 485 7.0E-08
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 383 487 7.0E-08
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 383 487 7.0E-08
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 427 487 7.0E-08
sp|Q9ET58|KLF2_RAT Krueppel-like factor 2 OS=Rattus norvegicus GN=Klf2 PE=1 SV=1 419 487 7.0E-08
sp|Q60843|KLF2_MOUSE Krueppel-like factor 2 OS=Mus musculus GN=Klf2 PE=1 SV=2 419 487 7.0E-08
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 432 487 7.0E-08
sp|Q7L2R6|ZN765_HUMAN Zinc finger protein 765 OS=Homo sapiens GN=ZNF765 PE=1 SV=2 422 487 7.0E-08
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 427 487 7.0E-08
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 432 487 7.0E-08
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 424 487 7.0E-08
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 432 487 7.0E-08
sp|O43474|KLF4_HUMAN Krueppel-like factor 4 OS=Homo sapiens GN=KLF4 PE=1 SV=3 416 487 7.0E-08
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 432 487 7.0E-08
sp|Q13887|KLF5_HUMAN Krueppel-like factor 5 OS=Homo sapiens GN=KLF5 PE=1 SV=2 428 485 7.0E-08
sp|Q96NG5|ZN558_HUMAN Zinc finger protein 558 OS=Homo sapiens GN=ZNF558 PE=2 SV=1 432 487 7.0E-08
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 432 487 8.0E-08
sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 427 487 8.0E-08
sp|Q5XGT8|SP8_XENLA Transcription factor Sp8 OS=Xenopus laevis GN=sp8 PE=2 SV=1 439 487 8.0E-08
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 422 487 8.0E-08
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 432 487 8.0E-08
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 432 490 8.0E-08
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 427 487 8.0E-08
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 432 487 8.0E-08
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 432 487 8.0E-08
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 424 487 8.0E-08
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 432 487 8.0E-08
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 432 487 8.0E-08
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 432 487 8.0E-08
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 432 487 8.0E-08
sp|Q5VTD9|GFI1B_HUMAN Zinc finger protein Gfi-1b OS=Homo sapiens GN=GFI1B PE=1 SV=1 426 487 8.0E-08
sp|O42409|GFI1B_CHICK Zinc finger protein Gfi-1b OS=Gallus gallus GN=GFI1B PE=2 SV=1 393 487 8.0E-08
sp|A2T7D2|ZKSC5_PANTR Zinc finger protein with KRAB and SCAN domains 5 OS=Pan troglodytes GN=ZKSCAN5 PE=3 SV=1 432 486 8.0E-08
sp|Q1LZ87|ZN397_BOVIN Zinc finger protein 397 OS=Bos taurus GN=ZNF397 PE=2 SV=1 434 487 8.0E-08
sp|Q9Y2Y9|KLF13_HUMAN Krueppel-like factor 13 OS=Homo sapiens GN=KLF13 PE=1 SV=1 428 487 9.0E-08
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 427 487 9.0E-08
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 434 487 9.0E-08
sp|P18731|ZG62_XENLA Gastrula zinc finger protein XlCGF62.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 420 487 9.0E-08
sp|Q19A40|KLF14_PANTR Krueppel-like factor 14 OS=Pan troglodytes GN=KLF14 PE=3 SV=1 439 487 9.0E-08
sp|Q14V87|KLF14_GORGO Krueppel-like factor 14 OS=Gorilla gorilla gorilla GN=KLF14 PE=3 SV=1 439 487 9.0E-08
sp|A6NHJ4|ZN860_HUMAN Zinc finger protein 860 OS=Homo sapiens GN=ZNF860 PE=2 SV=3 311 491 9.0E-08
sp|P13682|ZNF35_HUMAN Zinc finger protein 35 OS=Homo sapiens GN=ZNF35 PE=2 SV=4 427 487 9.0E-08
sp|Q0VAW7|ZN112_MOUSE Zinc finger protein 112 OS=Mus musculus GN=Znf112 PE=2 SV=2 432 487 9.0E-08
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 392 487 9.0E-08
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 432 487 9.0E-08
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 432 487 9.0E-08
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 427 487 9.0E-08
sp|Q9H7X3|ZN696_HUMAN Zinc finger protein 696 OS=Homo sapiens GN=ZNF696 PE=2 SV=2 423 487 9.0E-08
sp|Q8N9Z0|ZN610_HUMAN Zinc finger protein 610 OS=Homo sapiens GN=ZNF610 PE=2 SV=2 432 487 9.0E-08
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 432 485 9.0E-08
sp|P0CG23|ZN853_HUMAN Zinc finger protein 853 OS=Homo sapiens GN=ZNF853 PE=2 SV=1 432 487 9.0E-08
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 434 487 9.0E-08
sp|Q9Y2L8|ZKSC5_HUMAN Zinc finger protein with KRAB and SCAN domains 5 OS=Homo sapiens GN=ZKSCAN5 PE=1 SV=1 432 486 9.0E-08
sp|Q8N988|ZN557_HUMAN Zinc finger protein 557 OS=Homo sapiens GN=ZNF557 PE=2 SV=2 434 487 9.0E-08
sp|Q9Y5W3|KLF2_HUMAN Krueppel-like factor 2 OS=Homo sapiens GN=KLF2 PE=1 SV=2 419 487 9.0E-08
sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens GN=ZNF565 PE=2 SV=2 428 487 9.0E-08
sp|O14771|ZN213_HUMAN Zinc finger protein 213 OS=Homo sapiens GN=ZNF213 PE=2 SV=2 420 487 9.0E-08
sp|Q9NSD4|ZN275_HUMAN Zinc finger protein 275 OS=Homo sapiens GN=ZNF275 PE=2 SV=2 397 485 9.0E-08
sp|Q6NZQ6|ZN740_MOUSE Zinc finger protein 740 OS=Mus musculus GN=Znf740 PE=1 SV=1 432 487 9.0E-08
sp|P17023|ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens GN=ZNF19 PE=2 SV=4 432 487 9.0E-08
sp|P49910|ZN165_HUMAN Zinc finger protein 165 OS=Homo sapiens GN=ZNF165 PE=1 SV=1 432 487 1.0E-07
sp|Q8TDD2|SP7_HUMAN Transcription factor Sp7 OS=Homo sapiens GN=SP7 PE=1 SV=1 439 485 1.0E-07
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 434 487 1.0E-07
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 432 487 1.0E-07
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 432 487 1.0E-07
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 427 487 1.0E-07
sp|Q9H963|ZN702_HUMAN Putative zinc finger protein 702 OS=Homo sapiens GN=ZNF702P PE=5 SV=2 432 487 1.0E-07
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 432 486 1.0E-07
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 432 487 1.0E-07
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 422 487 1.0E-07
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 427 487 1.0E-07
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 432 487 1.0E-07
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 420 486 1.0E-07
sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 434 487 1.0E-07
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 432 485 1.0E-07
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 427 487 1.0E-07
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 432 487 1.0E-07
sp|Q29W20|EGR1_BOVIN Early growth response protein 1 OS=Bos taurus GN=EGR1 PE=2 SV=1 422 487 1.0E-07
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 427 487 1.0E-07
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 427 487 1.0E-07
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 432 487 1.0E-07
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 432 485 1.0E-07
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 434 487 1.0E-07
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 432 485 1.0E-07
sp|Q96JB3|HIC2_HUMAN Hypermethylated in cancer 2 protein OS=Homo sapiens GN=HIC2 PE=1 SV=2 422 487 1.0E-07
sp|Q9JLZ6|HIC2_MOUSE Hypermethylated in cancer 2 protein OS=Mus musculus GN=Hic2 PE=2 SV=4 422 487 1.0E-07
sp|Q6PDB4|ZN880_HUMAN Zinc finger protein 880 OS=Homo sapiens GN=ZNF880 PE=2 SV=2 432 487 1.0E-07
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 427 487 1.0E-07
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 434 487 1.0E-07
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 422 487 1.0E-07
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 332 487 1.0E-07
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 435 487 1.0E-07
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 432 487 1.0E-07
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 432 487 1.0E-07
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 422 487 1.0E-07
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 432 487 1.0E-07
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 432 487 1.0E-07
sp|Q6NZQ6|ZN740_MOUSE Zinc finger protein 740 OS=Mus musculus GN=Znf740 PE=1 SV=1 422 487 1.0E-07
sp|Q9Y2X9|ZN281_HUMAN Zinc finger protein 281 OS=Homo sapiens GN=ZNF281 PE=1 SV=1 432 491 1.0E-07
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 423 487 1.0E-07
sp|O95201|ZN205_HUMAN Zinc finger protein 205 OS=Homo sapiens GN=ZNF205 PE=1 SV=2 432 487 1.0E-07
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 432 486 1.0E-07
sp|Q8CFA7|KLF17_MOUSE Krueppel-like factor 17 OS=Mus musculus GN=Klf17 PE=1 SV=2 432 485 1.0E-07
sp|P51522|ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens GN=ZNF83 PE=2 SV=3 432 487 1.0E-07
sp|P17032|ZN37A_HUMAN Zinc finger protein 37A OS=Homo sapiens GN=ZNF37A PE=2 SV=3 427 487 1.0E-07
sp|Q86Y25|Z354C_HUMAN Zinc finger protein 354C OS=Homo sapiens GN=ZNF354C PE=2 SV=1 432 522 1.0E-07
sp|P30373|CKR1_CHICK Zinc finger protein CKR1 OS=Gallus gallus PE=2 SV=1 409 487 1.0E-07
sp|Q6PG37|ZN790_HUMAN Zinc finger protein 790 OS=Homo sapiens GN=ZNF790 PE=2 SV=2 432 487 1.0E-07
sp|Q9BUG6|ZSA5A_HUMAN Zinc finger and SCAN domain-containing protein 5A OS=Homo sapiens GN=ZSCAN5A PE=2 SV=1 434 487 1.0E-07
sp|O94130|CREA_BOTFU DNA-binding protein creA OS=Botryotinia fuckeliana GN=creA PE=3 SV=1 428 485 1.0E-07
sp|Q5JT82|KLF17_HUMAN Krueppel-like factor 17 OS=Homo sapiens GN=KLF17 PE=1 SV=1 432 488 1.0E-07
sp|P17141|ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus GN=Zfp37 PE=2 SV=4 421 503 1.0E-07
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 432 487 1.0E-07
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 432 487 1.0E-07
sp|A8MUZ8|Z705G_HUMAN Putative zinc finger protein 705G OS=Homo sapiens GN=ZNF705G PE=2 SV=2 422 487 1.0E-07
sp|P18741|ZO15_XENLA Oocyte zinc finger protein XlCOF15 (Fragment) OS=Xenopus laevis PE=3 SV=1 432 485 1.0E-07
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 422 487 1.0E-07
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 432 487 1.0E-07
sp|Q99LI5|ZN281_MOUSE Zinc finger protein 281 OS=Mus musculus GN=Znf281 PE=1 SV=1 432 490 1.0E-07
sp|P10069|BRLA_EMENI Regulatory protein brlA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=brlA PE=3 SV=1 434 486 1.0E-07
sp|Q01713|KLF9_RAT Krueppel-like factor 9 OS=Rattus norvegicus GN=Klf9 PE=2 SV=1 439 487 1.0E-07
sp|B1H2Q6|ZN865_XENTR Zinc finger protein 865 OS=Xenopus tropicalis GN=znf865 PE=2 SV=1 425 485 1.0E-07
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 432 487 1.0E-07
sp|Q8IYN0|ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens GN=ZNF100 PE=2 SV=2 432 487 1.0E-07
sp|Q9Z0Z7|KLF5_MOUSE Krueppel-like factor 5 OS=Mus musculus GN=Klf5 PE=2 SV=2 428 487 1.0E-07
sp|P58317|ZN121_HUMAN Zinc finger protein 121 OS=Homo sapiens GN=ZNF121 PE=3 SV=2 427 485 1.0E-07
sp|Q5VV52|ZN691_HUMAN Zinc finger protein 691 OS=Homo sapiens GN=ZNF691 PE=1 SV=1 432 485 1.0E-07
sp|Q93560|BLMP1_CAEEL B lymphocyte-induced maturation protein 1 homolog OS=Caenorhabditis elegans GN=blmp-1 PE=1 SV=1 427 487 1.0E-07
sp|P98182|ZN200_HUMAN Zinc finger protein 200 OS=Homo sapiens GN=ZNF200 PE=2 SV=2 418 487 1.0E-07
sp|Q61751|Z354A_MOUSE Zinc finger protein 354A OS=Mus musculus GN=Znf354a PE=2 SV=2 432 487 1.0E-07
sp|P18742|ZO19_XENLA Oocyte zinc finger protein XlCOF19 (Fragment) OS=Xenopus laevis PE=3 SV=1 406 487 1.0E-07
sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=2 SV=2 434 487 1.0E-07
sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=2 SV=2 419 487 1.0E-07
sp|Q96K75|ZN514_HUMAN Zinc finger protein 514 OS=Homo sapiens GN=ZNF514 PE=2 SV=1 423 487 1.0E-07
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 432 487 1.0E-07
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 423 487 1.0E-07
sp|B7ZRU9|EVI1A_XENLA MDS1 and EVI1 complex locus protein EVI1-A OS=Xenopus laevis GN=mecom-a PE=1 SV=1 434 490 1.0E-07
sp|Q9NYW8|RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens GN=RBAK PE=1 SV=1 432 487 1.0E-07
sp|Q9ERU3|ZNF22_MOUSE Zinc finger protein 22 OS=Mus musculus GN=Znf22 PE=1 SV=2 434 487 1.0E-07
sp|P18736|ZG71_XENLA Gastrula zinc finger protein XlCGF71.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 423 487 1.0E-07
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 423 506 1.0E-07
sp|Q13886|KLF9_HUMAN Krueppel-like factor 9 OS=Homo sapiens GN=KLF9 PE=1 SV=1 439 487 1.0E-07
sp|Q17QR7|ZN691_BOVIN Zinc finger protein 691 OS=Bos taurus GN=ZNF691 PE=2 SV=1 432 485 1.0E-07
sp|O35739|KLF9_MOUSE Krueppel-like factor 9 OS=Mus musculus GN=Klf9 PE=2 SV=1 439 487 1.0E-07
sp|Q5HY98|ZN766_HUMAN Zinc finger protein 766 OS=Homo sapiens GN=ZNF766 PE=2 SV=1 432 487 1.0E-07
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 434 487 1.0E-07
sp|Q9ERU2|ZNF22_RAT Zinc finger protein 22 OS=Rattus norvegicus GN=Znf22 PE=2 SV=2 434 487 1.0E-07
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 427 487 1.0E-07
sp|P14404|EVI1_MOUSE MDS1 and EVI1 complex locus protein EVI1 OS=Mus musculus GN=Mecom PE=1 SV=1 434 542 1.0E-07
sp|P79288|KLF9_PIG Krueppel-like factor 9 OS=Sus scrofa GN=KLF9 PE=2 SV=3 439 487 1.0E-07
sp|Q5T5D7|ZN684_HUMAN Zinc finger protein 684 OS=Homo sapiens GN=ZNF684 PE=2 SV=1 434 487 1.0E-07
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 423 487 1.0E-07
sp|Q8N7M2|ZN283_HUMAN Zinc finger protein 283 OS=Homo sapiens GN=ZNF283 PE=2 SV=4 432 487 1.0E-07
sp|Q90625|ZBT17_CHICK Zinc finger and BTB domain-containing protein 17 (Fragment) OS=Gallus gallus GN=ZBTB17 PE=2 SV=1 432 501 1.0E-07
sp|A8MT65|ZN891_HUMAN Zinc finger protein 891 OS=Homo sapiens GN=ZNF891 PE=2 SV=2 432 487 1.0E-07
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 427 490 2.0E-07
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 427 490 2.0E-07
sp|P19544|WT1_HUMAN Wilms tumor protein OS=Homo sapiens GN=WT1 PE=1 SV=2 407 487 2.0E-07
sp|Q8VI67|SP7_MOUSE Transcription factor Sp7 OS=Mus musculus GN=Sp7 PE=1 SV=1 439 485 2.0E-07
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 436 487 2.0E-07
sp|Q9HBT8|Z286A_HUMAN Zinc finger protein 286A OS=Homo sapiens GN=ZNF286A PE=1 SV=1 423 487 2.0E-07
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 432 487 2.0E-07
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 422 487 2.0E-07
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 432 487 2.0E-07
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 422 487 2.0E-07
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 427 490 2.0E-07
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 422 487 2.0E-07
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 423 503 2.0E-07
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 434 487 2.0E-07
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 427 487 2.0E-07
sp|Q07231|ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus GN=Zscan21 PE=2 SV=2 434 487 2.0E-07
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 420 487 2.0E-07
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 420 487 2.0E-07
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 432 487 2.0E-07
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 431 487 2.0E-07
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 432 487 2.0E-07
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 392 487 2.0E-07
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 434 487 2.0E-07
sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=ZNF3 PE=1 SV=3 432 487 2.0E-07
sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 427 487 2.0E-07
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 427 487 2.0E-07
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 369 500 2.0E-07
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 432 487 2.0E-07
sp|A6NGD5|ZSA5C_HUMAN Putative zinc finger and SCAN domain-containing protein 5C OS=Homo sapiens GN=ZSCAN5CP PE=5 SV=1 434 487 2.0E-07
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 432 512 2.0E-07
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 432 487 2.0E-07
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 432 506 2.0E-07
sp|Q8K1S5|KLF11_MOUSE Krueppel-like factor 11 OS=Mus musculus GN=Klf11 PE=2 SV=3 432 485 2.0E-07
sp|Q5RJR4|ZN467_RAT Zinc finger protein 467 OS=Rattus norvegicus GN=Znf467 PE=2 SV=1 427 485 2.0E-07
sp|Q5RJR4|ZN467_RAT Zinc finger protein 467 OS=Rattus norvegicus GN=Znf467 PE=2 SV=1 427 487 2.0E-07
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 427 485 2.0E-07
sp|Q8JZL0|ZN467_MOUSE Zinc finger protein 467 OS=Mus musculus GN=Znf467 PE=1 SV=1 427 487 2.0E-07
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 434 487 2.0E-07
sp|Q9UL36|ZN236_HUMAN Zinc finger protein 236 OS=Homo sapiens GN=ZNF236 PE=2 SV=2 420 490 2.0E-07
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 427 487 2.0E-07
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 392 487 2.0E-07
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 422 487 2.0E-07
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 432 487 2.0E-07
sp|Q9Y6Q3|ZFP37_HUMAN Zinc finger protein 37 homolog OS=Homo sapiens GN=ZFP37 PE=2 SV=3 421 506 2.0E-07
sp|P0CG31|Z286B_HUMAN Putative zinc finger protein 286B OS=Homo sapiens GN=ZNF286B PE=5 SV=1 423 487 2.0E-07
sp|Q5R7I8|ZNF19_PONAB Zinc finger protein 19 OS=Pongo abelii GN=ZNF19 PE=2 SV=1 432 487 2.0E-07
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 427 487 2.0E-07
sp|Q8N859|ZN713_HUMAN Zinc finger protein 713 OS=Homo sapiens GN=ZNF713 PE=2 SV=1 422 486 2.0E-07
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 432 487 2.0E-07
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 423 487 2.0E-07
sp|Q60793|KLF4_MOUSE Krueppel-like factor 4 OS=Mus musculus GN=Klf4 PE=1 SV=3 432 485 2.0E-07
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 427 487 2.0E-07
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 427 492 2.0E-07
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 434 487 2.0E-07
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 427 487 2.0E-07
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 432 487 2.0E-07
sp|O43474|KLF4_HUMAN Krueppel-like factor 4 OS=Homo sapiens GN=KLF4 PE=1 SV=3 432 485 2.0E-07
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 432 487 2.0E-07
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 427 487 2.0E-07
sp|Q1LZ87|ZN397_BOVIN Zinc finger protein 397 OS=Bos taurus GN=ZNF397 PE=2 SV=1 357 487 2.0E-07
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 435 487 2.0E-07
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 434 487 2.0E-07
sp|Q8N988|ZN557_HUMAN Zinc finger protein 557 OS=Homo sapiens GN=ZNF557 PE=2 SV=2 434 487 2.0E-07
sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens GN=ZNF565 PE=2 SV=2 432 487 2.0E-07
sp|P17023|ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens GN=ZNF19 PE=2 SV=4 432 487 2.0E-07
sp|P51522|ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens GN=ZNF83 PE=2 SV=3 434 487 2.0E-07
sp|P30373|CKR1_CHICK Zinc finger protein CKR1 OS=Gallus gallus PE=2 SV=1 432 499 2.0E-07
sp|P17141|ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus GN=Zfp37 PE=2 SV=4 432 487 2.0E-07
sp|Q01713|KLF9_RAT Krueppel-like factor 9 OS=Rattus norvegicus GN=Klf9 PE=2 SV=1 439 485 2.0E-07
sp|Q96K75|ZN514_HUMAN Zinc finger protein 514 OS=Homo sapiens GN=ZNF514 PE=2 SV=1 432 487 2.0E-07
sp|Q96K75|ZN514_HUMAN Zinc finger protein 514 OS=Homo sapiens GN=ZNF514 PE=2 SV=1 423 487 2.0E-07
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 423 487 2.0E-07
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 423 487 2.0E-07
sp|Q4R3I5|ZN668_MACFA Zinc finger protein 668 OS=Macaca fascicularis GN=ZNF668 PE=2 SV=1 422 507 2.0E-07
sp|Q923B3|NRIF1_MOUSE Neurotrophin receptor-interacting factor 1 OS=Mus musculus GN=Nrif1 PE=1 SV=3 427 486 2.0E-07
sp|Q6DCW1|GFI1B_XENLA Zinc finger protein Gfi-1b OS=Xenopus laevis GN=gfi1b PE=2 SV=1 426 487 2.0E-07
sp|Q6V9R5|ZN562_HUMAN Zinc finger protein 562 OS=Homo sapiens GN=ZNF562 PE=2 SV=2 427 487 2.0E-07
sp|Q5HYK9|ZN667_HUMAN Zinc finger protein 667 OS=Homo sapiens GN=ZNF667 PE=2 SV=2 421 487 2.0E-07
sp|Q3MIS6|ZN528_HUMAN Zinc finger protein 528 OS=Homo sapiens GN=ZNF528 PE=2 SV=1 426 487 2.0E-07
sp|Q9QXT9|Z354B_MOUSE Zinc finger protein 354B OS=Mus musculus GN=Znf354b PE=2 SV=1 432 487 2.0E-07
sp|Q8TBZ5|ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens GN=ZNF502 PE=1 SV=1 427 487 2.0E-07
sp|Q96ND8|ZN583_HUMAN Zinc finger protein 583 OS=Homo sapiens GN=ZNF583 PE=2 SV=2 432 487 2.0E-07
sp|P56670|MAZ_MESAU Myc-associated zinc finger protein (Fragment) OS=Mesocricetus auratus GN=MAZ PE=2 SV=1 432 489 2.0E-07
sp|P52738|ZN140_HUMAN Zinc finger protein 140 OS=Homo sapiens GN=ZNF140 PE=2 SV=2 423 490 2.0E-07
sp|Q8NCN2|ZBT34_HUMAN Zinc finger and BTB domain-containing protein 34 OS=Homo sapiens GN=ZBTB34 PE=2 SV=4 434 497 2.0E-07
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 432 487 2.0E-07
sp|Q02526|ZFP41_MOUSE Zinc finger protein 41 OS=Mus musculus GN=Zfp41 PE=2 SV=2 432 487 2.0E-07
sp|Q03112|EVI1_HUMAN MDS1 and EVI1 complex locus protein EVI1 OS=Homo sapiens GN=MECOM PE=1 SV=2 434 490 2.0E-07
sp|Q6ZSB9|ZBT49_HUMAN Zinc finger and BTB domain-containing protein 49 OS=Homo sapiens GN=ZBTB49 PE=1 SV=3 417 487 3.0E-07
sp|P19544|WT1_HUMAN Wilms tumor protein OS=Homo sapiens GN=WT1 PE=1 SV=2 432 494 3.0E-07
sp|B7ZSG3|WT1A_XENLA Wilms tumor protein homolog A OS=Xenopus laevis GN=wt1-a PE=2 SV=1 432 494 3.0E-07
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 432 487 3.0E-07
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 432 487 3.0E-07
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 422 487 3.0E-07
sp|Q14119|VEZF1_HUMAN Vascular endothelial zinc finger 1 OS=Homo sapiens GN=VEZF1 PE=1 SV=2 404 487 3.0E-07
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 432 485 3.0E-07
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 422 493 3.0E-07
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 432 487 3.0E-07
sp|Q9UJL9|ZF69B_HUMAN Zinc finger protein ZFP69B OS=Homo sapiens GN=ZFP69B PE=1 SV=2 419 487 3.0E-07
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 427 487 3.0E-07
sp|P18731|ZG62_XENLA Gastrula zinc finger protein XlCGF62.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 432 485 3.0E-07
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 432 487 3.0E-07
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 422 487 3.0E-07
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 422 487 3.0E-07
sp|Q8BIF9|ZN787_MOUSE Zinc finger protein 787 OS=Mus musculus GN=Znf787 PE=2 SV=3 432 487 3.0E-07
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 432 487 3.0E-07
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 432 487 3.0E-07
sp|Q7Z7K2|ZN467_HUMAN Zinc finger protein 467 OS=Homo sapiens GN=ZNF467 PE=2 SV=1 427 485 3.0E-07
sp|Q3U133|ZN746_MOUSE Zinc finger protein 746 OS=Mus musculus GN=Znf746 PE=1 SV=3 432 485 3.0E-07
sp|Q9EPU7|Z354C_RAT Zinc finger protein 354C OS=Rattus norvegicus GN=Znf354c PE=1 SV=1 432 494 3.0E-07
sp|P52736|ZN133_HUMAN Zinc finger protein 133 OS=Homo sapiens GN=ZNF133 PE=1 SV=2 432 487 3.0E-07
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 432 487 3.0E-07
sp|P17014|ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens GN=ZNF12 PE=1 SV=3 432 498 3.0E-07
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 426 487 3.0E-07
sp|Q60843|KLF2_MOUSE Krueppel-like factor 2 OS=Mus musculus GN=Klf2 PE=1 SV=2 427 485 3.0E-07
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 432 485 3.0E-07
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 427 487 3.0E-07
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 432 487 3.0E-07
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 407 487 3.0E-07
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 431 487 3.0E-07
sp|P51522|ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens GN=ZNF83 PE=2 SV=3 432 487 3.0E-07
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 432 487 3.0E-07
sp|B1H2Q6|ZN865_XENTR Zinc finger protein 865 OS=Xenopus tropicalis GN=znf865 PE=2 SV=1 434 486 3.0E-07
sp|P0C6Y7|PRDM9_RAT Histone-lysine N-methyltransferase PRDM9 OS=Rattus norvegicus GN=Prdm9 PE=3 SV=1 423 487 3.0E-07
sp|Q13886|KLF9_HUMAN Krueppel-like factor 9 OS=Homo sapiens GN=KLF9 PE=1 SV=1 439 485 3.0E-07
sp|O35739|KLF9_MOUSE Krueppel-like factor 9 OS=Mus musculus GN=Klf9 PE=2 SV=1 439 485 3.0E-07
sp|P79288|KLF9_PIG Krueppel-like factor 9 OS=Sus scrofa GN=KLF9 PE=2 SV=3 439 485 3.0E-07
sp|Q96ND8|ZN583_HUMAN Zinc finger protein 583 OS=Homo sapiens GN=ZNF583 PE=2 SV=2 416 487 3.0E-07
sp|P52738|ZN140_HUMAN Zinc finger protein 140 OS=Homo sapiens GN=ZNF140 PE=2 SV=2 423 487 3.0E-07
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 432 487 3.0E-07
sp|Q8BXX2|ZBT49_MOUSE Zinc finger and BTB domain-containing protein 49 OS=Mus musculus GN=Zbtb49 PE=2 SV=1 417 487 4.0E-07
sp|O62651|WT1_PIG Wilms tumor protein homolog OS=Sus scrofa GN=WT1 PE=2 SV=1 432 485 4.0E-07
sp|P18735|ZG7_XENLA Gastrula zinc finger protein XlCGF7.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 432 485 4.0E-07
sp|A3KN36|ZNF19_BOVIN Zinc finger protein 19 OS=Bos taurus GN=ZNF19 PE=2 SV=1 432 487 4.0E-07
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 432 487 4.0E-07
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 423 485 4.0E-07
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 423 487 4.0E-07
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 420 487 4.0E-07
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 407 487 4.0E-07
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 432 487 4.0E-07
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 432 491 4.0E-07
sp|P17039|ZNF30_HUMAN Zinc finger protein 30 OS=Homo sapiens GN=ZNF30 PE=2 SV=5 432 487 4.0E-07
sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens GN=ZNF606 PE=2 SV=1 423 487 4.0E-07
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 432 487 4.0E-07
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 423 487 4.0E-07
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 432 487 4.0E-07
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 434 487 4.0E-07
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 432 487 4.0E-07
sp|Q9Y6Q3|ZFP37_HUMAN Zinc finger protein 37 homolog OS=Homo sapiens GN=ZFP37 PE=2 SV=3 434 485 4.0E-07
sp|P18744|ZO20_XENLA Oocyte zinc finger protein XlCOF20 (Fragment) OS=Xenopus laevis PE=3 SV=1 432 487 4.0E-07
sp|Q6ZS27|ZN662_HUMAN Zinc finger protein 662 OS=Homo sapiens GN=ZNF662 PE=1 SV=1 376 487 4.0E-07
sp|Q8N859|ZN713_HUMAN Zinc finger protein 713 OS=Homo sapiens GN=ZNF713 PE=2 SV=1 432 487 4.0E-07
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 434 487 4.0E-07
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 427 487 4.0E-07
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 420 487 4.0E-07
sp|Q9ET58|KLF2_RAT Krueppel-like factor 2 OS=Rattus norvegicus GN=Klf2 PE=1 SV=1 427 485 4.0E-07
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 432 496 4.0E-07
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 432 487 4.0E-07
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 432 487 4.0E-07
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 420 487 4.0E-07
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 427 487 4.0E-07
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 434 487 4.0E-07
sp|P17023|ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens GN=ZNF19 PE=2 SV=4 432 487 4.0E-07
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 432 487 4.0E-07
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 427 487 4.0E-07
sp|P17141|ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus GN=Zfp37 PE=2 SV=4 434 485 4.0E-07
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 423 487 4.0E-07
sp|Q4R3I5|ZN668_MACFA Zinc finger protein 668 OS=Macaca fascicularis GN=ZNF668 PE=2 SV=1 422 486 4.0E-07
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 432 487 4.0E-07
sp|Q0IHB8|OSR2B_XENLA Protein odd-skipped-related 2-B OS=Xenopus laevis GN=osr2-b PE=2 SV=1 422 486 5.0E-07
sp|Q32NK7|OSR2A_XENLA Protein odd-skipped-related 2-A OS=Xenopus laevis GN=osr2-a PE=2 SV=1 422 486 5.0E-07
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 436 487 5.0E-07
sp|P49952|WT1_RAT Wilms tumor protein homolog OS=Rattus norvegicus GN=Wt1 PE=2 SV=1 432 485 5.0E-07
sp|P49952|WT1_RAT Wilms tumor protein homolog OS=Rattus norvegicus GN=Wt1 PE=2 SV=1 415 487 5.0E-07
sp|P22561|WT1_MOUSE Wilms tumor protein homolog OS=Mus musculus GN=Wt1 PE=1 SV=1 432 485 5.0E-07
sp|P22561|WT1_MOUSE Wilms tumor protein homolog OS=Mus musculus GN=Wt1 PE=1 SV=1 415 487 5.0E-07
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 432 487 5.0E-07
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 434 487 5.0E-07
sp|A1YG60|ZKSC8_PANPA Zinc finger protein with KRAB and SCAN domains 8 OS=Pan paniscus GN=ZKSCAN8 PE=3 SV=1 434 487 5.0E-07
sp|A2T736|ZKSC8_PANTR Zinc finger protein with KRAB and SCAN domains 8 OS=Pan troglodytes GN=ZKSCAN8 PE=3 SV=1 434 487 5.0E-07
sp|Q15776|ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens GN=ZKSCAN8 PE=1 SV=2 434 487 5.0E-07
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 423 487 5.0E-07
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 432 487 5.0E-07
sp|O14901|KLF11_HUMAN Krueppel-like factor 11 OS=Homo sapiens GN=KLF11 PE=1 SV=2 432 485 5.0E-07
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 432 485 5.0E-07
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 426 487 5.0E-07
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 423 487 5.0E-07
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 423 487 5.0E-07
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 432 487 5.0E-07
sp|Q6ZMY9|ZN517_HUMAN Zinc finger protein 517 OS=Homo sapiens GN=ZNF517 PE=2 SV=2 432 487 5.0E-07
sp|Q6ZMY9|ZN517_HUMAN Zinc finger protein 517 OS=Homo sapiens GN=ZNF517 PE=2 SV=2 423 485 5.0E-07
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 434 487 5.0E-07
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 434 487 5.0E-07
sp|A6NM28|ZFP92_HUMAN Zinc finger protein 92 homolog OS=Homo sapiens GN=ZFP92 PE=2 SV=3 432 487 5.0E-07
sp|Q13351|KLF1_HUMAN Krueppel-like factor 1 OS=Homo sapiens GN=KLF1 PE=1 SV=1 415 487 5.0E-07
sp|A7MBI1|ZFP69_BOVIN Zinc finger protein ZFP69 OS=Bos taurus GN=ZFP69 PE=2 SV=1 432 487 5.0E-07
sp|Q8N859|ZN713_HUMAN Zinc finger protein 713 OS=Homo sapiens GN=ZNF713 PE=2 SV=1 432 487 5.0E-07
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 427 487 5.0E-07
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 417 487 5.0E-07
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 420 487 5.0E-07
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 434 490 5.0E-07
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 432 487 5.0E-07
sp|Q1LZ87|ZN397_BOVIN Zinc finger protein 397 OS=Bos taurus GN=ZNF397 PE=2 SV=1 432 487 5.0E-07
sp|Q9Y5W3|KLF2_HUMAN Krueppel-like factor 2 OS=Homo sapiens GN=KLF2 PE=1 SV=2 427 485 5.0E-07
sp|P17141|ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus GN=Zfp37 PE=2 SV=4 434 487 5.0E-07
sp|P17141|ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus GN=Zfp37 PE=2 SV=4 427 487 5.0E-07
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 423 487 5.0E-07
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 427 487 5.0E-07
sp|Q96ND8|ZN583_HUMAN Zinc finger protein 583 OS=Homo sapiens GN=ZNF583 PE=2 SV=2 432 487 5.0E-07
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 432 487 5.0E-07
sp|B7ZSG3|WT1A_XENLA Wilms tumor protein homolog A OS=Xenopus laevis GN=wt1-a PE=2 SV=1 424 487 6.0E-07
sp|B5DE03|WT1_XENTR Wilms tumor protein homolog OS=Xenopus tropicalis GN=wt1 PE=2 SV=1 423 487 6.0E-07
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 423 487 6.0E-07
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 427 487 6.0E-07
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 393 487 6.0E-07
sp|Q6PDB4|ZN880_HUMAN Zinc finger protein 880 OS=Homo sapiens GN=ZNF880 PE=2 SV=2 432 487 6.0E-07
sp|Q9R1Y5|HIC1_MOUSE Hypermethylated in cancer 1 protein OS=Mus musculus GN=Hic1 PE=1 SV=4 422 487 6.0E-07
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 432 487 6.0E-07
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 432 487 6.0E-07
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 432 487 6.0E-07
sp|Q1LZ87|ZN397_BOVIN Zinc finger protein 397 OS=Bos taurus GN=ZNF397 PE=2 SV=1 432 487 6.0E-07
sp|Q1LZ87|ZN397_BOVIN Zinc finger protein 397 OS=Bos taurus GN=ZNF397 PE=2 SV=1 420 487 6.0E-07
sp|P51522|ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens GN=ZNF83 PE=2 SV=3 432 487 6.0E-07
sp|P51522|ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens GN=ZNF83 PE=2 SV=3 432 487 6.0E-07
sp|P51522|ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens GN=ZNF83 PE=2 SV=3 432 487 6.0E-07
sp|P18742|ZO19_XENLA Oocyte zinc finger protein XlCOF19 (Fragment) OS=Xenopus laevis PE=3 SV=1 432 487 6.0E-07
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 423 485 6.0E-07
sp|Q6AY34|OSR2_RAT Protein odd-skipped-related 2 OS=Rattus norvegicus GN=Osr2 PE=2 SV=1 422 486 7.0E-07
sp|P79958|WT1B_XENLA Wilms tumor protein homolog B OS=Xenopus laevis GN=wt1-b PE=2 SV=1 424 487 7.0E-07
sp|P18712|ZG16_XENLA Gastrula zinc finger protein XlCGF16.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 432 485 7.0E-07
sp|Q9VQU9|BOWEL_DROME Protein bowel OS=Drosophila melanogaster GN=bowl PE=1 SV=1 426 490 7.0E-07
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 427 487 7.0E-07
sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 427 487 7.0E-07
sp|Q3U3I9|ZN865_MOUSE Zinc finger protein 865 OS=Mus musculus GN=Znf865 PE=2 SV=1 434 486 7.0E-07
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 432 487 7.0E-07
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 434 486 7.0E-07
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 423 487 7.0E-07
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 432 487 7.0E-07
sp|Q4R8H9|ZN274_MACFA Neurotrophin receptor-interacting factor homolog OS=Macaca fascicularis GN=ZNF274 PE=2 SV=1 434 488 7.0E-07
sp|O75290|Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens GN=ZNF780A PE=2 SV=3 431 487 7.0E-07
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 432 485 7.0E-07
sp|Q96N58|ZN578_HUMAN Zinc finger protein 578 OS=Homo sapiens GN=ZNF578 PE=2 SV=2 422 487 7.0E-07
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 433 487 7.0E-07
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 434 487 7.0E-07
sp|P10075|GLI4_HUMAN Zinc finger protein GLI4 OS=Homo sapiens GN=GLI4 PE=1 SV=2 432 485 7.0E-07
sp|Q6PDB4|ZN880_HUMAN Zinc finger protein 880 OS=Homo sapiens GN=ZNF880 PE=2 SV=2 426 487 7.0E-07
sp|Q9EPU7|Z354C_RAT Zinc finger protein 354C OS=Rattus norvegicus GN=Znf354c PE=1 SV=1 432 487 7.0E-07
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 427 492 7.0E-07
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 432 487 7.0E-07
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 426 487 7.0E-07
sp|Q5HY98|ZN766_HUMAN Zinc finger protein 766 OS=Homo sapiens GN=ZNF766 PE=2 SV=1 434 490 7.0E-07
sp|P41696|AZF1_YEAST Asparagine-rich zinc finger protein AZF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZF1 PE=1 SV=1 432 487 8.0E-07
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 432 487 8.0E-07
sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=ZNF3 PE=1 SV=3 432 487 8.0E-07
sp|P17039|ZNF30_HUMAN Zinc finger protein 30 OS=Homo sapiens GN=ZNF30 PE=2 SV=5 422 487 8.0E-07
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 432 488 8.0E-07
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 427 487 8.0E-07
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 427 487 8.0E-07
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 423 487 8.0E-07
sp|Q6AZW8|ZN660_HUMAN Zinc finger protein 660 OS=Homo sapiens GN=ZNF660 PE=1 SV=1 387 487 8.0E-07
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 422 487 8.0E-07
sp|Q6DD87|ZN787_HUMAN Zinc finger protein 787 OS=Homo sapiens GN=ZNF787 PE=1 SV=3 432 487 8.0E-07
sp|Q14526|HIC1_HUMAN Hypermethylated in cancer 1 protein OS=Homo sapiens GN=HIC1 PE=1 SV=5 422 487 8.0E-07
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 432 487 8.0E-07
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 427 487 8.0E-07
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 431 487 8.0E-07
sp|Q3T135|OSR2_BOVIN Protein odd-skipped-related 2 OS=Bos taurus GN=OSR2 PE=2 SV=1 422 486 9.0E-07
sp|P50902|WT1_ALLMI Wilms tumor protein homolog (Fragment) OS=Alligator mississippiensis GN=WT1 PE=2 SV=1 432 494 9.0E-07
sp|P50902|WT1_ALLMI Wilms tumor protein homolog (Fragment) OS=Alligator mississippiensis GN=WT1 PE=2 SV=1 407 487 9.0E-07
sp|Q90850|HIC1_CHICK Hypermethylated in cancer 1 protein (Fragment) OS=Gallus gallus GN=HIC1 PE=2 SV=2 422 487 9.0E-07
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 432 487 9.0E-07
sp|Q9Y2Q1|ZN257_HUMAN Zinc finger protein 257 OS=Homo sapiens GN=ZNF257 PE=2 SV=2 423 487 9.0E-07
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 434 487 9.0E-07
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 427 487 9.0E-07
sp|Q6ZMY9|ZN517_HUMAN Zinc finger protein 517 OS=Homo sapiens GN=ZNF517 PE=2 SV=2 421 486 9.0E-07
sp|Q5RER9|ZN813_PONAB Zinc finger protein 813 OS=Pongo abelii GN=ZNF813 PE=2 SV=1 434 487 9.0E-07
sp|O08876|KLF10_RAT Krueppel-like factor 10 OS=Rattus norvegicus GN=Klf10 PE=2 SV=1 439 487 9.0E-07
sp|Q9BS34|ZN670_HUMAN Zinc finger protein 670 OS=Homo sapiens GN=ZNF670 PE=1 SV=1 432 487 9.0E-07
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 432 487 9.0E-07
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 427 487 9.0E-07
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 432 485 9.0E-07
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 432 487 9.0E-07
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 422 487 9.0E-07
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 432 487 9.0E-07
sp|Q9NSD4|ZN275_HUMAN Zinc finger protein 275 OS=Homo sapiens GN=ZNF275 PE=2 SV=2 431 487 9.0E-07
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 427 487 9.0E-07
sp|P58317|ZN121_HUMAN Zinc finger protein 121 OS=Homo sapiens GN=ZNF121 PE=3 SV=2 432 487 9.0E-07
sp|Q61751|Z354A_MOUSE Zinc finger protein 354A OS=Mus musculus GN=Znf354a PE=2 SV=2 428 487 9.0E-07
sp|P86413|OSR1_XENLA Protein odd-skipped-related 1 OS=Xenopus laevis GN=osr1 PE=2 SV=1 420 486 1.0E-06
sp|Q66JF8|OSR1_XENTR Protein odd-skipped-related 1 OS=Xenopus tropicalis GN=osr1 PE=2 SV=1 420 486 1.0E-06
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 422 487 1.0E-06
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 422 487 1.0E-06
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 432 487 1.0E-06
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 323 487 1.0E-06
sp|P49953|WT1_SMIMA Wilms tumor protein homolog (Fragment) OS=Sminthopsis macroura GN=WT1 PE=2 SV=1 407 487 1.0E-06
sp|P49953|WT1_SMIMA Wilms tumor protein homolog (Fragment) OS=Sminthopsis macroura GN=WT1 PE=2 SV=1 432 494 1.0E-06
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 432 487 1.0E-06
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 432 487 1.0E-06
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 422 487 1.0E-06
sp|Q5R5Y7|ZN436_PONAB Zinc finger protein 436 OS=Pongo abelii GN=ZNF436 PE=2 SV=1 427 487 1.0E-06
sp|Q9C0F3|ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens GN=ZNF436 PE=1 SV=2 427 487 1.0E-06
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 432 487 1.0E-06
sp|Q9BRH9|ZN251_HUMAN Zinc finger protein 251 OS=Homo sapiens GN=ZNF251 PE=2 SV=4 423 487 1.0E-06
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 432 487 1.0E-06
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 420 487 1.0E-06
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 432 487 1.0E-06
sp|P17098|ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens GN=ZNF8 PE=2 SV=2 432 487 1.0E-06
sp|P17098|ZNF8_HUMAN Zinc finger protein 8 OS=Homo sapiens GN=ZNF8 PE=2 SV=2 432 487 1.0E-06
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 422 487 1.0E-06
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 432 487 1.0E-06
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 427 487 1.0E-06
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 432 487 1.0E-06
sp|P10072|HKR1_HUMAN Krueppel-related zinc finger protein 1 OS=Homo sapiens GN=HKR1 PE=2 SV=4 427 487 1.0E-06
sp|Q8BIF9|ZN787_MOUSE Zinc finger protein 787 OS=Mus musculus GN=Znf787 PE=2 SV=3 434 487 1.0E-06
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 431 487 1.0E-06
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 427 487 1.0E-06
sp|Q9Z1D9|ZN394_MOUSE Zinc finger protein 394 OS=Mus musculus GN=Znf394 PE=2 SV=3 423 485 1.0E-06
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 431 487 1.0E-06
sp|Q3KNS6|ZN829_HUMAN Zinc finger protein 829 OS=Homo sapiens GN=ZNF829 PE=2 SV=1 432 487 1.0E-06
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 427 487 1.0E-06
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 383 487 1.0E-06
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 432 487 1.0E-06
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 432 487 1.0E-06
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 434 486 1.0E-06
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 432 487 1.0E-06
sp|Q08AN1|ZN616_HUMAN Zinc finger protein 616 OS=Homo sapiens GN=ZNF616 PE=2 SV=2 432 487 1.0E-06
sp|Q6ZNG1|ZN600_HUMAN Zinc finger protein 600 OS=Homo sapiens GN=ZNF600 PE=1 SV=2 432 490 1.0E-06
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 432 487 1.0E-06
sp|O89091|KLF10_MOUSE Krueppel-like factor 10 OS=Mus musculus GN=Klf10 PE=1 SV=1 439 487 1.0E-06
sp|O75290|Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens GN=ZNF780A PE=2 SV=3 427 487 1.0E-06
sp|Q571J5|Z354C_MOUSE Zinc finger protein 354C OS=Mus musculus GN=Znf354c PE=2 SV=2 435 487 1.0E-06
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 432 486 1.0E-06
sp|Q13118|KLF10_HUMAN Krueppel-like factor 10 OS=Homo sapiens GN=KLF10 PE=1 SV=1 439 487 1.0E-06
sp|Q90W33|HIC2_DANRE Hypermethylated in cancer 2 protein OS=Danio rerio GN=hic2 PE=2 SV=1 422 487 1.0E-06
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 420 487 1.0E-06
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 422 492 1.0E-06
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 435 487 1.0E-06
sp|P17014|ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens GN=ZNF12 PE=1 SV=3 427 487 1.0E-06
sp|P17014|ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens GN=ZNF12 PE=1 SV=3 427 487 1.0E-06
sp|Q9BUY5|ZN426_HUMAN Zinc finger protein 426 OS=Homo sapiens GN=ZNF426 PE=1 SV=1 427 487 1.0E-06
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 432 487 1.0E-06
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 423 487 1.0E-06
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 423 487 1.0E-06
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 423 487 1.0E-06
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 420 487 1.0E-06
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 432 487 1.0E-06
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 432 487 1.0E-06
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 432 487 1.0E-06
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 432 487 1.0E-06
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 434 487 1.0E-06
sp|A2T7D2|ZKSC5_PANTR Zinc finger protein with KRAB and SCAN domains 5 OS=Pan troglodytes GN=ZKSCAN5 PE=3 SV=1 422 487 1.0E-06
sp|A2T7D2|ZKSC5_PANTR Zinc finger protein with KRAB and SCAN domains 5 OS=Pan troglodytes GN=ZKSCAN5 PE=3 SV=1 432 485 1.0E-06
sp|Q9Y2L8|ZKSC5_HUMAN Zinc finger protein with KRAB and SCAN domains 5 OS=Homo sapiens GN=ZKSCAN5 PE=1 SV=1 422 487 1.0E-06
sp|Q9Y2L8|ZKSC5_HUMAN Zinc finger protein with KRAB and SCAN domains 5 OS=Homo sapiens GN=ZKSCAN5 PE=1 SV=1 432 485 1.0E-06
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 420 487 1.0E-06
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 432 487 1.0E-06
sp|Q99LI5|ZN281_MOUSE Zinc finger protein 281 OS=Mus musculus GN=Znf281 PE=1 SV=1 422 487 1.0E-06
sp|P18742|ZO19_XENLA Oocyte zinc finger protein XlCOF19 (Fragment) OS=Xenopus laevis PE=3 SV=1 427 485 1.0E-06
sp|Q9NYW8|RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens GN=RBAK PE=1 SV=1 432 487 1.0E-06
sp|Q9NYW8|RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens GN=RBAK PE=1 SV=1 432 487 1.0E-06
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 434 487 1.0E-06
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 432 487 1.0E-06
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 427 487 1.0E-06
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 427 487 1.0E-06
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 423 487 1.0E-06
sp|Q9QXT9|Z354B_MOUSE Zinc finger protein 354B OS=Mus musculus GN=Znf354b PE=2 SV=1 428 487 1.0E-06
sp|Q8TBZ5|ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens GN=ZNF502 PE=1 SV=1 383 487 1.0E-06
sp|Q96ND8|ZN583_HUMAN Zinc finger protein 583 OS=Homo sapiens GN=ZNF583 PE=2 SV=2 432 487 1.0E-06
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 432 492 1.0E-06
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 432 487 2.0E-06
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 432 487 2.0E-06
sp|Q4V8A8|ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus GN=Zfp90 PE=2 SV=1 432 487 2.0E-06
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 432 487 2.0E-06
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 432 487 2.0E-06
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 432 487 2.0E-06
sp|Q9UJN7|ZN391_HUMAN Zinc finger protein 391 OS=Homo sapiens GN=ZNF391 PE=2 SV=2 432 487 2.0E-06
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 426 487 2.0E-06
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 434 488 2.0E-06
sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 422 487 2.0E-06
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 432 487 2.0E-06
sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 422 487 2.0E-06
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 427 487 2.0E-06
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 422 487 2.0E-06
sp|Q49AA0|ZFP69_HUMAN Zinc finger protein ZFP69 OS=Homo sapiens GN=ZFP69 PE=2 SV=2 427 487 2.0E-06
sp|Q8NB42|ZN527_HUMAN Zinc finger protein 527 OS=Homo sapiens GN=ZNF527 PE=2 SV=2 432 487 2.0E-06
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 422 487 2.0E-06
sp|Q96CX3|ZN501_HUMAN Zinc finger protein 501 OS=Homo sapiens GN=ZNF501 PE=2 SV=2 432 487 2.0E-06
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 427 487 2.0E-06
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 423 506 2.0E-06
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 432 487 2.0E-06
sp|P18731|ZG62_XENLA Gastrula zinc finger protein XlCGF62.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 427 500 2.0E-06
sp|P52741|ZN134_HUMAN Zinc finger protein 134 OS=Homo sapiens GN=ZNF134 PE=2 SV=2 434 487 2.0E-06
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 434 487 2.0E-06
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 432 487 2.0E-06
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 432 487 2.0E-06
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 420 487 2.0E-06
sp|Q9Y2Q1|ZN257_HUMAN Zinc finger protein 257 OS=Homo sapiens GN=ZNF257 PE=2 SV=2 434 487 2.0E-06
sp|Q58DK7|ZN205_BOVIN Zinc finger protein 205 OS=Bos taurus GN=ZNF205 PE=2 SV=1 417 487 2.0E-06
sp|Q15929|ZNF56_HUMAN Putative zinc finger protein 56 OS=Homo sapiens GN=ZNF56 PE=5 SV=2 438 487 2.0E-06
sp|Q9Z1D8|ZKSC5_MOUSE Zinc finger protein with KRAB and SCAN domains 5 OS=Mus musculus GN=Zkscan5 PE=2 SV=2 432 485 2.0E-06
sp|Q6P9A1|ZN530_HUMAN Zinc finger protein 530 OS=Homo sapiens GN=ZNF530 PE=2 SV=2 434 487 2.0E-06
sp|Q9UC06|ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens GN=ZNF70 PE=2 SV=2 423 487 2.0E-06
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 422 487 2.0E-06
sp|P10754|ZFP13_MOUSE Zinc finger protein 13 OS=Mus musculus GN=Zfp13 PE=2 SV=2 417 487 2.0E-06
sp|Q9QZ48|ZBT7A_RAT Zinc finger and BTB domain-containing protein 7A OS=Rattus norvegicus GN=Zbtb7a PE=1 SV=1 436 487 2.0E-06
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 432 487 2.0E-06
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 432 487 2.0E-06
sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens GN=ZNF606 PE=2 SV=1 432 487 2.0E-06
sp|P18722|ZG46_XENLA Gastrula zinc finger protein XlCGF46.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 424 485 2.0E-06
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 432 487 2.0E-06
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 427 487 2.0E-06
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 427 487 2.0E-06
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 432 487 2.0E-06
sp|Q1LZC0|ZNF22_BOVIN Zinc finger protein 22 OS=Bos taurus GN=ZNF22 PE=2 SV=1 432 485 2.0E-06
sp|Q96GC6|ZN274_HUMAN Neurotrophin receptor-interacting factor homolog OS=Homo sapiens GN=ZNF274 PE=1 SV=2 434 488 2.0E-06
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 427 487 2.0E-06
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 432 487 2.0E-06
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 432 487 2.0E-06
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 432 486 2.0E-06
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 432 487 2.0E-06
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 432 487 2.0E-06
sp|Q96N58|ZN578_HUMAN Zinc finger protein 578 OS=Homo sapiens GN=ZNF578 PE=2 SV=2 432 487 2.0E-06
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 420 487 2.0E-06
sp|Q9BS34|ZN670_HUMAN Zinc finger protein 670 OS=Homo sapiens GN=ZNF670 PE=1 SV=1 427 487 2.0E-06
sp|P10075|GLI4_HUMAN Zinc finger protein GLI4 OS=Homo sapiens GN=GLI4 PE=1 SV=2 421 487 2.0E-06
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 365 486 2.0E-06
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 434 498 2.0E-06
sp|Q8N4W9|ZN808_HUMAN Zinc finger protein 808 OS=Homo sapiens GN=ZNF808 PE=2 SV=2 432 487 2.0E-06
sp|P52736|ZN133_HUMAN Zinc finger protein 133 OS=Homo sapiens GN=ZNF133 PE=1 SV=2 432 487 2.0E-06
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 427 487 2.0E-06
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 420 487 2.0E-06
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 432 487 2.0E-06
sp|Q49A33|Z876P_HUMAN Putative zinc finger protein 876 OS=Homo sapiens GN=ZNF876P PE=5 SV=3 422 485 2.0E-06
sp|P17014|ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens GN=ZNF12 PE=1 SV=3 427 487 2.0E-06
sp|P17014|ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens GN=ZNF12 PE=1 SV=3 432 487 2.0E-06
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 432 487 2.0E-06
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 420 487 2.0E-06
sp|Q8N587|ZN561_HUMAN Zinc finger protein 561 OS=Homo sapiens GN=ZNF561 PE=2 SV=2 427 487 2.0E-06
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 423 487 2.0E-06
sp|Q4R882|ZN561_MACFA Zinc finger protein 561 OS=Macaca fascicularis GN=ZNF561 PE=2 SV=1 427 487 2.0E-06
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 427 487 2.0E-06
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 432 487 2.0E-06
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 434 488 2.0E-06
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 432 487 2.0E-06
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 383 485 2.0E-06
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 422 487 2.0E-06
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 432 487 2.0E-06
sp|Q9UJU3|ZN112_HUMAN Zinc finger protein 112 OS=Homo sapiens GN=ZNF112 PE=2 SV=2 434 488 2.0E-06
sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 423 487 2.0E-06
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 432 487 2.0E-06
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 434 487 2.0E-06
sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 427 487 2.0E-06
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 427 487 2.0E-06
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 431 487 2.0E-06
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 432 487 2.0E-06
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 432 487 2.0E-06
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 432 487 2.0E-06
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 432 486 2.0E-06
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 432 487 2.0E-06
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 427 487 2.0E-06
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 432 487 2.0E-06
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 279 487 2.0E-06
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 432 487 2.0E-06
sp|Q9Y2X9|ZN281_HUMAN Zinc finger protein 281 OS=Homo sapiens GN=ZNF281 PE=1 SV=1 422 487 2.0E-06
sp|P08043|ZFP2_MOUSE Zinc finger protein 2 OS=Mus musculus GN=Zfp2 PE=2 SV=2 432 487 2.0E-06
sp|Q6PG37|ZN790_HUMAN Zinc finger protein 790 OS=Homo sapiens GN=ZNF790 PE=2 SV=2 432 487 2.0E-06
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 432 487 2.0E-06
sp|Q8BZW4|ZN120_MOUSE Zinc finger protein 120 OS=Mus musculus GN=Zfp120 PE=2 SV=1 427 487 2.0E-06
sp|P18725|ZG5_XENLA Gastrula zinc finger protein 5-1 OS=Xenopus laevis PE=2 SV=2 422 487 2.0E-06
sp|Q8IYN0|ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens GN=ZNF100 PE=2 SV=2 432 487 2.0E-06
sp|P18742|ZO19_XENLA Oocyte zinc finger protein XlCOF19 (Fragment) OS=Xenopus laevis PE=3 SV=1 432 485 2.0E-06
sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=2 SV=2 427 487 2.0E-06
sp|Q62513|ZN260_MOUSE Zinc finger protein 260 OS=Mus musculus GN=Znf260 PE=1 SV=1 406 487 2.0E-06
sp|Q9ERU3|ZNF22_MOUSE Zinc finger protein 22 OS=Mus musculus GN=Znf22 PE=1 SV=2 432 487 2.0E-06
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 434 487 2.0E-06
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 423 487 2.0E-06
sp|A8MT65|ZN891_HUMAN Zinc finger protein 891 OS=Homo sapiens GN=ZNF891 PE=2 SV=2 422 490 2.0E-06
sp|Q923B3|NRIF1_MOUSE Neurotrophin receptor-interacting factor 1 OS=Mus musculus GN=Nrif1 PE=1 SV=3 434 487 2.0E-06
sp|Q3MIS6|ZN528_HUMAN Zinc finger protein 528 OS=Homo sapiens GN=ZNF528 PE=2 SV=1 432 487 2.0E-06
sp|Q8BXX2|ZBT49_MOUSE Zinc finger and BTB domain-containing protein 49 OS=Mus musculus GN=Zbtb49 PE=2 SV=1 432 490 3.0E-06
sp|Q91ZD1|OSR2_MOUSE Protein odd-skipped-related 2 OS=Mus musculus GN=Osr2 PE=1 SV=1 422 486 3.0E-06
sp|Q8N2R0|OSR2_HUMAN Protein odd-skipped-related 2 OS=Homo sapiens GN=OSR2 PE=1 SV=2 422 486 3.0E-06
sp|Q9UNY5|ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens GN=ZNF232 PE=1 SV=1 436 487 3.0E-06
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 432 487 3.0E-06
sp|Q07231|ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus GN=Zscan21 PE=2 SV=2 432 492 3.0E-06
sp|Q07231|ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus GN=Zscan21 PE=2 SV=2 432 487 3.0E-06
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 427 488 3.0E-06
sp|Q49AA0|ZFP69_HUMAN Zinc finger protein ZFP69 OS=Homo sapiens GN=ZFP69 PE=2 SV=2 432 490 3.0E-06
sp|Q8NB42|ZN527_HUMAN Zinc finger protein 527 OS=Homo sapiens GN=ZNF527 PE=2 SV=2 432 487 3.0E-06
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 427 487 3.0E-06
sp|Q5RF70|ZN501_PONAB Zinc finger protein 501 OS=Pongo abelii GN=ZNF501 PE=2 SV=3 432 487 3.0E-06
sp|Q8BPP0|ZN436_MOUSE Zinc finger protein 436 OS=Mus musculus GN=Znf436 PE=2 SV=1 432 487 3.0E-06
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 432 487 3.0E-06
sp|Q8WV37|ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens GN=ZNF480 PE=1 SV=2 432 487 3.0E-06
sp|Q5VIY5|ZN468_HUMAN Zinc finger protein 468 OS=Homo sapiens GN=ZNF468 PE=2 SV=1 383 487 3.0E-06
sp|P39413|AEF1_DROME Adult enhancer factor 1 OS=Drosophila melanogaster GN=Aef1 PE=2 SV=1 408 487 3.0E-06
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 423 487 3.0E-06
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 427 487 3.0E-06
sp|Q9Z2K3|ZN394_RAT Zinc finger protein 394 OS=Rattus norvegicus GN=Znf394 PE=2 SV=1 432 485 3.0E-06
sp|Q9Y2Q1|ZN257_HUMAN Zinc finger protein 257 OS=Homo sapiens GN=ZNF257 PE=2 SV=2 434 487 3.0E-06
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 432 487 3.0E-06
sp|Q9UC06|ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens GN=ZNF70 PE=2 SV=2 432 487 3.0E-06
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 432 491 3.0E-06
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 427 487 3.0E-06
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 432 488 3.0E-06
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 434 487 3.0E-06
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 434 487 3.0E-06
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 432 487 3.0E-06
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 432 487 3.0E-06
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 424 487 3.0E-06
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 432 487 3.0E-06
sp|O75290|Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens GN=ZNF780A PE=2 SV=3 432 487 3.0E-06
sp|Q571J5|Z354C_MOUSE Zinc finger protein 354C OS=Mus musculus GN=Znf354c PE=2 SV=2 432 494 3.0E-06
sp|Q8TC21|ZN596_HUMAN Zinc finger protein 596 OS=Homo sapiens GN=ZNF596 PE=2 SV=2 422 487 3.0E-06
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 423 487 3.0E-06
sp|A7MBI1|ZFP69_BOVIN Zinc finger protein ZFP69 OS=Bos taurus GN=ZFP69 PE=2 SV=1 432 494 3.0E-06
sp|Q8IW36|ZN695_HUMAN Zinc finger protein 695 OS=Homo sapiens GN=ZNF695 PE=1 SV=4 432 485 3.0E-06
sp|Q96N20|ZN75A_HUMAN Zinc finger protein 75A OS=Homo sapiens GN=ZNF75A PE=2 SV=1 420 487 3.0E-06
sp|P17014|ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens GN=ZNF12 PE=1 SV=3 420 487 3.0E-06
sp|Q9NW07|ZN358_HUMAN Zinc finger protein 358 OS=Homo sapiens GN=ZNF358 PE=1 SV=2 423 487 3.0E-06
sp|Q9BUY5|ZN426_HUMAN Zinc finger protein 426 OS=Homo sapiens GN=ZNF426 PE=1 SV=1 427 487 3.0E-06
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 432 487 3.0E-06
sp|Q8N184|ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens GN=ZNF567 PE=1 SV=3 434 487 3.0E-06
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 434 487 3.0E-06
sp|A2VDP4|ZN567_BOVIN Zinc finger protein 567 OS=Bos taurus GN=ZNF567 PE=2 SV=1 432 487 3.0E-06
sp|Q7L2R6|ZN765_HUMAN Zinc finger protein 765 OS=Homo sapiens GN=ZNF765 PE=1 SV=2 432 487 3.0E-06
sp|Q9NV72|ZN701_HUMAN Zinc finger protein 701 OS=Homo sapiens GN=ZNF701 PE=2 SV=3 420 487 3.0E-06
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 432 486 3.0E-06
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 432 487 3.0E-06
sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens GN=ZNF565 PE=2 SV=2 432 487 3.0E-06
sp|Q9BUG6|ZSA5A_HUMAN Zinc finger and SCAN domain-containing protein 5A OS=Homo sapiens GN=ZSCAN5A PE=2 SV=1 434 487 3.0E-06
sp|P18741|ZO15_XENLA Oocyte zinc finger protein XlCOF15 (Fragment) OS=Xenopus laevis PE=3 SV=1 432 487 3.0E-06
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 432 487 3.0E-06
sp|Q96K75|ZN514_HUMAN Zinc finger protein 514 OS=Homo sapiens GN=ZNF514 PE=2 SV=1 427 487 3.0E-06
sp|Q9NYW8|RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens GN=RBAK PE=1 SV=1 432 496 3.0E-06
sp|Q9ERU2|ZNF22_RAT Zinc finger protein 22 OS=Rattus norvegicus GN=Znf22 PE=2 SV=2 432 487 3.0E-06
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 427 486 3.0E-06
sp|Q8N7M2|ZN283_HUMAN Zinc finger protein 283 OS=Homo sapiens GN=ZNF283 PE=2 SV=4 432 485 3.0E-06
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 434 487 3.0E-06
sp|Q02526|ZFP41_MOUSE Zinc finger protein 41 OS=Mus musculus GN=Zfp41 PE=2 SV=2 391 487 3.0E-06
sp|Q567J8|OSR2_DANRE Protein odd-skipped-related 2 OS=Danio rerio GN=osr2 PE=2 SV=1 419 486 4.0E-06
sp|Q62396|ZFP92_MOUSE Zinc finger protein 92 OS=Mus musculus GN=Zfp92 PE=2 SV=2 423 486 4.0E-06
sp|Q61967|ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus GN=Zfp90 PE=2 SV=1 427 487 4.0E-06
sp|P10078|ZFP28_MOUSE Zinc finger protein 28 OS=Mus musculus GN=Zfp28 PE=2 SV=3 432 487 4.0E-06
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 434 486 4.0E-06
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 432 487 4.0E-06
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 427 487 4.0E-06
sp|P41995|ODD1_CAEEL Zinc finger protein odd-1 OS=Caenorhabditis elegans GN=odd-1 PE=2 SV=2 427 485 4.0E-06
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 432 487 4.0E-06
sp|Q6ZN06|ZN813_HUMAN Zinc finger protein 813 OS=Homo sapiens GN=ZNF813 PE=2 SV=2 330 487 4.0E-06
sp|Q05516|ZBT16_HUMAN Zinc finger and BTB domain-containing protein 16 OS=Homo sapiens GN=ZBTB16 PE=1 SV=2 432 498 4.0E-06
sp|Q2KI58|ZN181_BOVIN Zinc finger protein 181 OS=Bos taurus GN=ZNF181 PE=2 SV=1 432 487 4.0E-06
sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=ZNF3 PE=1 SV=3 432 487 4.0E-06
sp|P17036|ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens GN=ZNF3 PE=1 SV=3 432 487 4.0E-06
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 432 487 4.0E-06
sp|Q3U3I9|ZN865_MOUSE Zinc finger protein 865 OS=Mus musculus GN=Znf865 PE=2 SV=1 434 486 4.0E-06
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 427 487 4.0E-06
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 432 486 4.0E-06
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 413 486 4.0E-06
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 432 487 4.0E-06
sp|P17039|ZNF30_HUMAN Zinc finger protein 30 OS=Homo sapiens GN=ZNF30 PE=2 SV=5 432 487 4.0E-06
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 432 487 4.0E-06
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 432 487 4.0E-06
sp|Q08DG8|ZN135_BOVIN Zinc finger protein 135 OS=Bos taurus GN=ZNF135 PE=2 SV=1 427 487 4.0E-06
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 432 487 4.0E-06
sp|Q08ER8|ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens GN=ZNF543 PE=1 SV=3 423 487 4.0E-06
sp|Q6ZNG1|ZN600_HUMAN Zinc finger protein 600 OS=Homo sapiens GN=ZNF600 PE=1 SV=2 432 487 4.0E-06
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 423 487 4.0E-06
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 423 487 4.0E-06
sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 432 487 4.0E-06
sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 432 487 4.0E-06
sp|Q96GC6|ZN274_HUMAN Neurotrophin receptor-interacting factor homolog OS=Homo sapiens GN=ZNF274 PE=1 SV=2 434 487 4.0E-06
sp|Q7Z7K2|ZN467_HUMAN Zinc finger protein 467 OS=Homo sapiens GN=ZNF467 PE=2 SV=1 432 487 4.0E-06
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 434 486 4.0E-06
sp|Q99676|ZN184_HUMAN Zinc finger protein 184 OS=Homo sapiens GN=ZNF184 PE=1 SV=4 431 487 4.0E-06
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 432 487 4.0E-06
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 432 491 4.0E-06
sp|Q9BWM5|ZN416_HUMAN Zinc finger protein 416 OS=Homo sapiens GN=ZNF416 PE=2 SV=1 434 487 4.0E-06
sp|Q9Y6Q3|ZFP37_HUMAN Zinc finger protein 37 homolog OS=Homo sapiens GN=ZFP37 PE=2 SV=3 432 487 4.0E-06
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 423 491 4.0E-06
sp|Q6PDB4|ZN880_HUMAN Zinc finger protein 880 OS=Homo sapiens GN=ZNF880 PE=2 SV=2 432 487 4.0E-06
sp|Q6PDB4|ZN880_HUMAN Zinc finger protein 880 OS=Homo sapiens GN=ZNF880 PE=2 SV=2 432 487 4.0E-06
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 432 486 4.0E-06
sp|A6NM28|ZFP92_HUMAN Zinc finger protein 92 homolog OS=Homo sapiens GN=ZFP92 PE=2 SV=3 423 487 4.0E-06
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 432 487 4.0E-06
sp|A7MBI1|ZFP69_BOVIN Zinc finger protein ZFP69 OS=Bos taurus GN=ZFP69 PE=2 SV=1 427 487 4.0E-06
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 427 487 4.0E-06
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 432 485 4.0E-06
sp|Q6ZMS4|ZN852_HUMAN Zinc finger protein 852 OS=Homo sapiens GN=ZNF852 PE=2 SV=4 432 498 4.0E-06
sp|Q8TB69|ZN519_HUMAN Zinc finger protein 519 OS=Homo sapiens GN=ZNF519 PE=2 SV=2 434 487 4.0E-06
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 432 487 4.0E-06
sp|P0CJ79|ZN888_HUMAN Zinc finger protein 888 OS=Homo sapiens GN=ZNF888 PE=3 SV=1 432 487 4.0E-06
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 427 487 4.0E-06
sp|Q8BQC8|RBAK_MOUSE RB-associated KRAB zinc finger protein OS=Mus musculus GN=Rbak PE=1 SV=1 427 491 4.0E-06
sp|Q8NA42|ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens GN=ZNF383 PE=2 SV=1 432 487 4.0E-06
sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 422 486 4.0E-06
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 432 487 4.0E-06
sp|A2T7D2|ZKSC5_PANTR Zinc finger protein with KRAB and SCAN domains 5 OS=Pan troglodytes GN=ZKSCAN5 PE=3 SV=1 431 485 4.0E-06
sp|Q9Y2L8|ZKSC5_HUMAN Zinc finger protein with KRAB and SCAN domains 5 OS=Homo sapiens GN=ZKSCAN5 PE=1 SV=1 431 485 4.0E-06
sp|O14771|ZN213_HUMAN Zinc finger protein 213 OS=Homo sapiens GN=ZNF213 PE=2 SV=2 432 487 4.0E-06
sp|Q6NSZ9|ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens GN=ZSCAN25 PE=2 SV=3 422 487 4.0E-06
sp|P51522|ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens GN=ZNF83 PE=2 SV=3 422 487 4.0E-06
sp|P18741|ZO15_XENLA Oocyte zinc finger protein XlCOF15 (Fragment) OS=Xenopus laevis PE=3 SV=1 432 485 4.0E-06
sp|Q9NYW8|RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens GN=RBAK PE=1 SV=1 427 491 4.0E-06
sp|Q9NYW8|RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens GN=RBAK PE=1 SV=1 432 487 4.0E-06
sp|Q96EQ9|PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus GN=Prdm9 PE=1 SV=2 427 487 4.0E-06
sp|Q96N38|ZN714_HUMAN Zinc finger protein 714 OS=Homo sapiens GN=ZNF714 PE=2 SV=3 433 487 4.0E-06
sp|Q8N7M2|ZN283_HUMAN Zinc finger protein 283 OS=Homo sapiens GN=ZNF283 PE=2 SV=4 432 487 4.0E-06
sp|Q6V9R5|ZN562_HUMAN Zinc finger protein 562 OS=Homo sapiens GN=ZNF562 PE=2 SV=2 432 487 4.0E-06
sp|Q96ND8|ZN583_HUMAN Zinc finger protein 583 OS=Homo sapiens GN=ZNF583 PE=2 SV=2 432 487 4.0E-06
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 432 487 4.0E-06
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 432 487 5.0E-06
sp|Q9Y2H8|ZN510_HUMAN Zinc finger protein 510 OS=Homo sapiens GN=ZNF510 PE=2 SV=1 434 487 5.0E-06
sp|Q96JL9|ZN333_HUMAN Zinc finger protein 333 OS=Homo sapiens GN=ZNF333 PE=2 SV=3 432 487 5.0E-06
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 432 488 5.0E-06
sp|Q9NR11|ZN302_HUMAN Zinc finger protein 302 OS=Homo sapiens GN=ZNF302 PE=1 SV=1 432 486 5.0E-06
sp|Q9UJL9|ZF69B_HUMAN Zinc finger protein ZFP69B OS=Homo sapiens GN=ZFP69B PE=1 SV=2 432 485 5.0E-06
sp|O75467|Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens GN=ZNF324 PE=2 SV=1 432 487 5.0E-06
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 432 487 5.0E-06
sp|P08155|KRH1_DROME Krueppel homolog 1 OS=Drosophila melanogaster GN=Kr-h1 PE=2 SV=2 422 487 5.0E-06
sp|Q9XSR1|ZN252_CANLF Zinc finger protein 252 OS=Canis lupus familiaris GN=ZNF252 PE=2 SV=1 432 485 5.0E-06
sp|Q8BQN6|OZF_MOUSE Zinc finger protein OZF OS=Mus musculus GN=Znf146 PE=2 SV=2 432 487 5.0E-06
sp|Q9Z1D8|ZKSC5_MOUSE Zinc finger protein with KRAB and SCAN domains 5 OS=Mus musculus GN=Zkscan5 PE=2 SV=2 436 487 5.0E-06
sp|P0CJ78|ZN865_HUMAN Zinc finger protein 865 OS=Homo sapiens GN=ZNF865 PE=3 SV=1 432 486 5.0E-06
sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 432 487 5.0E-06
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 432 487 5.0E-06
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 407 487 5.0E-06
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 434 487 5.0E-06
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 423 487 5.0E-06
sp|Q5RBX0|ZNF7_PONAB Zinc finger protein 7 OS=Pongo abelii GN=ZNF7 PE=2 SV=1 432 487 5.0E-06
sp|O75820|ZN189_HUMAN Zinc finger protein 189 OS=Homo sapiens GN=ZNF189 PE=1 SV=2 432 487 5.0E-06
sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 427 487 5.0E-06
sp|Q1LZC0|ZNF22_BOVIN Zinc finger protein 22 OS=Bos taurus GN=ZNF22 PE=2 SV=1 432 487 5.0E-06
sp|Q5R7I8|ZNF19_PONAB Zinc finger protein 19 OS=Pongo abelii GN=ZNF19 PE=2 SV=1 432 487 5.0E-06
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 432 489 5.0E-06
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 396 487 5.0E-06
sp|Q9NQZ8|ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens GN=ZNF71 PE=2 SV=1 427 487 5.0E-06
sp|Q49A33|Z876P_HUMAN Putative zinc finger protein 876 OS=Homo sapiens GN=ZNF876P PE=5 SV=3 432 487 5.0E-06
sp|Q5JVG2|ZN484_HUMAN Zinc finger protein 484 OS=Homo sapiens GN=ZNF484 PE=1 SV=1 432 487 5.0E-06
sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=1 SV=2 432 487 5.0E-06
sp|Q7L2R6|ZN765_HUMAN Zinc finger protein 765 OS=Homo sapiens GN=ZNF765 PE=1 SV=2 381 487 5.0E-06
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 432 487 5.0E-06
sp|Q9EQB9|ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus GN=Znf287 PE=2 SV=2 427 487 5.0E-06
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 432 485 5.0E-06
sp|Q86Y25|Z354C_HUMAN Zinc finger protein 354C OS=Homo sapiens GN=ZNF354C PE=2 SV=1 435 487 5.0E-06
sp|Q5T5D7|ZN684_HUMAN Zinc finger protein 684 OS=Homo sapiens GN=ZNF684 PE=2 SV=1 432 486 5.0E-06
sp|Q8N7M2|ZN283_HUMAN Zinc finger protein 283 OS=Homo sapiens GN=ZNF283 PE=2 SV=4 368 487 5.0E-06
sp|Q96ND8|ZN583_HUMAN Zinc finger protein 583 OS=Homo sapiens GN=ZNF583 PE=2 SV=2 432 487 5.0E-06
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 422 487 5.0E-06
sp|Q9HBT8|Z286A_HUMAN Zinc finger protein 286A OS=Homo sapiens GN=ZNF286A PE=1 SV=1 434 487 6.0E-06
sp|Q0VGE8|ZN816_HUMAN Zinc finger protein 816 OS=Homo sapiens GN=ZNF816 PE=2 SV=2 432 487 6.0E-06
sp|Q16587|ZNF74_HUMAN Zinc finger protein 74 OS=Homo sapiens GN=ZNF74 PE=2 SV=3 432 487 6.0E-06
sp|A1YG60|ZKSC8_PANPA Zinc finger protein with KRAB and SCAN domains 8 OS=Pan paniscus GN=ZKSCAN8 PE=3 SV=1 429 487 6.0E-06
sp|A2T736|ZKSC8_PANTR Zinc finger protein with KRAB and SCAN domains 8 OS=Pan troglodytes GN=ZKSCAN8 PE=3 SV=1 429 487 6.0E-06
sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 419 487 6.0E-06
sp|Q15776|ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens GN=ZKSCAN8 PE=1 SV=2 429 487 6.0E-06
sp|Q5REF1|ZN181_PONAB Zinc finger protein 181 OS=Pongo abelii GN=ZNF181 PE=2 SV=1 432 487 6.0E-06
sp|Q9Z1D9|ZN394_MOUSE Zinc finger protein 394 OS=Mus musculus GN=Znf394 PE=2 SV=3 432 486 6.0E-06
sp|P15622|ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens GN=ZNF250 PE=1 SV=3 434 487 6.0E-06
sp|Q8WXB4|ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens GN=ZNF606 PE=2 SV=1 427 487 6.0E-06
sp|Q06730|ZN33A_HUMAN Zinc finger protein 33A OS=Homo sapiens GN=ZNF33A PE=1 SV=3 432 487 6.0E-06
sp|Q86XN6|ZN761_HUMAN Zinc finger protein 761 OS=Homo sapiens GN=ZNF761 PE=2 SV=2 434 491 6.0E-06
sp|A2T812|ZN287_PONPY Zinc finger protein 287 OS=Pongo pygmaeus GN=ZNF287 PE=3 SV=1 432 487 6.0E-06
sp|Q9HBT7|ZN287_HUMAN Zinc finger protein 287 OS=Homo sapiens GN=ZNF287 PE=2 SV=1 432 487 6.0E-06
sp|Q9UL36|ZN236_HUMAN Zinc finger protein 236 OS=Homo sapiens GN=ZNF236 PE=2 SV=2 428 487 6.0E-06
sp|P17097|ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens GN=ZNF7 PE=1 SV=1 432 487 6.0E-06
sp|P18744|ZO20_XENLA Oocyte zinc finger protein XlCOF20 (Fragment) OS=Xenopus laevis PE=3 SV=1 432 487 6.0E-06
sp|A6NM28|ZFP92_HUMAN Zinc finger protein 92 homolog OS=Homo sapiens GN=ZFP92 PE=2 SV=3 434 486 6.0E-06
sp|Q9HCX3|ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens GN=ZNF304 PE=2 SV=2 423 487 6.0E-06
sp|Q6ZS27|ZN662_HUMAN Zinc finger protein 662 OS=Homo sapiens GN=ZNF662 PE=1 SV=1 436 486 6.0E-06
sp|P0CG31|Z286B_HUMAN Putative zinc finger protein 286B OS=Homo sapiens GN=ZNF286B PE=5 SV=1 434 487 6.0E-06
sp|Q7TSI0|ZNF12_MOUSE Zinc finger protein 12 OS=Mus musculus GN=Znf12 PE=2 SV=1 427 487 6.0E-06
sp|Q6A085|ZN629_MOUSE Zinc finger protein 629 OS=Mus musculus GN=Znf629 PE=2 SV=2 432 485 6.0E-06
sp|Q5RFP4|OZF_PONAB Zinc finger protein OZF OS=Pongo abelii GN=ZNF146 PE=2 SV=1 432 487 6.0E-06
sp|Q15072|OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens GN=ZNF146 PE=1 SV=2 432 487 6.0E-06
sp|Q96NG5|ZN558_HUMAN Zinc finger protein 558 OS=Homo sapiens GN=ZNF558 PE=2 SV=1 436 487 6.0E-06
sp|B2RUI1|ZN551_MOUSE Zinc finger protein 551 OS=Mus musculus GN=Znf551 PE=2 SV=2 432 487 6.0E-06
sp|P17032|ZN37A_HUMAN Zinc finger protein 37A OS=Homo sapiens GN=ZNF37A PE=2 SV=3 423 487 6.0E-06
sp|Q8IYN0|ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens GN=ZNF100 PE=2 SV=2 432 487 6.0E-06
sp|P28698|MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens GN=MZF1 PE=1 SV=3 432 487 6.0E-06
sp|Q6V9R5|ZN562_HUMAN Zinc finger protein 562 OS=Homo sapiens GN=ZNF562 PE=2 SV=2 432 487 6.0E-06
sp|Q8TBZ5|ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens GN=ZNF502 PE=1 SV=1 432 487 6.0E-06
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 432 487 6.0E-06
sp|Q76KX8|ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens GN=ZNF534 PE=2 SV=1 432 487 7.0E-06
sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=1 SV=2 434 487 7.0E-06
sp|P0CG24|ZN883_HUMAN Zinc finger protein 883 OS=Homo sapiens GN=ZNF883 PE=2 SV=1 434 486 7.0E-06
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 432 487 7.0E-06
sp|Q9UJL9|ZF69B_HUMAN Zinc finger protein ZFP69B OS=Homo sapiens GN=ZFP69B PE=1 SV=2 427 487 7.0E-06
sp|Q9P0L1|ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens GN=ZKSCAN7 PE=1 SV=2 432 487 7.0E-06
sp|Q6AW86|Z324B_HUMAN Zinc finger protein 324B OS=Homo sapiens GN=ZNF324B PE=1 SV=1 432 487 7.0E-06
sp|Q8NHY6|ZFP28_HUMAN Zinc finger protein 28 homolog OS=Homo sapiens GN=ZFP28 PE=1 SV=1 432 487 7.0E-06
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 432 487 7.0E-06
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 434 487 7.0E-06
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 432 487 7.0E-06
sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 432 487 7.0E-06
sp|Q3U3I9|ZN865_MOUSE Zinc finger protein 865 OS=Mus musculus GN=Znf865 PE=2 SV=1 421 518 7.0E-06
sp|Q9NQV7|PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens GN=PRDM9 PE=1 SV=2 432 487 7.0E-06
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 432 487 7.0E-06
sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 432 487 7.0E-06
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 368 487 7.0E-06
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 427 485 7.0E-06
sp|P18751|ZO71_XENLA Oocyte zinc finger protein XlCOF7.1 (Fragment) OS=Xenopus laevis PE=2 SV=1 423 487 7.0E-06
sp|Q4R8H9|ZN274_MACFA Neurotrophin receptor-interacting factor homolog OS=Macaca fascicularis GN=ZNF274 PE=2 SV=1 434 487 7.0E-06
sp|O75290|Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens GN=ZNF780A PE=2 SV=3 432 487 7.0E-06
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 420 487 7.0E-06
sp|Q8IW36|ZN695_HUMAN Zinc finger protein 695 OS=Homo sapiens GN=ZNF695 PE=1 SV=4 432 487 7.0E-06
sp|Q68DY9|ZN772_HUMAN Zinc finger protein 772 OS=Homo sapiens GN=ZNF772 PE=1 SV=2 427 487 7.0E-06
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 432 487 7.0E-06
sp|Q7L2R6|ZN765_HUMAN Zinc finger protein 765 OS=Homo sapiens GN=ZNF765 PE=1 SV=2 432 487 7.0E-06
sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 432 487 7.0E-06
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 432 487 7.0E-06
sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=2 SV=2 432 487 7.0E-06
sp|O43296|ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens GN=ZNF264 PE=1 SV=1 432 487 7.0E-06
sp|Q7TSH9|ZN184_MOUSE Zinc finger protein 184 OS=Mus musculus GN=Zfp184 PE=2 SV=1 414 487 7.0E-06
sp|P30373|CKR1_CHICK Zinc finger protein CKR1 OS=Gallus gallus PE=2 SV=1 436 486 7.0E-06
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 432 487 7.0E-06
sp|Q9NYW8|RBAK_HUMAN RB-associated KRAB zinc finger protein OS=Homo sapiens GN=RBAK PE=1 SV=1 383 485 7.0E-06
sp|Q8N7M2|ZN283_HUMAN Zinc finger protein 283 OS=Homo sapiens GN=ZNF283 PE=2 SV=4 432 487 7.0E-06
sp|Q8N7M2|ZN283_HUMAN Zinc finger protein 283 OS=Homo sapiens GN=ZNF283 PE=2 SV=4 427 487 7.0E-06
sp|Q6ECI4|ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens GN=ZNF470 PE=2 SV=3 432 487 7.0E-06
sp|Q9HBT8|Z286A_HUMAN Zinc finger protein 286A OS=Homo sapiens GN=ZNF286A PE=1 SV=1 423 486 8.0E-06
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 432 487 8.0E-06
sp|Q8TF47|ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens GN=ZFP90 PE=1 SV=2 422 487 8.0E-06
sp|Q2M3W8|ZN181_HUMAN Zinc finger protein 181 OS=Homo sapiens GN=ZNF181 PE=1 SV=1 432 487 8.0E-06
sp|A3KN36|ZNF19_BOVIN Zinc finger protein 19 OS=Bos taurus GN=ZNF19 PE=2 SV=1 432 487 8.0E-06
sp|Q8N9F8|ZN454_HUMAN Zinc finger protein 454 OS=Homo sapiens GN=ZNF454 PE=2 SV=2 432 487 8.0E-06
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 432 487 8.0E-06
sp|P52742|ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens GN=ZNF135 PE=2 SV=3 432 487 8.0E-06
sp|Q9Y6R6|Z780B_HUMAN Zinc finger protein 780B OS=Homo sapiens GN=ZNF780B PE=2 SV=1 432 487 8.0E-06
sp|Q9Z1D9|ZN394_MOUSE Zinc finger protein 394 OS=Mus musculus GN=Znf394 PE=2 SV=3 434 487 8.0E-06
sp|Q8TF45|ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens GN=ZNF418 PE=1 SV=2 434 487 8.0E-06
sp|Q96NG8|ZN582_HUMAN Zinc finger protein 582 OS=Homo sapiens GN=ZNF582 PE=2 SV=1 432 487 8.0E-06
sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=1 SV=1 432 487 8.0E-06
sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 432 487 8.0E-06
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 423 487 8.0E-06
sp|Q86V71|ZN429_HUMAN Zinc finger protein 429 OS=Homo sapiens GN=ZNF429 PE=2 SV=2 434 487 8.0E-06
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 432 487 8.0E-06
sp|Q61116|ZN235_MOUSE Zinc finger protein 235 OS=Mus musculus GN=Znf235 PE=2 SV=1 432 487 8.0E-06
sp|Q9UEG4|ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens GN=ZNF629 PE=1 SV=2 432 485 8.0E-06
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 432 487 8.0E-06
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 432 487 8.0E-06
sp|Q6NX49|ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens GN=ZNF544 PE=1 SV=1 427 509 8.0E-06
sp|Q8N7M2|ZN283_HUMAN Zinc finger protein 283 OS=Homo sapiens GN=ZNF283 PE=2 SV=4 432 487 8.0E-06
sp|P0CI00|Z705B_HUMAN Putative zinc finger protein 705B OS=Homo sapiens GN=ZNF705B PE=5 SV=1 422 487 9.0E-06
sp|Q96SE7|ZN347_HUMAN Zinc finger protein 347 OS=Homo sapiens GN=ZNF347 PE=1 SV=2 432 487 9.0E-06
sp|Q7TNU6|ZN250_MOUSE Zinc finger protein 250 OS=Mus musculus GN=Znf250 PE=2 SV=1 432 487 9.0E-06
sp|Q2KI58|ZN181_BOVIN Zinc finger protein 181 OS=Bos taurus GN=ZNF181 PE=2 SV=1 432 486 9.0E-06
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 434 486 9.0E-06
sp|Q8R1D1|ZN426_MOUSE Zinc finger protein 426 OS=Mus musculus GN=Znf426 PE=2 SV=1 427 487 9.0E-06
sp|Q86TJ5|ZN554_HUMAN Zinc finger protein 554 OS=Homo sapiens GN=ZNF554 PE=2 SV=1 427 487 9.0E-06
sp|Q6ZNG1|ZN600_HUMAN Zinc finger protein 600 OS=Homo sapiens GN=ZNF600 PE=1 SV=2 422 485 9.0E-06
sp|Q6AZW8|ZN660_HUMAN Zinc finger protein 660 OS=Homo sapiens GN=ZNF660 PE=1 SV=1 434 487 9.0E-06
sp|Q9Y6Q3|ZFP37_HUMAN Zinc finger protein 37 homolog OS=Homo sapiens GN=ZFP37 PE=2 SV=3 427 486 9.0E-06
sp|Q96SZ4|ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens GN=ZSCAN10 PE=1 SV=1 432 487 9.0E-06
sp|O14978|ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens GN=ZNF263 PE=1 SV=2 423 485 9.0E-06
sp|Q8N9K5|ZN565_HUMAN Zinc finger protein 565 OS=Homo sapiens GN=ZNF565 PE=2 SV=2 434 487 9.0E-06
sp|P51522|ZNF83_HUMAN Zinc finger protein 83 OS=Homo sapiens GN=ZNF83 PE=2 SV=3 432 487 9.0E-06
sp|Q86Y25|Z354C_HUMAN Zinc finger protein 354C OS=Homo sapiens GN=ZNF354C PE=2 SV=1 432 494 9.0E-06
sp|P17035|ZNF28_HUMAN Zinc finger protein 28 OS=Homo sapiens GN=ZNF28 PE=2 SV=5 423 487 9.0E-06
sp|Q8IYN0|ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens GN=ZNF100 PE=2 SV=2 432 487 9.0E-06
sp|Q923B3|NRIF1_MOUSE Neurotrophin receptor-interacting factor 1 OS=Mus musculus GN=Nrif1 PE=1 SV=3 434 487 9.0E-06
sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 432 487 1.0E-05
sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 432 487 1.0E-05
sp|Q14592|ZN460_HUMAN Zinc finger protein 460 OS=Homo sapiens GN=ZNF460 PE=1 SV=2 434 487 1.0E-05
sp|Q3SXZ3|ZN718_HUMAN Zinc finger protein 718 OS=Homo sapiens GN=ZNF718 PE=2 SV=1 432 486 1.0E-05
sp|O75123|ZN623_HUMAN Zinc finger protein 623 OS=Homo sapiens GN=ZNF623 PE=2 SV=2 434 490 1.0E-05
sp|Q09FC8|ZN415_HUMAN Zinc finger protein 415 OS=Homo sapiens GN=ZNF415 PE=1 SV=2 432 487 1.0E-05
sp|Q9BX82|ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens GN=ZNF471 PE=2 SV=1 432 487 1.0E-05
sp|P17040|ZSC20_HUMAN Zinc finger and SCAN domain-containing protein 20 OS=Homo sapiens GN=ZSCAN20 PE=2 SV=3 432 487 1.0E-05
sp|Q921B4|NRIF2_MOUSE Neurotrophin receptor-interacting factor 2 OS=Mus musculus GN=Nrif2 PE=1 SV=1 434 488 1.0E-05
sp|O75290|Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens GN=ZNF780A PE=2 SV=3 432 487 1.0E-05
sp|Q86W11|ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens GN=ZSCAN30 PE=1 SV=1 432 487 1.0E-05
sp|Q4R6C2|ZN383_MACFA Zinc finger protein 383 OS=Macaca fascicularis GN=ZNF383 PE=2 SV=1 432 487 1.0E-05
sp|P17023|ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens GN=ZNF19 PE=2 SV=4 432 487 1.0E-05
sp|Q6V9R5|ZN562_HUMAN Zinc finger protein 562 OS=Homo sapiens GN=ZNF562 PE=2 SV=2 436 487 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003676 nucleic acid binding Yes
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
C2H2 zinc finger

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1171
LAAETDRPGPAAMDSTMMPQQPVFFFQHDCQGKQQLGLYPTVRALPSTSMPPTSMFSRPGSSSCSQPPTLLSNGP
SAMTPTSSPQLAHHKPAIMLETELGDCSYFPATPPLSAPGSAMGSPKGYDVLQTPMNPMFSGLEDVGAGKMALDS
VDMISVLEWSTCGSPPMTPVYIQSQAAATVASLSSSTTSDLSTASCPSLSPSPTPYARSIASENDVDFCDPRNLT
VSAAASAQTLAPDFQLPPVGEDEVKPDPAAAPSTTVPFDFNPVAAHGLPVFEDLSDLDSDDGFSHLAAVAQRGPA
DVSRPRACTGSSVVSLGHGSFIGDDDFHLDDGEAFHFSSLPSPPSSTDSAADDSHQDKRQKRSMTPAVGAEPVMS
MAAGDASSGGGPHRSEKASSVVSDSNASSNSDEPSAPLPAPTNRRGRKQSLTEDPSKTFVCELCNRRFRRQEHLK
RHYRSLHTQEKPFECNECGKKFSRSDNLAQHARTHAGGAIVMNLIESGDGSVYDAAGMVPGPAVDDYANYGKVLF
QIASEVPGSASELSSEEGNDQGKKKRKRSD*
Coding >Hirsu2|1171
CTGGCCGCTGAGACCGACCGACCAGGCCCAGCAGCCATGGACTCAACCATGATGCCCCAACAGCCCGTCTTCTTC
TTCCAGCACGACTGCCAGGGCAAGCAGCAACTGGGCCTCTACCCCACGGTCCGCGCCCTGCCGTCGACGTCGATG
CCGCCAACGTCCATGTTCTCGCGGCCCGGCTCCTCGTCGTGCTCGCAGCCGCCGACGCTGCTGAGCAACGGCCCG
TCGGCCATGACGCCCACGAGCTCGCCGCAGCTGGCGCACCACAAGCCGGCCATCATGCTGGAGACGGAGCTGGGT
GACTGCTCCTACTTCCCCGCCACGCCGCCGCTGTCGGCCCCGGGCAGCGCCATGGGCAGCCCCAAGGGCTACGAC
GTGCTGCAGACGCCCATGAACCCCATGTTCTCCGGCCTCGAGGACGTGGGCGCCGGCAAGATGGCGCTCGACTCG
GTCGACATGATATCCGTCCTGGAATGGTCCACCTGCGGATCGCCGCCCATGACGCCTGTGTACATTCAATCCCAG
GCTGCCGCCACCGTTGCCTCGCTAAGCAGCAGCACCACGAGCGACCTGTCCACTGCATCGTGCCCGTCGCTCTCG
CCGTCGCCCACGCCGTACGCGCGCTCCATCGCGTCGGAGAACGACGTTGACTTCTGCGACCCGCGGAACCTGACC
GTCTCGGCCGCCGCCTCGGCCCAGACGCTCGCCCCCGACTTCCAGCTCCCGCCCGTCGGAGAGGACGAGGTCAAG
CCGGACCCGGCCGCGGCCCCGTCGACGACGGTCCCCTTCGACTTCAACCCCGTCGCCGCCCACGGCCTGCCCGTC
TTTGAGGACCTGTCCGACCTGGACTCGGACGACGGCTTCAGCCACCTGGCCGCCGTTGCCCAGCGGGGCCCCGCC
GACGTCTCGCGCCCCCGCGCCTGCACCGGCTCCTCGGTCGTCTCCCTGGGCCACGGGAGCTTCATCGGCGACGAC
GACTTCCACCTCGACGACGGCGAGGCCTTCCACTTCTCGTCGCTCCCCAGCCCCCCCTCCAGCACCGACTCGGCG
GCCGACGACAGCCACCAGGACAAGCGCCAGAAGAGGTCCATGACGCCCGCCGTCGGGGCCGAGCCCGTCATGAGC
ATGGCCGCCGGCGACGCGTCTTCGGGCGGCGGCCCCCACCGCTCGGAGAAGGCCTCGTCCGTCGTCTCCGATTCC
AACGCGTCCTCCAACTCGGACGAGCCGTCTGCGCCCCTGCCCGCGCCCACCAATCGGCGCGGCCGCAAGCAGTCG
CTCACCGAGGACCCCTCCAAGACGTTTGTGTGCGAGCTGTGCAACCGACGGTTCCGCCGCCAAGAGCACCTGAAG
CGCCACTACCGCTCCCTGCACACGCAGGAGAAGCCGTTTGAGTGCAACGAGTGCGGCAAGAAGTTTTCCCGCAGC
GACAATCTCGCCCAGCACGCGAGGACACACGCGGGCGGGGCCATCGTCATGAACCTGATTGAGAGCGGCGACGGG
TCCGTCTACGACGCCGCCGGCATGGTGCCGGGCCCGGCCGTCGACGACTACGCCAACTATGGCAAGGTGCTCTTC
CAGATCGCGTCGGAGGTCCCCGGCAGCGCCAGCGAGCTGTCGTCGGAAGAGGGCAACGATCAAGGCAAGAAGAAG
CGCAAGCGCTCGGACTAA
Transcript >Hirsu2|1171
CTGGCCGCTGAGACCGACCGACCAGGCCCAGCAGCCATGGACTCAACCATGATGCCCCAACAGCCCGTCTTCTTC
TTCCAGCACGACTGCCAGGGCAAGCAGCAACTGGGCCTCTACCCCACGGTCCGCGCCCTGCCGTCGACGTCGATG
CCGCCAACGTCCATGTTCTCGCGGCCCGGCTCCTCGTCGTGCTCGCAGCCGCCGACGCTGCTGAGCAACGGCCCG
TCGGCCATGACGCCCACGAGCTCGCCGCAGCTGGCGCACCACAAGCCGGCCATCATGCTGGAGACGGAGCTGGGT
GACTGCTCCTACTTCCCCGCCACGCCGCCGCTGTCGGCCCCGGGCAGCGCCATGGGCAGCCCCAAGGGCTACGAC
GTGCTGCAGACGCCCATGAACCCCATGTTCTCCGGCCTCGAGGACGTGGGCGCCGGCAAGATGGCGCTCGACTCG
GTCGACATGATATCCGTCCTGGAATGGTCCACCTGCGGATCGCCGCCCATGACGCCTGTGTACATTCAATCCCAG
GCTGCCGCCACCGTTGCCTCGCTAAGCAGCAGCACCACGAGCGACCTGTCCACTGCATCGTGCCCGTCGCTCTCG
CCGTCGCCCACGCCGTACGCGCGCTCCATCGCGTCGGAGAACGACGTTGACTTCTGCGACCCGCGGAACCTGACC
GTCTCGGCCGCCGCCTCGGCCCAGACGCTCGCCCCCGACTTCCAGCTCCCGCCCGTCGGAGAGGACGAGGTCAAG
CCGGACCCGGCCGCGGCCCCGTCGACGACGGTCCCCTTCGACTTCAACCCCGTCGCCGCCCACGGCCTGCCCGTC
TTTGAGGACCTGTCCGACCTGGACTCGGACGACGGCTTCAGCCACCTGGCCGCCGTTGCCCAGCGGGGCCCCGCC
GACGTCTCGCGCCCCCGCGCCTGCACCGGCTCCTCGGTCGTCTCCCTGGGCCACGGGAGCTTCATCGGCGACGAC
GACTTCCACCTCGACGACGGCGAGGCCTTCCACTTCTCGTCGCTCCCCAGCCCCCCCTCCAGCACCGACTCGGCG
GCCGACGACAGCCACCAGGACAAGCGCCAGAAGAGGTCCATGACGCCCGCCGTCGGGGCCGAGCCCGTCATGAGC
ATGGCCGCCGGCGACGCGTCTTCGGGCGGCGGCCCCCACCGCTCGGAGAAGGCCTCGTCCGTCGTCTCCGATTCC
AACGCGTCCTCCAACTCGGACGAGCCGTCTGCGCCCCTGCCCGCGCCCACCAATCGGCGCGGCCGCAAGCAGTCG
CTCACCGAGGACCCCTCCAAGACGTTTGTGTGCGAGCTGTGCAACCGACGGTTCCGCCGCCAAGAGCACCTGAAG
CGCCACTACCGCTCCCTGCACACGCAGGAGAAGCCGTTTGAGTGCAACGAGTGCGGCAAGAAGTTTTCCCGCAGC
GACAATCTCGCCCAGCACGCGAGGACACACGCGGGCGGGGCCATCGTCATGAACCTGATTGAGAGCGGCGACGGG
TCCGTCTACGACGCCGCCGGCATGGTGCCGGGCCCGGCCGTCGACGACTACGCCAACTATGGCAAGGTGCTCTTC
CAGATCGCGTCGGAGGTCCCCGGCAGCGCCAGCGAGCTGTCGTCGGAAGAGGGCAACGATCAAGGCAAGAAGAAG
CGCAAGCGCTCGGACTAA
Gene >Hirsu2|1171
CTGGCCGCTGAGGTGAGAGAGAGCCAACCGTCGTCTTTTCCTCTCTCTCTCTCTCGCTCTTGCCCAAGGCAGCGC
CACTAACACGCCCGCGCGGACGCCAGACCGACCGACCAGGCCCAGCAGCCATGGACTCAACCATGATGCCCCAAC
AGCCCGTCTTCTTCTTCCAGCACGACTGCCAGGGCAAGCAGCAACTGGGCCTCTACCCCACGGTCCGCGCCCTGC
CGTCGACGTCGATGCCGCCAACGTCCATGTTCTCGCGGCCCGGCTCCTCGTCGTGCTCGCAGCCGCCGACGCTGC
TGAGCAACGGCCCGTCGGCCATGACGCCCACGAGCTCGCCGCAGCTGGCGCACCACAAGCCGGCCATCATGCTGG
AGACGGAGCTGGGTGACTGCTCCTACTTCCCCGCCACGCCGCCGCTGTCGGCCCCGGGCAGCGCCATGGGCAGCC
CCAAGGGCTACGACGTGCTGCAGACGCCCATGAACCCCATGTTCTCCGGCCTCGAGGACGTGGGCGCCGGCAAGA
TGGCGCTCGACTCGGTCGACATGATATCCGTCCTGGAATGGTCCACCTGCGGATCGCCGCCCATGACGCCTGGTG
AGTGCCCTGCCCCGACCCCGAGCACGCCGGCGACGGCCAGCGGCAGGGGGGCCGCCGACCGGACAGGGGGCCTTG
GTTGGCCCACGTCCCAGGCCGGGAAATGCGTTTGGCTGCGGTGCGACGCCGTGGCCCGCGCTGCCGCGCCAGGCC
CTGCTGCTGCGCCCTTATCGCCCTGCTGATTGCCCGTCGAGAGAGCGGGGGTCCGGTGGCTGACCGGTATTGGCA
CAGTGTACATTCAATCCCAGGCTGCCGCCACCGTTGCCTCGCTAAGCAGCAGCACCACGAGCGACCTGTCCACTG
CATCGTGCCCGTCGCTCTCGCCGTCGCCCACGCCGTACGCGCGCTCCATCGCGTCGGAGAACGACGTTGACTTCT
GCGACCCGCGGAACCTGACCGTCTCGGCCGCCGCCTCGGCCCAGACGCTCGCCCCCGACTTCCAGCTCCCGCCCG
TCGGAGAGGACGAGGTCAAGCCGGACCCGGCCGCGGCCCCGTCGACGACGGTCCCCTTCGACTTCAACCCCGTCG
CCGCCCACGGCCTGCCCGTCTTTGAGGACCTGTCCGACCTGGACTCGGACGACGGCTTCAGCCACCTGGCCGCCG
TTGCCCAGCGGGGCCCCGCCGACGTCTCGCGCCCCCGCGCCTGCACCGGCTCCTCGGTCGTCTCCCTGGGCCACG
GGAGCTTCATCGGCGACGACGACTTCCACCTCGACGACGGCGAGGCCTTCCACTTCTCGTCGCTCCCCAGCCCCC
CCTCCAGCACCGACTCGGCGGCCGACGACAGCCACCAGGACAAGCGCCAGAAGAGGTCCATGACGCCCGCCGTCG
GGGCCGAGCCCGTCATGAGCATGGCCGCCGGCGACGCGTCTTCGGGCGGCGGCCCCCACCGCTCGGAGAAGGCCT
CGTCCGTCGTCTCCGATTCCAACGCGTCCTCCAACTCGGACGAGCCGTCTGCGCCCCTGCCCGCGCCCACCAATC
GGCGCGGCCGCAAGCAGTCGCTCACCGAGGACCCCTCCAAGACGTTTGTGTGCGAGCTGTGCAACCGACGGTTCC
GCCGCCAAGAGCACCTGAAGCGCCACTACCGCTCCCTGCACACGCAGGAGAAGCCGTTTGAGTGCAACGAGTGCG
GCAAGAAGTTTTCCCGCAGCGACAATCTCGCCCAGCACGCGAGGACACACGCGGGCGGGGCCATCGTCATGAACC
TGATTGAGAGCGGCGACGGGTCCGTCTACGACGCCGCCGGCATGGTGCCGGGCCCGGCCGTCGACGACTACGCCA
ACTATGGCAAGGTGCTCTTCCAGATCGCGTCGGAGGTCCCCGGCAGCGCCAGCGAGCTGTCGTCGGAAGAGGGCA
ACGATCAAGGCAAGAAGAAGCGCAAGCGCTCGGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail