Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1164
Gene name
LocationContig_1246:5028..7333
Strand+
Gene length (bp)2305
Transcript length (bp)2166
Coding sequence length (bp)2166
Protein length (aa) 722

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00400 WD40 WD domain, G-beta repeat 3.0E-05 655 684

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10990|CDT2_SCHPO Cell division cycle protein cdt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdt2 PE=1 SV=1 263 696 1.0E-29
sp|Q5ZJW8|DTL_CHICK Denticleless protein homolog OS=Gallus gallus GN=DTL PE=2 SV=1 289 685 8.0E-20
sp|Q6P1W0|DTL_XENTR Denticleless protein homolog OS=Xenopus tropicalis GN=dtl PE=1 SV=1 287 685 4.0E-18
sp|Q9NZJ0|DTL_HUMAN Denticleless protein homolog OS=Homo sapiens GN=DTL PE=1 SV=3 289 710 5.0E-17
sp|Q3TLR7|DTL_MOUSE Denticleless protein homolog OS=Mus musculus GN=Dtl PE=1 SV=2 232 689 7.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10990|CDT2_SCHPO Cell division cycle protein cdt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdt2 PE=1 SV=1 263 696 1.0E-29
sp|Q5ZJW8|DTL_CHICK Denticleless protein homolog OS=Gallus gallus GN=DTL PE=2 SV=1 289 685 8.0E-20
sp|Q6P1W0|DTL_XENTR Denticleless protein homolog OS=Xenopus tropicalis GN=dtl PE=1 SV=1 287 685 4.0E-18
sp|Q9NZJ0|DTL_HUMAN Denticleless protein homolog OS=Homo sapiens GN=DTL PE=1 SV=3 289 710 5.0E-17
sp|Q3TLR7|DTL_MOUSE Denticleless protein homolog OS=Mus musculus GN=Dtl PE=1 SV=2 232 689 7.0E-17
sp|Q6GPU3|DTLB_XENLA Denticleless protein homolog B OS=Xenopus laevis GN=dtl-b PE=2 SV=1 287 687 1.0E-16
sp|Q4V837|DTLA_XENLA Denticleless protein homolog A OS=Xenopus laevis GN=dtl-a PE=2 SV=1 287 710 1.0E-16
sp|Q24371|L2DTL_DROME Protein lethal(2)denticleless OS=Drosophila melanogaster GN=l(2)dtl PE=1 SV=2 289 685 5.0E-16
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2628 0.9164 0.0236 0.0099 0.0533 0.0043 0.0282 0.0165 0.0048 0.014

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1571
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2280
Ophiocordyceps australis map64 (Brazil) OphauB2|5992
Ophiocordyceps camponoti-floridani Ophcf2|06778
Ophiocordyceps camponoti-rufipedis Ophun1|5909
Ophiocordyceps kimflemingae Ophio5|2620
Ophiocordyceps subramaniannii Hirsu2|1164 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1164
MRPQGPAAADAVASSPPPSTPEPPNPFLSPTRSTQPKERRVPSVTPRRFRRFFTPRPLPQQTSRTTLGVMDSVAV
NRQMLSPQSLAGGPLSSDPICPSSPTDRLAPIDEGGDKRKPERQFGPPAKRRRGVDLSDLLPPLPCAPADGERTP
PGSMASLEGDATLSERRKATLSHFFKSSRRGLQSLGDKWQASAQHPAQVDISLAKPLRDYRPQPIRKLRNRGFEA
RLLDREHGFSSHTGKQHLAFPAPDPTVETAGFYSDRYDSYFCTPVEHAGTTIPFSLASCRRSDVTAIGDEHGFVR
LFSTAKLSGPGDKVATTTKVHDNAIMDLDLSGDDSRLASACGDRSGRILDMQTQTVAVELGGGHWDSLRQVTFQP
GRSGDVLASSDRAGRVQVWDLRYSSLPALCFSSGPGGLGRRDDRLDIAAARTVNTIDGAHERTIQGSTSSASVTA
LQWMAAGREHLLLTASEANACIKLWDTRYIKPRRQTAAETPVAATPAPATHAFRSYGITSLALGNDAARLYAVCK
DSTVYAYSTNHLVLGLAPDLLEGAPKRKPAGVEGLGPLYGLKHDSLRVASFYVKCAIRPGPASDGAELLAVGSSD
GCAVLFPTDERYMRAAWARREHVLTSASSSSCPPSSPGVASGSPPILRTGTPLVSGHSREVTTLSWSHDGKLVTA
SDDYSVRQWQWDAGRARHLRQVGDFGGERYNAGWAKVSDGWDEDEC*
Coding >Hirsu2|1164
ATGCGGCCCCAAGGCCCTGCTGCCGCCGATGCGGTGGCCTCGAGCCCGCCGCCGTCGACGCCCGAGCCCCCAAAT
CCCTTCCTTTCCCCGACGAGGTCGACCCAGCCCAAGGAGAGGCGTGTGCCGTCCGTGACGCCCAGGAGGTTCCGG
AGATTCTTCACCCCTCGTCCTCTCCCGCAGCAAACGTCCCGGACGACGCTGGGAGTCATGGATTCCGTCGCGGTT
AACCGCCAGATGCTGTCCCCGCAGTCCCTGGCCGGAGGCCCTCTGAGCTCCGACCCCATCTGCCCTTCCTCGCCC
ACCGACCGTTTAGCACCCATCGACGAGGGCGGCGACAAGAGAAAACCCGAAAGGCAGTTTGGCCCGCCCGCCAAG
AGGCGCCGAGGCGTAGACCTGAGTGATCTGCTGCCTCCGCTGCCCTGTGCGCCTGCGGATGGGGAGAGGACGCCG
CCTGGCAGCATGGCCAGCCTCGAGGGCGACGCTACACTGAGTGAGAGAAGAAAGGCGACTCTCAGCCATTTCTTC
AAGTCTAGTCGGAGAGGTCTGCAGAGCCTGGGCGACAAGTGGCAGGCCTCGGCCCAGCATCCCGCCCAAGTCGAC
ATCAGCCTGGCCAAGCCGCTGCGAGATTACCGGCCCCAGCCCATTCGAAAGCTCCGCAACCGCGGCTTCGAAGCT
CGTCTGCTCGACCGTGAGCACGGCTTCTCCTCCCACACGGGCAAGCAGCACCTCGCCTTTCCGGCGCCGGACCCG
ACGGTCGAGACGGCCGGCTTCTACAGCGACAGATACGACTCCTACTTCTGCACGCCAGTCGAACACGCCGGCACC
ACCATCCCCTTCAGCCTTGCGAGCTGTCGTCGATCCGACGTCACGGCCATCGGCGATGAGCATGGCTTTGTCCGC
CTCTTCTCCACCGCCAAGCTCTCCGGGCCTGGCGACAAGGTGGCCACGACCACCAAGGTCCACGACAATGCCATC
ATGGACCTGGACTTGTCCGGCGACGACAGCCGGCTGGCGAGCGCTTGCGGCGACCGGTCGGGGCGGATCCTCGAC
ATGCAGACGCAGACGGTGGCCGTCGAGCTGGGCGGCGGCCACTGGGACTCCCTGCGGCAGGTCACCTTTCAGCCC
GGACGGTCGGGGGACGTGCTCGCCTCGTCGGACCGAGCCGGCCGAGTACAGGTCTGGGACCTGCGCTACTCCTCC
CTGCCCGCCCTGTGCTTCTCGTCGGGCCCGGGCGGGCTTGGTCGCCGGGACGACAGGCTGGACATTGCCGCCGCC
CGGACGGTCAACACCATCGACGGCGCCCACGAGCGCACGATACAGGGAAGCACGTCGTCGGCCTCGGTCACGGCG
CTGCAGTGGATGGCCGCCGGCCGCGAGCACCTTCTGCTGACGGCGTCGGAGGCAAACGCCTGCATCAAGCTTTGG
GACACGCGCTACATCAAGCCGCGGCGCCAGACGGCGGCGGAGACGCCCGTGGCCGCGACGCCGGCGCCGGCCACG
CACGCCTTCCGCTCCTACGGCATCACGTCCCTGGCCCTGGGCAACGACGCGGCGCGCCTCTATGCCGTCTGCAAG
GACAGCACCGTCTACGCCTACTCGACCAACCACCTGGTCCTCGGCCTGGCCCCCGATCTGCTCGAGGGCGCTCCC
AAGCGGAAGCCCGCCGGCGTCGAGGGCCTCGGGCCGCTCTACGGCCTCAAGCACGACTCGCTGCGCGTCGCCTCT
TTCTACGTCAAGTGCGCGATCCGGCCCGGGCCGGCCAGCGACGGGGCGGAGCTGCTCGCCGTCGGCAGCTCCGAC
GGCTGCGCCGTGCTGTTCCCGACCGACGAGCGGTACATGCGCGCCGCGTGGGCCCGGCGCGAGCACGTCCTCACC
TCCGCCTCCTCCTCTTCCTGCCCCCCTTCCTCCCCCGGCGTGGCGTCGGGGTCGCCGCCCATTCTCCGCACCGGC
ACCCCCTTGGTCTCCGGGCACAGCCGCGAGGTGACGACGCTGAGCTGGTCGCACGACGGCAAGCTCGTGACGGCC
TCGGACGACTACTCGGTCCGGCAGTGGCAGTGGGACGCCGGGCGTGCCAGGCACCTGCGGCAGGTGGGCGACTTC
GGAGGCGAGCGGTACAATGCCGGCTGGGCCAAGGTGAGCGACGGCTGGGACGAGGATGAGTGCTGA
Transcript >Hirsu2|1164
ATGCGGCCCCAAGGCCCTGCTGCCGCCGATGCGGTGGCCTCGAGCCCGCCGCCGTCGACGCCCGAGCCCCCAAAT
CCCTTCCTTTCCCCGACGAGGTCGACCCAGCCCAAGGAGAGGCGTGTGCCGTCCGTGACGCCCAGGAGGTTCCGG
AGATTCTTCACCCCTCGTCCTCTCCCGCAGCAAACGTCCCGGACGACGCTGGGAGTCATGGATTCCGTCGCGGTT
AACCGCCAGATGCTGTCCCCGCAGTCCCTGGCCGGAGGCCCTCTGAGCTCCGACCCCATCTGCCCTTCCTCGCCC
ACCGACCGTTTAGCACCCATCGACGAGGGCGGCGACAAGAGAAAACCCGAAAGGCAGTTTGGCCCGCCCGCCAAG
AGGCGCCGAGGCGTAGACCTGAGTGATCTGCTGCCTCCGCTGCCCTGTGCGCCTGCGGATGGGGAGAGGACGCCG
CCTGGCAGCATGGCCAGCCTCGAGGGCGACGCTACACTGAGTGAGAGAAGAAAGGCGACTCTCAGCCATTTCTTC
AAGTCTAGTCGGAGAGGTCTGCAGAGCCTGGGCGACAAGTGGCAGGCCTCGGCCCAGCATCCCGCCCAAGTCGAC
ATCAGCCTGGCCAAGCCGCTGCGAGATTACCGGCCCCAGCCCATTCGAAAGCTCCGCAACCGCGGCTTCGAAGCT
CGTCTGCTCGACCGTGAGCACGGCTTCTCCTCCCACACGGGCAAGCAGCACCTCGCCTTTCCGGCGCCGGACCCG
ACGGTCGAGACGGCCGGCTTCTACAGCGACAGATACGACTCCTACTTCTGCACGCCAGTCGAACACGCCGGCACC
ACCATCCCCTTCAGCCTTGCGAGCTGTCGTCGATCCGACGTCACGGCCATCGGCGATGAGCATGGCTTTGTCCGC
CTCTTCTCCACCGCCAAGCTCTCCGGGCCTGGCGACAAGGTGGCCACGACCACCAAGGTCCACGACAATGCCATC
ATGGACCTGGACTTGTCCGGCGACGACAGCCGGCTGGCGAGCGCTTGCGGCGACCGGTCGGGGCGGATCCTCGAC
ATGCAGACGCAGACGGTGGCCGTCGAGCTGGGCGGCGGCCACTGGGACTCCCTGCGGCAGGTCACCTTTCAGCCC
GGACGGTCGGGGGACGTGCTCGCCTCGTCGGACCGAGCCGGCCGAGTACAGGTCTGGGACCTGCGCTACTCCTCC
CTGCCCGCCCTGTGCTTCTCGTCGGGCCCGGGCGGGCTTGGTCGCCGGGACGACAGGCTGGACATTGCCGCCGCC
CGGACGGTCAACACCATCGACGGCGCCCACGAGCGCACGATACAGGGAAGCACGTCGTCGGCCTCGGTCACGGCG
CTGCAGTGGATGGCCGCCGGCCGCGAGCACCTTCTGCTGACGGCGTCGGAGGCAAACGCCTGCATCAAGCTTTGG
GACACGCGCTACATCAAGCCGCGGCGCCAGACGGCGGCGGAGACGCCCGTGGCCGCGACGCCGGCGCCGGCCACG
CACGCCTTCCGCTCCTACGGCATCACGTCCCTGGCCCTGGGCAACGACGCGGCGCGCCTCTATGCCGTCTGCAAG
GACAGCACCGTCTACGCCTACTCGACCAACCACCTGGTCCTCGGCCTGGCCCCCGATCTGCTCGAGGGCGCTCCC
AAGCGGAAGCCCGCCGGCGTCGAGGGCCTCGGGCCGCTCTACGGCCTCAAGCACGACTCGCTGCGCGTCGCCTCT
TTCTACGTCAAGTGCGCGATCCGGCCCGGGCCGGCCAGCGACGGGGCGGAGCTGCTCGCCGTCGGCAGCTCCGAC
GGCTGCGCCGTGCTGTTCCCGACCGACGAGCGGTACATGCGCGCCGCGTGGGCCCGGCGCGAGCACGTCCTCACC
TCCGCCTCCTCCTCTTCCTGCCCCCCTTCCTCCCCCGGCGTGGCGTCGGGGTCGCCGCCCATTCTCCGCACCGGC
ACCCCCTTGGTCTCCGGGCACAGCCGCGAGGTGACGACGCTGAGCTGGTCGCACGACGGCAAGCTCGTGACGGCC
TCGGACGACTACTCGGTCCGGCAGTGGCAGTGGGACGCCGGGCGTGCCAGGCACCTGCGGCAGGTGGGCGACTTC
GGAGGCGAGCGGTACAATGCCGGCTGGGCCAAGGTGAGCGACGGCTGGGACGAGGATGAGTGCTGA
Gene >Hirsu2|1164
ATGCGGCCCCAAGGCCCTGCTGCCGCCGATGCGGTGGCCTCGAGCCCGCCGCCGTCGACGCCCGAGCCCCCAAAT
CCCTTCCTTTCCCCGACGAGGTCGACCCAGCCCAAGGAGAGGCGTGTGCCGTCCGTGACGCCCAGGAGGTTCCGG
AGATTCTTCACCCCTCGTCCTCTCCCGCAGCAAACGTCCCGGACGACGCTGGGAGTCATGGATTCCGTCGCGGTT
AACCGCCAGATGCTGTCCCCGCAGTCCCTGGCCGGAGGCCCTCTGAGCTCCGACCCCATCTGCCCTTCCTCGCCC
ACCGACCGTTTAGCACCCATCGACGAGGGCGGCGACAAGAGAAAACCCGAAAGGCAGTTTGGCCCGCCCGCCAAG
AGGCGCCGAGGCGTAGACCTGAGTGATCTGCTGCCTCCGCTGCCCTGTGCGCCTGCGGATGGGGAGAGGACGCCG
CCTGGCAGCATGGCCAGCCTCGAGGGCGACGCTACACTGAGTGAGAGAAGAAAGGCGACTCTCGTGAGCCTTGGC
CGACTCCTCAACACCTTCACCTACAACCATCTTTCTGACACTTTTCGCCCCTCCCAGAGCCATTTCTTCAAGTCT
AGTCGGAGAGGTCTGCAGAGCCTGGGCGACAAGTGGCAGGCCTCGGCCCAGCATCCCGCCCAAGTCGACATCAGC
CTGGCCAAGGTCAGTGCTCTTGGCCTGCCCTACTCTTTTTCTCCCGCAAAGCTGTCTCTAACACGCCCCTCTCCG
CTAGCCGCTGCGAGATTACCGGCCCCAGCCCATTCGAAAGCTCCGCAACCGCGGCTTCGAAGCTCGTCTGCTCGA
CCGTGAGCACGGCTTCTCCTCCCACACGGGCAAGCAGCACCTCGCCTTTCCGGCGCCGGACCCGACGGTCGAGAC
GGCCGGCTTCTACAGCGACAGATACGACTCCTACTTCTGCACGCCAGTCGAACACGCCGGCACCACCATCCCCTT
CAGCCTTGCGAGCTGTCGTCGATCCGACGTCACGGCCATCGGCGATGAGCATGGCTTTGTCCGCCTCTTCTCCAC
CGCCAAGCTCTCCGGGCCTGGCGACAAGGTGGCCACGACCACCAAGGTCCACGACAATGCCATCATGGACCTGGA
CTTGTCCGGCGACGACAGCCGGCTGGCGAGCGCTTGCGGCGACCGGTCGGGGCGGATCCTCGACATGCAGACGCA
GACGGTGGCCGTCGAGCTGGGCGGCGGCCACTGGGACTCCCTGCGGCAGGTCACCTTTCAGCCCGGACGGTCGGG
GGACGTGCTCGCCTCGTCGGACCGAGCCGGCCGAGTACAGGTCTGGGACCTGCGCTACTCCTCCCTGCCCGCCCT
GTGCTTCTCGTCGGGCCCGGGCGGGCTTGGTCGCCGGGACGACAGGCTGGACATTGCCGCCGCCCGGACGGTCAA
CACCATCGACGGCGCCCACGAGCGCACGATACAGGGAAGCACGTCGTCGGCCTCGGTCACGGCGCTGCAGTGGAT
GGCCGCCGGCCGCGAGCACCTTCTGCTGACGGCGTCGGAGGCAAACGCCTGCATCAAGCTTTGGGACACGCGCTA
CATCAAGCCGCGGCGCCAGACGGCGGCGGAGACGCCCGTGGCCGCGACGCCGGCGCCGGCCACGCACGCCTTCCG
CTCCTACGGCATCACGTCCCTGGCCCTGGGCAACGACGCGGCGCGCCTCTATGCCGTCTGCAAGGACAGCACCGT
CTACGCCTACTCGACCAACCACCTGGTCCTCGGCCTGGCCCCCGATCTGCTCGAGGGCGCTCCCAAGCGGAAGCC
CGCCGGCGTCGAGGGCCTCGGGCCGCTCTACGGCCTCAAGCACGACTCGCTGCGCGTCGCCTCTTTCTACGTCAA
GTGCGCGATCCGGCCCGGGCCGGCCAGCGACGGGGCGGAGCTGCTCGCCGTCGGCAGCTCCGACGGCTGCGCCGT
GCTGTTCCCGACCGACGAGCGGTACATGCGCGCCGCGTGGGCCCGGCGCGAGCACGTCCTCACCTCCGCCTCCTC
CTCTTCCTGCCCCCCTTCCTCCCCCGGCGTGGCGTCGGGGTCGCCGCCCATTCTCCGCACCGGCACCCCCTTGGT
CTCCGGGCACAGCCGCGAGGTGACGACGCTGAGCTGGTCGCACGACGGCAAGCTCGTGACGGCCTCGGACGACTA
CTCGGTCCGGCAGTGGCAGTGGGACGCCGGGCGTGCCAGGCACCTGCGGCAGGTGGGCGACTTCGGAGGCGAGCG
GTACAATGCCGGCTGGGCCAAGGTGAGCGACGGCTGGGACGAGGATGAGTGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail