Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|115
Gene name
LocationContig_1017:2000..3367
Strand-
Gene length (bp)1367
Transcript length (bp)1314
Coding sequence length (bp)1314
Protein length (aa) 438

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07993 NAD_binding_4 Male sterility protein 1.4E-28 21 301

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q96K12|FACR2_HUMAN Fatty acyl-CoA reductase 2 OS=Homo sapiens GN=FAR2 PE=2 SV=1 9 330 2.0E-15
sp|Q0P5J1|FACR2_BOVIN Fatty acyl-CoA reductase 2 OS=Bos taurus GN=FAR2 PE=2 SV=1 9 330 4.0E-14
sp|Q66H50|FACR1_RAT Fatty acyl-CoA reductase 1 OS=Rattus norvegicus GN=Far1 PE=2 SV=1 9 304 3.0E-13
sp|Q922J9|FACR1_MOUSE Fatty acyl-CoA reductase 1 OS=Mus musculus GN=Far1 PE=1 SV=1 9 304 5.0E-13
sp|Q5R834|FACR1_PONAB Fatty acyl-CoA reductase 1 OS=Pongo abelii GN=FAR1 PE=2 SV=1 9 304 8.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q96K12|FACR2_HUMAN Fatty acyl-CoA reductase 2 OS=Homo sapiens GN=FAR2 PE=2 SV=1 9 330 2.0E-15
sp|Q0P5J1|FACR2_BOVIN Fatty acyl-CoA reductase 2 OS=Bos taurus GN=FAR2 PE=2 SV=1 9 330 4.0E-14
sp|Q66H50|FACR1_RAT Fatty acyl-CoA reductase 1 OS=Rattus norvegicus GN=Far1 PE=2 SV=1 9 304 3.0E-13
sp|Q922J9|FACR1_MOUSE Fatty acyl-CoA reductase 1 OS=Mus musculus GN=Far1 PE=1 SV=1 9 304 5.0E-13
sp|Q5R834|FACR1_PONAB Fatty acyl-CoA reductase 1 OS=Pongo abelii GN=FAR1 PE=2 SV=1 9 304 8.0E-13
sp|Q8WVX9|FACR1_HUMAN Fatty acyl-CoA reductase 1 OS=Homo sapiens GN=FAR1 PE=1 SV=1 9 304 8.0E-13
sp|Q7TNT2|FACR2_MOUSE Fatty acyl-CoA reductase 2 OS=Mus musculus GN=Far2 PE=2 SV=1 9 330 2.0E-12
sp|Q7ZXF5|FACR1_XENLA Fatty acyl-CoA reductase 1 OS=Xenopus laevis GN=far1 PE=2 SV=1 9 304 2.0E-10
sp|A1ZAI5|FACR1_DROME Putative fatty acyl-CoA reductase CG5065 OS=Drosophila melanogaster GN=CG5065 PE=3 SV=1 9 304 4.0E-10
sp|Q5ZM72|FACR1_CHICK Fatty acyl-CoA reductase 1 OS=Gallus gallus GN=FAR1 PE=2 SV=1 9 304 4.0E-10
sp|A1ZAI3|FACR2_DROME Putative fatty acyl-CoA reductase CG8303 OS=Drosophila melanogaster GN=CG8303 PE=2 SV=2 9 165 4.0E-08
sp|Q960W6|FACR3_DROME Putative fatty acyl-CoA reductase CG8306 OS=Drosophila melanogaster GN=CG8306 PE=2 SV=1 9 304 9.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|115
MAEAEVDRVKQFYKDRTLFMTGASGMVGTVLLAKLVLDTEVKKIYALVRGGEWRLWSGLRSSLPPILVAALQNLN
KIVALDGDIERAGCGIGEENWQKVRTETTVFIHLASSTRQDMPLPVAAQEIVFPSLAVADMAFDCPNLSRFVYVS
SAYQCSFFERTDKGLTGFDKSVPENIDPKARGGRDLDAVLDELRTPGPMSYEHGEFATTYAHVKFVTEWALSEAF
RGRGVEDKLMIHRPAVLGAAERFPYPLFEKAGSTPNVTIAAMLAMSPEQEILAPRMAPDPSEYSLNEMPVDIAVN
HLLAHLALGTTGCVHAVASPRQEHRTTRSMPQWSRLFRAPAAGQVRIRWCDDHWTSPRVSIAFRLFPIVSCVFNF
EDNKSEQLWRGMNGRERLAWPLRATIDVTSDSYWLGRKTMVEQVVRILQAHANSNPSPWISA*
Coding >Hirsu2|115
ATGGCAGAGGCAGAAGTCGACAGAGTCAAGCAGTTCTACAAAGACCGGACGCTTTTCATGACGGGGGCAAGTGGC
ATGGTCGGAACGGTCCTGTTGGCCAAGCTGGTCCTGGACACGGAGGTGAAGAAGATATATGCCTTGGTAAGGGGA
GGAGAGTGGCGGCTGTGGAGCGGTCTGCGATCGAGCTTGCCGCCCATCCTCGTCGCAGCCTTGCAAAACCTCAAC
AAGATTGTCGCTCTCGACGGGGATATCGAGAGGGCGGGGTGCGGGATCGGAGAGGAGAACTGGCAGAAGGTGCGG
ACCGAGACGACGGTATTCATTCACTTAGCCTCGTCCACACGACAAGATATGCCCCTGCCGGTGGCCGCGCAGGAA
ATCGTCTTCCCGTCCCTCGCGGTCGCGGACATGGCATTCGACTGCCCCAACCTCTCTCGCTTTGTTTACGTCTCG
TCCGCCTATCAGTGCTCCTTCTTTGAGAGGACGGACAAGGGCTTGACCGGCTTCGACAAAAGTGTGCCCGAGAAC
ATTGACCCGAAAGCCAGAGGCGGCAGGGATCTCGATGCCGTGCTTGACGAGCTTCGCACACCGGGACCGATGTCC
TACGAACACGGGGAATTCGCGACCACATATGCGCACGTCAAGTTCGTCACGGAGTGGGCTCTTTCAGAGGCCTTT
CGCGGTCGGGGCGTGGAAGACAAGCTCATGATCCATCGGCCAGCGGTCCTCGGCGCAGCTGAACGCTTCCCGTAT
CCGCTGTTCGAAAAGGCGGGATCGACGCCGAACGTCACAATTGCGGCCATGTTGGCGATGAGTCCCGAACAGGAG
ATTCTCGCTCCTCGGATGGCGCCGGATCCGTCAGAGTATTCCCTCAACGAGATGCCGGTCGACATCGCCGTCAAC
CATCTCCTGGCCCATCTCGCGCTCGGGACGACCGGCTGCGTCCATGCCGTCGCCTCGCCCCGACAGGAACACAGG
ACGACGCGTTCGATGCCGCAGTGGAGCAGGCTCTTCCGCGCGCCGGCCGCGGGGCAGGTCCGTATCCGCTGGTGC
GACGACCACTGGACCTCGCCGCGAGTTTCCATCGCCTTCCGACTCTTCCCCATAGTCAGCTGCGTGTTCAATTTC
GAGGACAACAAGTCGGAGCAGCTATGGCGGGGGATGAACGGGCGCGAGCGGCTCGCGTGGCCTCTGCGGGCGACC
ATCGACGTCACGAGCGACAGCTACTGGCTGGGCAGGAAGACGATGGTGGAACAGGTAGTTCGAATACTGCAAGCC
CACGCGAACAGCAATCCGTCCCCATGGATATCTGCCTAG
Transcript >Hirsu2|115
ATGGCAGAGGCAGAAGTCGACAGAGTCAAGCAGTTCTACAAAGACCGGACGCTTTTCATGACGGGGGCAAGTGGC
ATGGTCGGAACGGTCCTGTTGGCCAAGCTGGTCCTGGACACGGAGGTGAAGAAGATATATGCCTTGGTAAGGGGA
GGAGAGTGGCGGCTGTGGAGCGGTCTGCGATCGAGCTTGCCGCCCATCCTCGTCGCAGCCTTGCAAAACCTCAAC
AAGATTGTCGCTCTCGACGGGGATATCGAGAGGGCGGGGTGCGGGATCGGAGAGGAGAACTGGCAGAAGGTGCGG
ACCGAGACGACGGTATTCATTCACTTAGCCTCGTCCACACGACAAGATATGCCCCTGCCGGTGGCCGCGCAGGAA
ATCGTCTTCCCGTCCCTCGCGGTCGCGGACATGGCATTCGACTGCCCCAACCTCTCTCGCTTTGTTTACGTCTCG
TCCGCCTATCAGTGCTCCTTCTTTGAGAGGACGGACAAGGGCTTGACCGGCTTCGACAAAAGTGTGCCCGAGAAC
ATTGACCCGAAAGCCAGAGGCGGCAGGGATCTCGATGCCGTGCTTGACGAGCTTCGCACACCGGGACCGATGTCC
TACGAACACGGGGAATTCGCGACCACATATGCGCACGTCAAGTTCGTCACGGAGTGGGCTCTTTCAGAGGCCTTT
CGCGGTCGGGGCGTGGAAGACAAGCTCATGATCCATCGGCCAGCGGTCCTCGGCGCAGCTGAACGCTTCCCGTAT
CCGCTGTTCGAAAAGGCGGGATCGACGCCGAACGTCACAATTGCGGCCATGTTGGCGATGAGTCCCGAACAGGAG
ATTCTCGCTCCTCGGATGGCGCCGGATCCGTCAGAGTATTCCCTCAACGAGATGCCGGTCGACATCGCCGTCAAC
CATCTCCTGGCCCATCTCGCGCTCGGGACGACCGGCTGCGTCCATGCCGTCGCCTCGCCCCGACAGGAACACAGG
ACGACGCGTTCGATGCCGCAGTGGAGCAGGCTCTTCCGCGCGCCGGCCGCGGGGCAGGTCCGTATCCGCTGGTGC
GACGACCACTGGACCTCGCCGCGAGTTTCCATCGCCTTCCGACTCTTCCCCATAGTCAGCTGCGTGTTCAATTTC
GAGGACAACAAGTCGGAGCAGCTATGGCGGGGGATGAACGGGCGCGAGCGGCTCGCGTGGCCTCTGCGGGCGACC
ATCGACGTCACGAGCGACAGCTACTGGCTGGGCAGGAAGACGATGGTGGAACAGGTAGTTCGAATACTGCAAGCC
CACGCGAACAGCAATCCGTCCCCATGGATATCTGCCTAG
Gene >Hirsu2|115
ATGGCAGAGGCAGAAGTCGACAGAGTCAAGCAGTTCTACAAAGACCGGACGCTTTTCATGACGGGGGCAAGTGGC
ATGGTCGGAACGGTCCTGTTGGCCAAGCTGGTCCTGGACACGGAGGTGAAGAAGATATATGCCTTGGTAAGGGGA
GGAGAGTGGTATGTCTCGCACCAGACTCACCGAGCTTCCCAGCCATACTCACGCAGGATAGGCGGCTGTGGAGCG
GTCTGCGATCGAGCTTGCCGCCCATCCTCGTCGCAGCCTTGCAAAACCTCAACAAGATTGTCGCTCTCGACGGGG
ATATCGAGAGGGCGGGGTGCGGGATCGGAGAGGAGAACTGGCAGAAGGTGCGGACCGAGACGACGGTATTCATTC
ACTTAGCCTCGTCCACACGACAAGATATGCCCCTGCCGGTGGCCGCGCAGGAAATCGTCTTCCCGTCCCTCGCGG
TCGCGGACATGGCATTCGACTGCCCCAACCTCTCTCGCTTTGTTTACGTCTCGTCCGCCTATCAGTGCTCCTTCT
TTGAGAGGACGGACAAGGGCTTGACCGGCTTCGACAAAAGTGTGCCCGAGAACATTGACCCGAAAGCCAGAGGCG
GCAGGGATCTCGATGCCGTGCTTGACGAGCTTCGCACACCGGGACCGATGTCCTACGAACACGGGGAATTCGCGA
CCACATATGCGCACGTCAAGTTCGTCACGGAGTGGGCTCTTTCAGAGGCCTTTCGCGGTCGGGGCGTGGAAGACA
AGCTCATGATCCATCGGCCAGCGGTCCTCGGCGCAGCTGAACGCTTCCCGTATCCGCTGTTCGAAAAGGCGGGAT
CGACGCCGAACGTCACAATTGCGGCCATGTTGGCGATGAGTCCCGAACAGGAGATTCTCGCTCCTCGGATGGCGC
CGGATCCGTCAGAGTATTCCCTCAACGAGATGCCGGTCGACATCGCCGTCAACCATCTCCTGGCCCATCTCGCGC
TCGGGACGACCGGCTGCGTCCATGCCGTCGCCTCGCCCCGACAGGAACACAGGACGACGCGTTCGATGCCGCAGT
GGAGCAGGCTCTTCCGCGCGCCGGCCGCGGGGCAGGTCCGTATCCGCTGGTGCGACGACCACTGGACCTCGCCGC
GAGTTTCCATCGCCTTCCGACTCTTCCCCATAGTCAGCTGCGTGTTCAATTTCGAGGACAACAAGTCGGAGCAGC
TATGGCGGGGGATGAACGGGCGCGAGCGGCTCGCGTGGCCTCTGCGGGCGACCATCGACGTCACGAGCGACAGCT
ACTGGCTGGGCAGGAAGACGATGGTGGAACAGGTAGTTCGAATACTGCAAGCCCACGCGAACAGCAATCCGTCCC
CATGGATATCTGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail