Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1166
Gene name
LocationContig_1247:4108..5089
Strand+
Gene length (bp)981
Transcript length (bp)783
Coding sequence length (bp)783
Protein length (aa) 261

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02798 GST_N Glutathione S-transferase, N-terminal domain 1.3E-09 9 85
PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain 5.2E-06 169 235
PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain 1.1E-05 18 89
PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain 1.2E-05 18 87
PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain 1.6E-04 161 238
PF00043 GST_C Glutathione S-transferase, C-terminal domain 2.3E-04 167 237

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P40582|GST1_YEAST Glutathione S-transferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GTT1 PE=1 SV=1 5 256 4.0E-30
sp|Q9P6M1|GST3_SCHPO Glutathione S-transferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gst3 PE=1 SV=3 8 217 5.0E-28

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1166
MDKPLPKIKLHWLNQSRSQRIVWLLEELGAPYEIQVYHRDGRTMLAPPALARVHPLGKSPVVSVSPPGGGDDVVL
AESGFMTQYLCEHLPGGARLVPPRWRDGCEGEVGGETEAWMRYQYLLHYAEGSLMPILVMALVLSRLKSTDVPFL
VRPITSAAANAVLARFVFPNAQKHLRLLEDMLAAGDYLCGDALTAADILMSFPLLAARDRWDDMGRWEGGSWAAT
HPRLVAYVARLEACEGYRRSVDRIEAVDGKFTAAL*
Coding >Hirsu2|1166
ATGGACAAGCCTCTGCCCAAGATCAAGCTCCACTGGCTCAACCAGTCGCGGTCGCAGCGGATCGTCTGGCTGCTG
GAGGAGCTGGGGGCGCCGTACGAGATCCAAGTCTACCACCGCGACGGCCGGACGATGCTGGCGCCGCCGGCGCTC
GCCCGCGTCCACCCGCTCGGCAAGTCGCCCGTCGTCAGCGTCTCGCCGCCCGGCGGCGGCGACGACGTCGTCTTG
GCCGAGAGCGGCTTCATGACGCAGTACCTGTGCGAGCACCTGCCTGGCGGCGCGCGCCTTGTGCCGCCGCGCTGG
AGGGACGGGTGTGAGGGCGAGGTTGGTGGCGAGACGGAGGCGTGGATGCGGTATCAGTACTTGCTGCACTATGCT
GAGGGGAGCTTGATGCCCATCCTCGTCATGGCCCTCGTCCTCTCCCGCCTCAAGTCCACCGACGTGCCGTTCCTG
GTGCGCCCCATCACGTCGGCGGCCGCCAACGCCGTCCTGGCCCGCTTCGTCTTCCCCAACGCGCAAAAGCACCTG
CGCCTGCTCGAGGACATGCTCGCCGCCGGCGACTACCTGTGCGGCGACGCGCTGACCGCCGCCGACATCCTCATG
AGCTTCCCGCTGCTCGCCGCCCGCGACCGCTGGGACGACATGGGCCGCTGGGAAGGCGGCTCCTGGGCCGCCACC
CACCCGCGCCTCGTCGCCTATGTCGCCCGCCTCGAGGCCTGTGAGGGCTACCGCCGCAGCGTCGACCGCATCGAG
GCCGTTGACGGCAAGTTCACGGCTGCCCTGTGA
Transcript >Hirsu2|1166
ATGGACAAGCCTCTGCCCAAGATCAAGCTCCACTGGCTCAACCAGTCGCGGTCGCAGCGGATCGTCTGGCTGCTG
GAGGAGCTGGGGGCGCCGTACGAGATCCAAGTCTACCACCGCGACGGCCGGACGATGCTGGCGCCGCCGGCGCTC
GCCCGCGTCCACCCGCTCGGCAAGTCGCCCGTCGTCAGCGTCTCGCCGCCCGGCGGCGGCGACGACGTCGTCTTG
GCCGAGAGCGGCTTCATGACGCAGTACCTGTGCGAGCACCTGCCTGGCGGCGCGCGCCTTGTGCCGCCGCGCTGG
AGGGACGGGTGTGAGGGCGAGGTTGGTGGCGAGACGGAGGCGTGGATGCGGTATCAGTACTTGCTGCACTATGCT
GAGGGGAGCTTGATGCCCATCCTCGTCATGGCCCTCGTCCTCTCCCGCCTCAAGTCCACCGACGTGCCGTTCCTG
GTGCGCCCCATCACGTCGGCGGCCGCCAACGCCGTCCTGGCCCGCTTCGTCTTCCCCAACGCGCAAAAGCACCTG
CGCCTGCTCGAGGACATGCTCGCCGCCGGCGACTACCTGTGCGGCGACGCGCTGACCGCCGCCGACATCCTCATG
AGCTTCCCGCTGCTCGCCGCCCGCGACCGCTGGGACGACATGGGCCGCTGGGAAGGCGGCTCCTGGGCCGCCACC
CACCCGCGCCTCGTCGCCTATGTCGCCCGCCTCGAGGCCTGTGAGGGCTACCGCCGCAGCGTCGACCGCATCGAG
GCCGTTGACGGCAAGTTCACGGCTGCCCTGTGA
Gene >Hirsu2|1166
ATGGACAAGCCTCTGCCCAAGATCAAGCTCCACTGGTGCGCGCGAGGCCCCCCCTCCCCCCCTTCGAGTCGGCCG
GAGGCTGTCTGACTGACCGACGACCCTTCTTCCTGGCTCAGGCTCAACCAGTCGCGGTCGCAGCGGATCGTCTGG
CTGCTGGAGGAGCTGGGGGCGCCGTACGAGATCCAAGTCTACCACCGCGACGGCCGGACGATGCTGGCGCCGCCG
GCGCTCGCCCGCGTCCACCCGCTCGGCAAGTCGCCCGTCGTCAGCGTCTCGCCGCCCGGCGGCGGCGACGACGTC
GTCTTGGCCGAGAGCGGCTTCATGACGCAGTACCTGTGCGAGCACCTGCCTGGCGGCGCGCGCCTTGTGCCGCCG
CGCTGGAGGGACGGGTGTGAGGGCGAGGTTGGTGGCGAGACGGAGGCGTGGATGCGGTATCAGTACTTGCTGCAC
TATGCTGAGGGGAGCTTGATGCCCATCCTCGTCATGGCCCTCGTCCTCTCCCGTGCGTCCTCTCCCTTCTCTCTC
TCTCTCTCCCTCTGTCTCTGTCTCATACACACACACACACACACTCTCTCTCTCTCTAGACATATACAACCGTCC
CCGCTCACGCGCCTCGCAGGCCTCAAGTCCACCGACGTGCCGTTCCTGGTGCGCCCCATCACGTCGGCGGCCGCC
AACGCCGTCCTGGCCCGCTTCGTCTTCCCCAACGCGCAAAAGCACCTGCGCCTGCTCGAGGACATGCTCGCCGCC
GGCGACTACCTGTGCGGCGACGCGCTGACCGCCGCCGACATCCTCATGAGCTTCCCGCTGCTCGCCGCCCGCGAC
CGCTGGGACGACATGGGCCGCTGGGAAGGCGGCTCCTGGGCCGCCACCCACCCGCGCCTCGTCGCCTATGTCGCC
CGCCTCGAGGCCTGTGAGGGCTACCGCCGCAGCGTCGACCGCATCGAGGCCGTTGACGGCAAGTTCACGGCTGCC
CTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail