Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1163
Gene name
LocationContig_1246:2629..3942
Strand-
Gene length (bp)1313
Transcript length (bp)1134
Coding sequence length (bp)1134
Protein length (aa) 378

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13230 GATase_4 Glutamine amidotransferases class-II 6.0E-14 38 299
PF13522 GATase_6 Glutamine amidotransferase domain 5.1E-09 79 166

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53871|DUG3_YEAST Probable glutamine amidotransferase DUG3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUG3 PE=1 SV=1 1 333 1.0E-103
sp|P54004|Y199_SYNY3 Putative glutamine amidotransferase slr0199 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0199 PE=3 SV=1 1 310 3.0E-30
sp|O69670|EGTC_MYCTU Gamma-glutamyl-hercynylcysteine sulfoxide hydrolase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=egtC PE=1 SV=1 1 121 3.0E-11
sp|A0R5M9|EGTC_MYCS2 Gamma-glutamyl-hercynylcysteine sulfoxide hydrolase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=egtC PE=1 SV=1 1 121 4.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1163
MCRFLVYKGSDEILLSKLILDPAHSILKQSFDSRLRLDTRRGQNNADGFGIGFYTDPKLGAPPCLFTSTIPAWNC
TNLQRIASKTASRLIFGHVRATTEGSLSEDNCHPFTHGSLMWMHNGNLGGWKHIKRRLGDRLADKWYLGVKGGTD
SEWAFALFLDTLERLGHSPGACPETGFGPTVLRRAMEQTIAQINELTDSIPQELVQSDDVDTRSLLNFAVTDGHS
VICTRYVSSSKDEAASLYYSSGTQWVTRTAEADDRRYQMERKDKGADIVLVASEPLTFERENWVNVPTNSILTIH
RQTVMVHPILDKYYERDPCHVRSSAFVQAKGLLSNEKAPSPGHEARQSAFDGCRKPCSGSHSPDLMRRSQTPASL
RE*
Coding >Hirsu2|1163
ATGTGCCGCTTTTTGGTATACAAGGGCAGCGACGAGATTCTTCTGTCGAAGCTCATCCTCGACCCTGCCCATTCG
ATCCTCAAACAATCCTTCGACTCGCGGCTGCGACTCGACACGCGGCGAGGGCAGAACAATGCCGACGGCTTCGGC
ATCGGGTTCTATACCGACCCCAAGCTCGGGGCGCCGCCCTGCCTCTTCACGTCGACCATCCCGGCCTGGAACTGC
ACCAACCTGCAGCGGATCGCGTCCAAGACGGCGTCGCGGCTGATATTCGGGCACGTGCGCGCCACGACCGAAGGC
TCCCTCAGCGAGGACAACTGCCATCCCTTCACGCACGGCAGCCTCATGTGGATGCACAACGGCAACCTCGGGGGG
TGGAAGCACATCAAGAGGCGGCTCGGCGACCGGCTGGCCGACAAGTGGTACCTGGGCGTCAAGGGCGGGACGGAC
AGCGAGTGGGCCTTTGCCCTCTTCCTCGACACGCTCGAGCGGCTGGGCCACAGCCCCGGCGCCTGCCCGGAGACG
GGCTTCGGGCCGACGGTGCTGCGCAGGGCCATGGAGCAGACGATTGCGCAGATCAACGAGCTGACCGACTCGATC
CCGCAGGAGCTGGTGCAGAGCGACGACGTCGACACCAGGAGCCTGCTCAACTTCGCCGTCACCGACGGCCACAGC
GTCATCTGCACGCGATACGTCAGCAGCTCCAAGGACGAGGCCGCCAGCCTGTACTACTCGTCCGGCACGCAGTGG
GTGACGCGGACGGCCGAGGCCGACGACCGGCGCTACCAGATGGAGCGCAAGGACAAGGGCGCCGACATCGTCCTC
GTCGCCAGCGAGCCGCTGACGTTTGAGAGGGAAAATTGGGTCAACGTGCCGACAAACTCAATCTTGACGATCCAT
CGACAGACGGTCATGGTGCACCCGATCCTCGACAAGTACTACGAGCGAGACCCGTGCCACGTCCGGTCCAGCGCC
TTTGTCCAGGCCAAGGGCCTGCTGTCGAACGAGAAGGCGCCGAGCCCCGGCCACGAGGCCCGGCAGTCGGCCTTT
GACGGCTGCAGGAAGCCCTGCTCCGGGAGTCACAGCCCGGACCTGATGCGAAGGTCGCAGACGCCGGCCTCGTTG
CGAGAGTGA
Transcript >Hirsu2|1163
ATGTGCCGCTTTTTGGTATACAAGGGCAGCGACGAGATTCTTCTGTCGAAGCTCATCCTCGACCCTGCCCATTCG
ATCCTCAAACAATCCTTCGACTCGCGGCTGCGACTCGACACGCGGCGAGGGCAGAACAATGCCGACGGCTTCGGC
ATCGGGTTCTATACCGACCCCAAGCTCGGGGCGCCGCCCTGCCTCTTCACGTCGACCATCCCGGCCTGGAACTGC
ACCAACCTGCAGCGGATCGCGTCCAAGACGGCGTCGCGGCTGATATTCGGGCACGTGCGCGCCACGACCGAAGGC
TCCCTCAGCGAGGACAACTGCCATCCCTTCACGCACGGCAGCCTCATGTGGATGCACAACGGCAACCTCGGGGGG
TGGAAGCACATCAAGAGGCGGCTCGGCGACCGGCTGGCCGACAAGTGGTACCTGGGCGTCAAGGGCGGGACGGAC
AGCGAGTGGGCCTTTGCCCTCTTCCTCGACACGCTCGAGCGGCTGGGCCACAGCCCCGGCGCCTGCCCGGAGACG
GGCTTCGGGCCGACGGTGCTGCGCAGGGCCATGGAGCAGACGATTGCGCAGATCAACGAGCTGACCGACTCGATC
CCGCAGGAGCTGGTGCAGAGCGACGACGTCGACACCAGGAGCCTGCTCAACTTCGCCGTCACCGACGGCCACAGC
GTCATCTGCACGCGATACGTCAGCAGCTCCAAGGACGAGGCCGCCAGCCTGTACTACTCGTCCGGCACGCAGTGG
GTGACGCGGACGGCCGAGGCCGACGACCGGCGCTACCAGATGGAGCGCAAGGACAAGGGCGCCGACATCGTCCTC
GTCGCCAGCGAGCCGCTGACGTTTGAGAGGGAAAATTGGGTCAACGTGCCGACAAACTCAATCTTGACGATCCAT
CGACAGACGGTCATGGTGCACCCGATCCTCGACAAGTACTACGAGCGAGACCCGTGCCACGTCCGGTCCAGCGCC
TTTGTCCAGGCCAAGGGCCTGCTGTCGAACGAGAAGGCGCCGAGCCCCGGCCACGAGGCCCGGCAGTCGGCCTTT
GACGGCTGCAGGAAGCCCTGCTCCGGGAGTCACAGCCCGGACCTGATGCGAAGGTCGCAGACGCCGGCCTCGTTG
CGAGAGTGA
Gene >Hirsu2|1163
ATGTGCCGCTTTTTGGTTCGTCGCCTCGTCGCCGCAGCCAACGGCTTCGGTCCGTCGGACGCGCGCTCACCTCGT
CCCCTCCGTCTAGGTATACAAGGGCAGCGACGAGATTCTTCTGTCGAAGCTCATCCTCGACCCTGCCCATTCGAT
CCTCAAACAATCCTTCGACTCGCGGCTGCGACTCGTAAGAAGCCGAGCCCCCCTTGTTCTGCCCTCCCCGAGGGG
CTGACACCCGACAGGACACGCGGCGAGGGCAGAACAATGCCGACGGCTTCGGCATCGGGTTCTATACCGACCCCA
AGCTCGGGGCGCCGCCCTGCCTCTTCACGTCGACCATCCCGGCCTGGAACTGCACCAACCTGCAGCGGATCGCGT
CCAAGACGGCGTCGCGGCTGATATTCGGGCACGTGCGCGCCACGACCGAAGGCTCCCTCAGCGAGGACAACTGCC
ATCCCTTCACGCACGGCAGCCTCATGTGGATGCACAACGGCAACCTCGGGGGGTGGAAGCACATCAAGAGGCGGC
TCGGCGACCGGCTGGCCGACAAGTGGTACCTGGGCGTCAAGGGCGGGACGGACAGCGAGTGGGCCTTTGCCCTCT
TCCTCGACACGCTCGAGCGGCTGGGCCACAGCCCCGGCGCCTGCCCGGAGACGGGCTTCGGGCCGACGGTGCTGC
GCAGGGCCATGGAGCAGACGATTGCGCAGATCAACGAGCTGACCGACTCGATCCCGCAGGAGCTGGTGCAGAGCG
ACGACGTCGACACCAGGAGCCTGCTCAACTTCGCCGTCACCGACGGCCACAGCGTCATCTGCACGCGATACGTCA
GCAGCTCCAAGGACGAGGCCGCCAGCCTGTACTACTCGTCCGGCACGCAGTGGGTGACGCGGACGGCCGAGGCCG
ACGACCGGCGCTACCAGATGGAGCGCAAGGACAAGGGCGCCGACATCGTCCTCGTCGCCAGCGAGCCGCTGACGT
TTGAGAGGGGTGAGTGAGGCGGGCTTGCCAGACGACGGACGGACGGCTGACGCAGGCCAGAAAATTGGGTCAACG
TGCCGACAAACTCAATCTTGACGATCCATCGACAGACGGTCATGGTGCACCCGATCCTCGACAAGTACTACGAGC
GAGACCCGTGCCACGTCCGGTCCAGCGCCTTTGTCCAGGCCAAGGGCCTGCTGTCGAACGAGAAGGCGCCGAGCC
CCGGCCACGAGGCCCGGCAGTCGGCCTTTGACGGCTGCAGGAAGCCCTGCTCCGGGAGTCACAGCCCGGACCTGA
TGCGAAGGTCGCAGACGCCGGCCTCGTTGCGAGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail