© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Hirsu2|1148 |
| Gene name | |
| Location | Contig_1241:6524..7892 |
| Strand | + |
| Gene length (bp) | 1368 |
| Transcript length (bp) | 1317 |
| Coding sequence length (bp) | 1317 |
| Protein length (aa) | 439 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF14572 | Pribosyl_synth | Phosphoribosyl synthetase-associated domain | 1.0E-35 | 322 | 435 |
| PF13793 | Pribosyltran_N | N-terminal domain of ribose phosphate pyrophosphokinase | 1.4E-30 | 6 | 98 |
| PF00156 | Pribosyltran | Phosphoribosyl transferase domain | 2.7E-14 | 273 | 374 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q12265|KPR5_YEAST | Ribose-phosphate pyrophosphokinase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRS5 PE=1 SV=1 | 2 | 369 | 9.0E-93 |
| sp|P87171|KPR5_SCHPO | Ribose-phosphate pyrophosphokinase 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3D6.06c PE=3 SV=1 | 214 | 438 | 9.0E-92 |
| sp|Q7ZXC9|PRPS2_XENLA | Ribose-phosphate pyrophosphokinase 2 OS=Xenopus laevis GN=prps2 PE=2 SV=1 | 226 | 437 | 3.0E-81 |
| sp|Q5XGI0|PRPS2_XENTR | Ribose-phosphate pyrophosphokinase 2 OS=Xenopus tropicalis GN=prps2 PE=2 SV=1 | 226 | 437 | 6.0E-81 |
| sp|P21108|PRPS3_HUMAN | Ribose-phosphate pyrophosphokinase 3 OS=Homo sapiens GN=PRPS1L1 PE=1 SV=2 | 226 | 437 | 2.0E-80 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q12265|KPR5_YEAST | Ribose-phosphate pyrophosphokinase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRS5 PE=1 SV=1 | 2 | 369 | 9.0E-93 |
| sp|P87171|KPR5_SCHPO | Ribose-phosphate pyrophosphokinase 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3D6.06c PE=3 SV=1 | 214 | 438 | 9.0E-92 |
| sp|Q7ZXC9|PRPS2_XENLA | Ribose-phosphate pyrophosphokinase 2 OS=Xenopus laevis GN=prps2 PE=2 SV=1 | 226 | 437 | 3.0E-81 |
| sp|Q5XGI0|PRPS2_XENTR | Ribose-phosphate pyrophosphokinase 2 OS=Xenopus tropicalis GN=prps2 PE=2 SV=1 | 226 | 437 | 6.0E-81 |
| sp|P21108|PRPS3_HUMAN | Ribose-phosphate pyrophosphokinase 3 OS=Homo sapiens GN=PRPS1L1 PE=1 SV=2 | 226 | 437 | 2.0E-80 |
| sp|Q5ZI49|PRPS2_CHICK | Ribose-phosphate pyrophosphokinase 2 OS=Gallus gallus GN=PRPS2 PE=2 SV=1 | 226 | 437 | 5.0E-80 |
| sp|Q9CS42|PRPS2_MOUSE | Ribose-phosphate pyrophosphokinase 2 OS=Mus musculus GN=Prps2 PE=1 SV=4 | 226 | 437 | 3.0E-79 |
| sp|Q5R8F8|PRPS2_PONAB | Ribose-phosphate pyrophosphokinase 2 OS=Pongo abelii GN=PRPS2 PE=2 SV=1 | 226 | 437 | 3.0E-79 |
| sp|Q4R4R7|PRPS2_MACFA | Ribose-phosphate pyrophosphokinase 2 OS=Macaca fascicularis GN=PRPS2 PE=2 SV=3 | 226 | 437 | 3.0E-79 |
| sp|P11908|PRPS2_HUMAN | Ribose-phosphate pyrophosphokinase 2 OS=Homo sapiens GN=PRPS2 PE=1 SV=2 | 226 | 437 | 3.0E-79 |
| sp|P09330|PRPS2_RAT | Ribose-phosphate pyrophosphokinase 2 OS=Rattus norvegicus GN=Prps2 PE=1 SV=3 | 226 | 437 | 8.0E-79 |
| sp|P60892|PRPS1_RAT | Ribose-phosphate pyrophosphokinase 1 OS=Rattus norvegicus GN=Prps1 PE=1 SV=2 | 226 | 437 | 1.0E-78 |
| sp|Q5RFJ7|PRPS1_PONAB | Ribose-phosphate pyrophosphokinase 1 OS=Pongo abelii GN=PRPS1 PE=2 SV=1 | 226 | 437 | 1.0E-78 |
| sp|Q9D7G0|PRPS1_MOUSE | Ribose-phosphate pyrophosphokinase 1 OS=Mus musculus GN=Prps1 PE=1 SV=4 | 226 | 437 | 1.0E-78 |
| sp|P60891|PRPS1_HUMAN | Ribose-phosphate pyrophosphokinase 1 OS=Homo sapiens GN=PRPS1 PE=1 SV=2 | 226 | 437 | 1.0E-78 |
| sp|Q2HJ58|PRPS1_BOVIN | Ribose-phosphate pyrophosphokinase 1 OS=Bos taurus GN=PRPS1 PE=2 SV=3 | 226 | 437 | 1.0E-78 |
| sp|Q4R4U3|PRPS1_MACFA | Ribose-phosphate pyrophosphokinase 1 OS=Macaca fascicularis GN=PRPS1 PE=2 SV=1 | 226 | 437 | 3.0E-78 |
| sp|P38689|KPR3_YEAST | Ribose-phosphate pyrophosphokinase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRS3 PE=1 SV=1 | 229 | 437 | 2.0E-71 |
| sp|Q54PA9|PRPSA_DICDI | Ribose-phosphate pyrophosphokinase A OS=Dictyostelium discoideum GN=prsA PE=1 SV=1 | 210 | 435 | 1.0E-70 |
| sp|O94413|KPR2_SCHPO | Ribose-phosphate pyrophosphokinase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1620.06c PE=1 SV=1 | 229 | 435 | 1.0E-69 |
| sp|P46585|KPR1_CANAX | Ribose-phosphate pyrophosphokinase 1 OS=Candida albicans GN=PRS1 PE=3 SV=1 | 229 | 437 | 3.0E-66 |
| sp|P38063|KPR4_YEAST | Ribose-phosphate pyrophosphokinase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRS4 PE=1 SV=3 | 229 | 437 | 4.0E-66 |
| sp|P38620|KPR2_YEAST | Ribose-phosphate pyrophosphokinase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRS2 PE=1 SV=1 | 229 | 437 | 2.0E-63 |
| sp|Q54QU9|PRPSC_DICDI | Ribose-phosphate pyrophosphokinase C OS=Dictyostelium discoideum GN=prsC PE=3 SV=1 | 210 | 432 | 4.0E-61 |
| sp|Q88PX6|KPRS_PSEPK | Ribose-phosphate pyrophosphokinase OS=Pseudomonas putida (strain KT2440) GN=prs PE=3 SV=1 | 208 | 435 | 3.0E-58 |
| sp|Q888C6|KPRS_PSESM | Ribose-phosphate pyrophosphokinase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=prs PE=3 SV=1 | 208 | 435 | 1.0E-57 |
| sp|Q9HVC5|KPRS_PSEAE | Ribose-phosphate pyrophosphokinase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=prs PE=3 SV=1 | 208 | 435 | 4.0E-56 |
| sp|Q7M8J0|KPRS_WOLSU | Ribose-phosphate pyrophosphokinase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=prs PE=3 SV=1 | 208 | 435 | 9.0E-56 |
| sp|P65235|KPRS_NEIMB | Ribose-phosphate pyrophosphokinase OS=Neisseria meningitidis serogroup B (strain MC58) GN=prs PE=1 SV=1 | 226 | 438 | 1.0E-55 |
| sp|P65234|KPRS_NEIMA | Ribose-phosphate pyrophosphokinase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=prs PE=3 SV=1 | 226 | 438 | 1.0E-55 |
| sp|Q7NQS9|KPRS_CHRVO | Ribose-phosphate pyrophosphokinase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=prs PE=3 SV=1 | 210 | 438 | 2.0E-55 |
| sp|Q82TQ4|KPRS_NITEU | Ribose-phosphate pyrophosphokinase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=prs PE=3 SV=1 | 208 | 435 | 3.0E-54 |
| sp|Q9PP15|KPRS_CAMJE | Ribose-phosphate pyrophosphokinase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=prs PE=3 SV=1 | 206 | 435 | 2.0E-53 |
| sp|P44328|KPRS_HAEIN | Ribose-phosphate pyrophosphokinase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=prs PE=3 SV=1 | 210 | 435 | 3.0E-53 |
| sp|P56184|KPRS_HELPY | Ribose-phosphate pyrophosphokinase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=prs PE=3 SV=1 | 208 | 435 | 6.0E-53 |
| sp|Q1LTH2|KPRS_BAUCH | Ribose-phosphate pyrophosphokinase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=prs PE=3 SV=1 | 210 | 437 | 2.0E-52 |
| sp|O67556|KPRS_AQUAE | Ribose-phosphate pyrophosphokinase OS=Aquifex aeolicus (strain VF5) GN=prs PE=3 SV=1 | 206 | 435 | 4.0E-52 |
| sp|Q8K9X2|KPRS_BUCAP | Ribose-phosphate pyrophosphokinase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=prs PE=3 SV=1 | 210 | 437 | 5.0E-52 |
| sp|P57266|KPRS_BUCAI | Ribose-phosphate pyrophosphokinase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=prs PE=3 SV=1 | 210 | 437 | 6.0E-52 |
| sp|Q9ZLA1|KPRS_HELPJ | Ribose-phosphate pyrophosphokinase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=prs PE=3 SV=1 | 206 | 435 | 8.0E-52 |
| sp|Q7VUH1|KPRS_BORPE | Ribose-phosphate pyrophosphokinase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=prs PE=3 SV=2 | 210 | 435 | 8.0E-52 |
| sp|P0A717|KPRS_ECOLI | Ribose-phosphate pyrophosphokinase OS=Escherichia coli (strain K12) GN=prs PE=1 SV=2 | 210 | 437 | 9.0E-52 |
| sp|P0A718|KPRS_ECOL6 | Ribose-phosphate pyrophosphokinase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=prs PE=3 SV=2 | 210 | 437 | 9.0E-52 |
| sp|P0A719|KPRS_ECO57 | Ribose-phosphate pyrophosphokinase OS=Escherichia coli O157:H7 GN=prs PE=3 SV=2 | 210 | 437 | 9.0E-52 |
| sp|Q8XHJ4|KPRS_CLOPE | Ribose-phosphate pyrophosphokinase OS=Clostridium perfringens (strain 13 / Type A) GN=prs PE=3 SV=1 | 189 | 436 | 1.0E-51 |
| sp|Q7N590|KPRS_PHOLL | Ribose-phosphate pyrophosphokinase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=prs PE=3 SV=1 | 143 | 437 | 1.0E-51 |
| sp|Q7W181|KPRS_BORPA | Ribose-phosphate pyrophosphokinase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=prs PE=3 SV=1 | 210 | 435 | 2.0E-51 |
| sp|Q7WNY4|KPRS_BORBR | Ribose-phosphate pyrophosphokinase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=prs PE=3 SV=1 | 210 | 435 | 2.0E-51 |
| sp|P0A1V6|KPRS_SALTY | Ribose-phosphate pyrophosphokinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=prs PE=3 SV=2 | 210 | 437 | 3.0E-51 |
| sp|P0A1V7|KPRS_SALTI | Ribose-phosphate pyrophosphokinase OS=Salmonella typhi GN=prs PE=3 SV=2 | 210 | 437 | 3.0E-51 |
| sp|P59512|KPRS_BUCBP | Ribose-phosphate pyrophosphokinase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=prs PE=3 SV=1 | 143 | 437 | 3.0E-51 |
| sp|Q9CP22|KPRS_PASMU | Ribose-phosphate pyrophosphokinase OS=Pasteurella multocida (strain Pm70) GN=prs PE=3 SV=1 | 143 | 435 | 4.0E-51 |
| sp|Q8ZEY2|KPRS_YERPE | Ribose-phosphate pyrophosphokinase OS=Yersinia pestis GN=prs PE=3 SV=1 | 210 | 437 | 7.0E-51 |
| sp|Q7VL55|KPRS_HAEDU | Ribose-phosphate pyrophosphokinase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=prs PE=3 SV=1 | 143 | 436 | 1.0E-50 |
| sp|Q7VFY9|KPRS_HELHP | Ribose-phosphate pyrophosphokinase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=prs PE=3 SV=1 | 209 | 435 | 1.0E-50 |
| sp|Q7VR76|KPRS_BLOFL | Ribose-phosphate pyrophosphokinase OS=Blochmannia floridanus GN=prs PE=3 SV=1 | 210 | 437 | 3.0E-50 |
| sp|Q8KCQ2|KPRS_CHLTE | Ribose-phosphate pyrophosphokinase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=prs PE=3 SV=1 | 210 | 436 | 3.0E-50 |
| sp|Q8R753|KPRS_CALS4 | Ribose-phosphate pyrophosphokinase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=prs PE=3 SV=1 | 208 | 435 | 1.0E-49 |
| sp|Q0C5A1|KPRS_HYPNA | Ribose-phosphate pyrophosphokinase OS=Hyphomonas neptunium (strain ATCC 15444) GN=prs PE=3 SV=1 | 187 | 437 | 5.0E-49 |
| sp|Q75JN8|PRPSB_DICDI | Ribose-phosphate pyrophosphokinase B OS=Dictyostelium discoideum GN=prsB PE=3 SV=1 | 210 | 434 | 6.0E-49 |
| sp|Q9AAV6|KPRS_CAUCR | Ribose-phosphate pyrophosphokinase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=prs PE=3 SV=1 | 187 | 436 | 7.0E-49 |
| sp|B8GZV1|KPRS_CAUCN | Ribose-phosphate pyrophosphokinase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=prs PE=3 SV=1 | 187 | 436 | 7.0E-49 |
| sp|Q8Y2E1|KPRS_RALSO | Ribose-phosphate pyrophosphokinase OS=Ralstonia solanacearum (strain GMI1000) GN=prs PE=3 SV=1 | 210 | 435 | 1.0E-48 |
| sp|Q6AJL7|KPRS_DESPS | Ribose-phosphate pyrophosphokinase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=prs PE=3 SV=1 | 210 | 435 | 1.0E-48 |
| sp|Q72V73|KPRS_LEPIC | Ribose-phosphate pyrophosphokinase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=prs PE=3 SV=1 | 208 | 436 | 1.0E-48 |
| sp|Q8EAQ9|KPRS_SHEON | Ribose-phosphate pyrophosphokinase OS=Shewanella oneidensis (strain MR-1) GN=prs PE=3 SV=1 | 210 | 437 | 1.0E-48 |
| sp|Q97E93|KPRS_CLOAB | Ribose-phosphate pyrophosphokinase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=prs PE=3 SV=1 | 188 | 438 | 2.0E-48 |
| sp|A6W1C7|KPRS_MARMS | Ribose-phosphate pyrophosphokinase OS=Marinomonas sp. (strain MWYL1) GN=prs PE=3 SV=1 | 208 | 435 | 3.0E-48 |
| sp|Q8EZN0|KPRS_LEPIN | Ribose-phosphate pyrophosphokinase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=prs PE=3 SV=1 | 208 | 436 | 3.0E-48 |
| sp|Q899I8|KPRS_CLOTE | Ribose-phosphate pyrophosphokinase OS=Clostridium tetani (strain Massachusetts / E88) GN=prs PE=3 SV=1 | 189 | 436 | 4.0E-48 |
| sp|Q9CHB8|KPRS1_LACLA | Ribose-phosphate pyrophosphokinase 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=prs1 PE=3 SV=1 | 208 | 436 | 4.0E-48 |
| sp|Q9PA76|KPRS_XYLFA | Ribose-phosphate pyrophosphokinase OS=Xylella fastidiosa (strain 9a5c) GN=prs PE=3 SV=2 | 208 | 435 | 5.0E-48 |
| sp|Q08DW2|KPRA_BOVIN | Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Bos taurus GN=PRPSAP1 PE=2 SV=1 | 229 | 437 | 6.0E-48 |
| sp|Q87A22|KPRS_XYLFT | Ribose-phosphate pyrophosphokinase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=prs PE=3 SV=1 | 208 | 435 | 7.0E-48 |
| sp|P42816|KPRS_BACCL | Ribose-phosphate pyrophosphokinase OS=Bacillus caldolyticus GN=prs PE=3 SV=1 | 209 | 436 | 2.0E-47 |
| sp|Q87RN8|KPRS_VIBPA | Ribose-phosphate pyrophosphokinase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=prs PE=3 SV=1 | 210 | 435 | 2.0E-47 |
| sp|B9KPJ0|KPRS_RHOSK | Ribose-phosphate pyrophosphokinase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=prs PE=3 SV=1 | 210 | 438 | 2.0E-47 |
| sp|Q14558|KPRA_HUMAN | Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Homo sapiens GN=PRPSAP1 PE=1 SV=2 | 229 | 437 | 3.0E-47 |
| sp|Q81J97|KPRS_BACCR | Ribose-phosphate pyrophosphokinase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=prs PE=3 SV=1 | 229 | 435 | 4.0E-47 |
| sp|Q81VZ0|KPRS_BACAN | Ribose-phosphate pyrophosphokinase OS=Bacillus anthracis GN=prs PE=3 SV=1 | 229 | 435 | 4.0E-47 |
| sp|Q9KQ22|KPRS_VIBCH | Ribose-phosphate pyrophosphokinase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=prs PE=3 SV=1 | 210 | 435 | 5.0E-47 |
| sp|Q9D0M1|KPRA_MOUSE | Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Mus musculus GN=Prpsap1 PE=1 SV=1 | 229 | 437 | 6.0E-47 |
| sp|Q7MMZ1|KPRS_VIBVY | Ribose-phosphate pyrophosphokinase OS=Vibrio vulnificus (strain YJ016) GN=prs PE=3 SV=1 | 210 | 435 | 6.0E-47 |
| sp|Q8DFF5|KPRS_VIBVU | Ribose-phosphate pyrophosphokinase OS=Vibrio vulnificus (strain CMCP6) GN=prs PE=3 SV=2 | 210 | 435 | 6.0E-47 |
| sp|Q8EU34|KPRS_OCEIH | Ribose-phosphate pyrophosphokinase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=prs PE=3 SV=1 | 209 | 436 | 7.0E-47 |
| sp|O60256|KPRB_HUMAN | Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Homo sapiens GN=PRPSAP2 PE=1 SV=1 | 229 | 437 | 9.0E-47 |
| sp|O33924|KPRS_CORAM | Ribose-phosphate pyrophosphokinase OS=Corynebacterium ammoniagenes GN=prs PE=3 SV=1 | 229 | 435 | 9.0E-47 |
| sp|P14193|KPRS_BACSU | Ribose-phosphate pyrophosphokinase OS=Bacillus subtilis (strain 168) GN=prs PE=1 SV=1 | 229 | 435 | 2.0E-46 |
| sp|Q83YI7|KPRS_LISIV | Ribose-phosphate pyrophosphokinase OS=Listeria ivanovii GN=prs PE=3 SV=1 | 208 | 436 | 4.0E-46 |
| sp|Q9RUD2|KPRS_DEIRA | Ribose-phosphate pyrophosphokinase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=prs PE=3 SV=2 | 223 | 435 | 4.0E-46 |
| sp|Q83TK1|KPRS_LISWE | Ribose-phosphate pyrophosphokinase OS=Listeria welshimeri GN=prs PE=3 SV=1 | 208 | 436 | 4.0E-46 |
| sp|Q8PNU0|KPRS_XANAC | Ribose-phosphate pyrophosphokinase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=prs PE=3 SV=2 | 209 | 435 | 5.0E-46 |
| sp|Q59988|KPRS_SYNE7 | Ribose-phosphate pyrophosphokinase OS=Synechococcus elongatus (strain PCC 7942) GN=prs PE=3 SV=1 | 229 | 435 | 5.0E-46 |
| sp|Q63468|KPRA_RAT | Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Rattus norvegicus GN=Prpsap1 PE=1 SV=1 | 229 | 437 | 5.0E-46 |
| sp|Q7MT83|KPRS_PORGI | Ribose-phosphate pyrophosphokinase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=prs PE=3 SV=1 | 210 | 435 | 6.0E-46 |
| sp|Q7NM67|KPRS_GLOVI | Ribose-phosphate pyrophosphokinase OS=Gloeobacter violaceus (strain PCC 7421) GN=prs PE=3 SV=1 | 229 | 435 | 1.0E-45 |
| sp|Q5RBA8|KPRB_PONAB | Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Pongo abelii GN=PRPSAP2 PE=2 SV=1 | 229 | 437 | 1.0E-45 |
| sp|Q28DH0|KPRB_XENTR | Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Xenopus tropicalis GN=prpsap2 PE=2 SV=1 | 229 | 437 | 1.0E-45 |
| sp|O08618|KPRB_RAT | Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Rattus norvegicus GN=Prpsap2 PE=1 SV=1 | 229 | 437 | 2.0E-45 |
| sp|Q8R574|KPRB_MOUSE | Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Mus musculus GN=Prpsap2 PE=1 SV=1 | 229 | 437 | 2.0E-45 |
| sp|Q5ZL26|KPRB_CHICK | Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Gallus gallus GN=PRPSAP2 PE=2 SV=1 | 229 | 437 | 3.0E-45 |
| sp|Q8RHM2|KPRS_FUSNN | Ribose-phosphate pyrophosphokinase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=prs PE=3 SV=1 | 229 | 435 | 4.0E-45 |
| sp|Q8PC63|KPRS_XANCP | Ribose-phosphate pyrophosphokinase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=prs PE=3 SV=1 | 206 | 435 | 4.0E-45 |
| sp|Q55848|KPRS_SYNY3 | Ribose-phosphate pyrophosphokinase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=prs PE=3 SV=1 | 188 | 436 | 6.0E-45 |
| sp|Q8YN97|KPRS_NOSS1 | Ribose-phosphate pyrophosphokinase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=prs PE=3 SV=1 | 229 | 435 | 9.0E-45 |
| sp|A2VDS0|KPRB_BOVIN | Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Bos taurus GN=PRPSAP2 PE=2 SV=1 | 229 | 437 | 1.0E-44 |
| sp|Q89DJ1|KPRS_BRADU | Ribose-phosphate pyrophosphokinase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=prs PE=3 SV=2 | 187 | 436 | 1.0E-44 |
| sp|Q69XQ6|KPRS2_ORYSJ | Ribose-phosphate pyrophosphokinase 2, chloroplastic OS=Oryza sativa subsp. japonica GN=Os06g0617800 PE=2 SV=2 | 209 | 436 | 2.0E-44 |
| sp|Q0ARN5|KPRS_MARMM | Ribose-phosphate pyrophosphokinase OS=Maricaulis maris (strain MCS10) GN=prs PE=3 SV=1 | 210 | 436 | 3.0E-44 |
| sp|Q48793|KPRS1_LISMO | Ribose-phosphate pyrophosphokinase 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=prs1 PE=3 SV=1 | 208 | 436 | 4.0E-44 |
| sp|Q724L4|KPRS1_LISMF | Ribose-phosphate pyrophosphokinase 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=prs1 PE=3 SV=1 | 208 | 436 | 4.0E-44 |
| sp|Q92F68|KPRS1_LISIN | Ribose-phosphate pyrophosphokinase 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=prs1 PE=3 SV=1 | 208 | 436 | 6.0E-44 |
| sp|Q92N73|KPRS_RHIME | Ribose-phosphate pyrophosphokinase OS=Rhizobium meliloti (strain 1021) GN=prs PE=3 SV=1 | 173 | 436 | 6.0E-44 |
| sp|Q7U7L5|KPRS_SYNPX | Ribose-phosphate pyrophosphokinase OS=Synechococcus sp. (strain WH8102) GN=prs PE=3 SV=1 | 229 | 435 | 6.0E-44 |
| sp|Q82ZA5|KPRS2_ENTFA | Ribose-phosphate pyrophosphokinase 2 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=prs2 PE=3 SV=1 | 209 | 436 | 1.0E-43 |
| sp|Q9XG98|KPRS1_SPIOL | Ribose-phosphate pyrophosphokinase 1 OS=Spinacia oleracea GN=PRS1 PE=2 SV=1 | 226 | 436 | 1.0E-43 |
| sp|O64888|KPRS5_ARATH | Ribose-phosphate pyrophosphokinase 5, chloroplastic OS=Arabidopsis thaliana GN=PRS5 PE=2 SV=2 | 209 | 426 | 1.0E-43 |
| sp|Q42581|KPRS1_ARATH | Ribose-phosphate pyrophosphokinase 1, chloroplastic OS=Arabidopsis thaliana GN=PRS1 PE=2 SV=2 | 226 | 435 | 1.0E-43 |
| sp|Q42583|KPRS2_ARATH | Ribose-phosphate pyrophosphokinase 2, chloroplastic OS=Arabidopsis thaliana GN=PRS2 PE=2 SV=2 | 226 | 435 | 2.0E-43 |
| sp|P9WKE3|KPRS_MYCTU | Ribose-phosphate pyrophosphokinase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=prs PE=1 SV=1 | 229 | 438 | 2.0E-43 |
| sp|P9WKE2|KPRS_MYCTO | Ribose-phosphate pyrophosphokinase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=prs PE=3 SV=1 | 229 | 438 | 2.0E-43 |
| sp|P65233|KPRS_MYCBO | Ribose-phosphate pyrophosphokinase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=prs PE=3 SV=1 | 229 | 438 | 2.0E-43 |
| sp|Q7VBH4|KPRS_PROMA | Ribose-phosphate pyrophosphokinase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=prs PE=3 SV=1 | 229 | 435 | 2.0E-43 |
| sp|Q98HW3|KPRS_RHILO | Ribose-phosphate pyrophosphokinase OS=Rhizobium loti (strain MAFF303099) GN=prs PE=3 SV=1 | 210 | 436 | 8.0E-43 |
| sp|Q0BPP0|KPRS_GRABC | Ribose-phosphate pyrophosphokinase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=prs PE=3 SV=1 | 187 | 436 | 9.0E-43 |
| sp|Q7V6S2|KPRS_PROMM | Ribose-phosphate pyrophosphokinase OS=Prochlorococcus marinus (strain MIT 9313) GN=prs PE=3 SV=1 | 229 | 435 | 3.0E-42 |
| sp|Q6Z2L5|KPRS1_ORYSJ | Ribose-phosphate pyrophosphokinase 1, chloroplastic OS=Oryza sativa subsp. japonica GN=Os02g0127700 PE=2 SV=2 | 226 | 431 | 5.0E-42 |
| sp|Q9X1W3|KPRS_THEMA | Ribose-phosphate pyrophosphokinase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=prs PE=3 SV=1 | 189 | 435 | 6.0E-42 |
| sp|Q8FZF0|KPRS_BRUSU | Ribose-phosphate pyrophosphokinase OS=Brucella suis biovar 1 (strain 1330) GN=prs PE=3 SV=1 | 187 | 436 | 6.0E-42 |
| sp|B7IFM5|KPRS_THEAB | Ribose-phosphate pyrophosphokinase OS=Thermosipho africanus (strain TCF52B) GN=prs PE=3 SV=1 | 143 | 437 | 7.0E-42 |
| sp|Q8YIG1|KPRS_BRUME | Ribose-phosphate pyrophosphokinase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=prs PE=3 SV=2 | 187 | 436 | 8.0E-42 |
| sp|Q7UPM4|KPRS_RHOBA | Ribose-phosphate pyrophosphokinase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=prs PE=3 SV=1 | 210 | 435 | 9.0E-42 |
| sp|P0DB99|KPRS1_STRPQ | Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=prs1 PE=3 SV=1 | 148 | 436 | 1.0E-41 |
| sp|P65245|KPRS1_STRP8 | Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=prs1 PE=3 SV=1 | 148 | 436 | 1.0E-41 |
| sp|Q5XEL0|KPRS1_STRP6 | Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=prs1 PE=3 SV=2 | 148 | 436 | 1.0E-41 |
| sp|P0DB98|KPRS1_STRP3 | Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=prs1 PE=3 SV=1 | 148 | 436 | 1.0E-41 |
| sp|P65243|KPRS1_STRP1 | Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus pyogenes serotype M1 GN=prs1 PE=3 SV=1 | 148 | 436 | 1.0E-41 |
| sp|Q9CD45|KPRS_MYCLE | Ribose-phosphate pyrophosphokinase OS=Mycobacterium leprae (strain TN) GN=prs PE=3 SV=1 | 229 | 436 | 1.0E-41 |
| sp|Q88Z84|KPRS1_LACPL | Ribose-phosphate pyrophosphokinase 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=prs1 PE=3 SV=1 | 209 | 437 | 2.0E-41 |
| sp|Q7V111|KPRS_PROMP | Ribose-phosphate pyrophosphokinase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=prs PE=3 SV=1 | 229 | 435 | 3.0E-41 |
| sp|Q49V09|KPRS_STAS1 | Ribose-phosphate pyrophosphokinase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=prs PE=3 SV=1 | 208 | 436 | 3.0E-41 |
| sp|Q9XG99|KPRS2_SPIOL | Ribose-phosphate pyrophosphokinase 2, chloroplastic OS=Spinacia oleracea GN=PRS2 PE=2 SV=1 | 226 | 436 | 4.0E-41 |
| sp|Q8CQU7|KPRS_STAES | Ribose-phosphate pyrophosphokinase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=prs PE=3 SV=1 | 208 | 436 | 1.0E-40 |
| sp|Q5HRQ5|KPRS_STAEQ | Ribose-phosphate pyrophosphokinase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=prs PE=3 SV=1 | 208 | 436 | 1.0E-40 |
| sp|Q9KGJ5|KPRS_BACHD | Ribose-phosphate pyrophosphokinase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=prs PE=3 SV=1 | 209 | 436 | 9.0E-40 |
| sp|Q8E2H0|KPRS1_STRA5 | Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=prs1 PE=3 SV=1 | 209 | 438 | 9.0E-40 |
| sp|Q8E7X8|KPRS1_STRA3 | Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=prs1 PE=3 SV=1 | 209 | 438 | 9.0E-40 |
| sp|P75044|KPRS_MYCPN | Ribose-phosphate pyrophosphokinase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=prs PE=3 SV=3 | 209 | 435 | 1.0E-39 |
| sp|Q8DWM2|KPRS1_STRMU | Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=prs1 PE=3 SV=1 | 209 | 436 | 1.0E-39 |
| sp|Q83AQ1|KPRS_COXBU | Ribose-phosphate pyrophosphokinase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=prs PE=3 SV=1 | 208 | 435 | 2.0E-39 |
| sp|Q5HIH5|KPRS_STAAC | Ribose-phosphate pyrophosphokinase OS=Staphylococcus aureus (strain COL) GN=prs PE=3 SV=1 | 208 | 436 | 3.0E-39 |
| sp|Q9K3U0|KPRS_STRCO | Ribose-phosphate pyrophosphokinase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=prs PE=3 SV=1 | 229 | 437 | 3.0E-39 |
| sp|P65238|KPRS_STAAW | Ribose-phosphate pyrophosphokinase OS=Staphylococcus aureus (strain MW2) GN=prs PE=3 SV=1 | 208 | 436 | 3.0E-39 |
| sp|Q6GBY8|KPRS_STAAS | Ribose-phosphate pyrophosphokinase OS=Staphylococcus aureus (strain MSSA476) GN=prs PE=3 SV=1 | 208 | 436 | 3.0E-39 |
| sp|Q6GJH1|KPRS_STAAR | Ribose-phosphate pyrophosphokinase OS=Staphylococcus aureus (strain MRSA252) GN=prs PE=3 SV=1 | 208 | 436 | 3.0E-39 |
| sp|P65237|KPRS_STAAN | Ribose-phosphate pyrophosphokinase OS=Staphylococcus aureus (strain N315) GN=prs PE=1 SV=1 | 208 | 436 | 3.0E-39 |
| sp|P65236|KPRS_STAAM | Ribose-phosphate pyrophosphokinase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=prs PE=3 SV=1 | 208 | 436 | 3.0E-39 |
| sp|Q4L3F7|KPRS_STAHJ | Ribose-phosphate pyrophosphokinase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=prs PE=3 SV=1 | 208 | 436 | 7.0E-39 |
| sp|P65240|KPRS1_STRR6 | Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=prs1 PE=3 SV=1 | 206 | 436 | 8.0E-39 |
| sp|P65239|KPRS1_STRPN | Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=prs1 PE=3 SV=1 | 206 | 436 | 8.0E-39 |
| sp|Q82HE7|KPRS_STRAW | Ribose-phosphate pyrophosphokinase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=prs PE=3 SV=1 | 209 | 437 | 9.0E-39 |
| sp|Q12265|KPR5_YEAST | Ribose-phosphate pyrophosphokinase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRS5 PE=1 SV=1 | 326 | 437 | 1.0E-38 |
| sp|Q8FQV2|KPRS_COREF | Ribose-phosphate pyrophosphokinase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=prs PE=3 SV=1 | 229 | 438 | 2.0E-38 |
| sp|Q8UDA9|KPRS_AGRFC | Ribose-phosphate pyrophosphokinase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=prs PE=3 SV=2 | 210 | 436 | 6.0E-38 |
| sp|Q8P137|KPRS2_STRP8 | Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=prs2 PE=3 SV=1 | 229 | 437 | 1.0E-37 |
| sp|Q5XC85|KPRS2_STRP6 | Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=prs2 PE=1 SV=1 | 229 | 437 | 1.0E-37 |
| sp|P0DC01|KPRS2_STRPQ | Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=prs2 PE=3 SV=1 | 229 | 437 | 2.0E-37 |
| sp|P0DC00|KPRS2_STRP3 | Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=prs2 PE=3 SV=1 | 229 | 437 | 2.0E-37 |
| sp|Q99ZR0|KPRS2_STRP1 | Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus pyogenes serotype M1 GN=prs2 PE=3 SV=1 | 229 | 437 | 2.0E-37 |
| sp|Q8G5P2|KPRS_BIFLO | Ribose-phosphate pyrophosphokinase OS=Bifidobacterium longum (strain NCC 2705) GN=prs PE=3 SV=2 | 209 | 436 | 2.0E-37 |
| sp|P47304|KPRS_MYCGE | Ribose-phosphate pyrophosphokinase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=prs PE=3 SV=2 | 209 | 436 | 6.0E-37 |
| sp|Q8NRU9|KPRS_CORGL | Ribose-phosphate pyrophosphokinase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=prs PE=3 SV=1 | 229 | 436 | 9.0E-37 |
| sp|P87171|KPR5_SCHPO | Ribose-phosphate pyrophosphokinase 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3D6.06c PE=3 SV=1 | 2 | 117 | 3.0E-36 |
| sp|Q8DZK4|KPRS2_STRA5 | Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=prs2 PE=3 SV=1 | 229 | 437 | 4.0E-36 |
| sp|Q8E568|KPRS2_STRA3 | Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=prs2 PE=3 SV=1 | 229 | 437 | 4.0E-36 |
| sp|Q9EWS0|KPRH_STRCO | Putative ribose-phosphate pyrophosphokinase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO0782 PE=3 SV=1 | 223 | 436 | 1.0E-35 |
| sp|Q9CEI4|KPRS2_LACLA | Ribose-phosphate pyrophosphokinase 2 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=prs2 PE=3 SV=1 | 229 | 438 | 1.0E-35 |
| sp|Q8DU94|KPRS2_STRMU | Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=prs2 PE=3 SV=1 | 208 | 438 | 6.0E-35 |
| sp|Q723E1|KPRS2_LISMF | Ribose-phosphate pyrophosphokinase 2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=prs2 PE=3 SV=1 | 209 | 435 | 1.0E-34 |
| sp|Q832Z5|KPRS1_ENTFA | Ribose-phosphate pyrophosphokinase 1 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=prs1 PE=3 SV=1 | 229 | 435 | 2.0E-34 |
| sp|Q98R83|KPRS_MYCPU | Ribose-phosphate pyrophosphokinase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=prs PE=3 SV=1 | 226 | 435 | 3.0E-34 |
| sp|Q8Y9L8|KPRS2_LISMO | Ribose-phosphate pyrophosphokinase 2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=prs2 PE=3 SV=1 | 209 | 435 | 5.0E-34 |
| sp|P65242|KPRS2_STRR6 | Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=prs2 PE=3 SV=1 | 229 | 438 | 6.0E-34 |
| sp|P65241|KPRS2_STRPN | Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=prs2 PE=3 SV=1 | 229 | 438 | 6.0E-34 |
| sp|Q92EF1|KPRS2_LISIN | Ribose-phosphate pyrophosphokinase 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=prs2 PE=3 SV=1 | 209 | 435 | 1.0E-33 |
| sp|Q88VA5|KPRS2_LACPL | Ribose-phosphate pyrophosphokinase 2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=prs2 PE=3 SV=1 | 208 | 436 | 2.0E-32 |
| sp|Q9PQV0|KPRS_UREPA | Ribose-phosphate pyrophosphokinase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=prs PE=3 SV=1 | 209 | 438 | 1.0E-28 |
| sp|P41831|KPR1_SCHPO | Ribose-phosphate pyrophosphokinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4A8.14 PE=3 SV=1 | 2 | 98 | 2.0E-27 |
| sp|Q7ZXC9|PRPS2_XENLA | Ribose-phosphate pyrophosphokinase 2 OS=Xenopus laevis GN=prps2 PE=2 SV=1 | 4 | 111 | 5.0E-27 |
| sp|Q5XGI0|PRPS2_XENTR | Ribose-phosphate pyrophosphokinase 2 OS=Xenopus tropicalis GN=prps2 PE=2 SV=1 | 4 | 111 | 5.0E-27 |
| sp|P09330|PRPS2_RAT | Ribose-phosphate pyrophosphokinase 2 OS=Rattus norvegicus GN=Prps2 PE=1 SV=3 | 4 | 111 | 5.0E-27 |
| sp|Q9CS42|PRPS2_MOUSE | Ribose-phosphate pyrophosphokinase 2 OS=Mus musculus GN=Prps2 PE=1 SV=4 | 4 | 111 | 6.0E-27 |
| sp|Q5R8F8|PRPS2_PONAB | Ribose-phosphate pyrophosphokinase 2 OS=Pongo abelii GN=PRPS2 PE=2 SV=1 | 4 | 111 | 6.0E-27 |
| sp|Q4R4R7|PRPS2_MACFA | Ribose-phosphate pyrophosphokinase 2 OS=Macaca fascicularis GN=PRPS2 PE=2 SV=3 | 4 | 111 | 6.0E-27 |
| sp|P11908|PRPS2_HUMAN | Ribose-phosphate pyrophosphokinase 2 OS=Homo sapiens GN=PRPS2 PE=1 SV=2 | 4 | 111 | 6.0E-27 |
| sp|Q5ZI49|PRPS2_CHICK | Ribose-phosphate pyrophosphokinase 2 OS=Gallus gallus GN=PRPS2 PE=2 SV=1 | 4 | 98 | 2.0E-26 |
| sp|P32895|KPR1_YEAST | Ribose-phosphate pyrophosphokinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRS1 PE=1 SV=1 | 229 | 318 | 1.0E-25 |
| sp|P60892|PRPS1_RAT | Ribose-phosphate pyrophosphokinase 1 OS=Rattus norvegicus GN=Prps1 PE=1 SV=2 | 4 | 111 | 2.0E-25 |
| sp|Q5RFJ7|PRPS1_PONAB | Ribose-phosphate pyrophosphokinase 1 OS=Pongo abelii GN=PRPS1 PE=2 SV=1 | 4 | 111 | 2.0E-25 |
| sp|Q9D7G0|PRPS1_MOUSE | Ribose-phosphate pyrophosphokinase 1 OS=Mus musculus GN=Prps1 PE=1 SV=4 | 4 | 111 | 2.0E-25 |
| sp|P60891|PRPS1_HUMAN | Ribose-phosphate pyrophosphokinase 1 OS=Homo sapiens GN=PRPS1 PE=1 SV=2 | 4 | 111 | 2.0E-25 |
| sp|Q2HJ58|PRPS1_BOVIN | Ribose-phosphate pyrophosphokinase 1 OS=Bos taurus GN=PRPS1 PE=2 SV=3 | 4 | 111 | 2.0E-25 |
| sp|Q4R4U3|PRPS1_MACFA | Ribose-phosphate pyrophosphokinase 1 OS=Macaca fascicularis GN=PRPS1 PE=2 SV=1 | 4 | 111 | 2.0E-25 |
| sp|P41831|KPR1_SCHPO | Ribose-phosphate pyrophosphokinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4A8.14 PE=3 SV=1 | 224 | 328 | 4.0E-25 |
| sp|P21108|PRPS3_HUMAN | Ribose-phosphate pyrophosphokinase 3 OS=Homo sapiens GN=PRPS1L1 PE=1 SV=2 | 4 | 98 | 3.0E-24 |
| sp|P32895|KPR1_YEAST | Ribose-phosphate pyrophosphokinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRS1 PE=1 SV=1 | 2 | 98 | 5.0E-23 |
| sp|O94413|KPR2_SCHPO | Ribose-phosphate pyrophosphokinase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1620.06c PE=1 SV=1 | 4 | 111 | 5.0E-22 |
| sp|Q8Y2E1|KPRS_RALSO | Ribose-phosphate pyrophosphokinase OS=Ralstonia solanacearum (strain GMI1000) GN=prs PE=3 SV=1 | 5 | 102 | 2.0E-21 |
| sp|P44328|KPRS_HAEIN | Ribose-phosphate pyrophosphokinase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=prs PE=3 SV=1 | 4 | 98 | 2.0E-20 |
| sp|Q7MMZ1|KPRS_VIBVY | Ribose-phosphate pyrophosphokinase OS=Vibrio vulnificus (strain YJ016) GN=prs PE=3 SV=1 | 7 | 98 | 3.0E-20 |
| sp|Q8DFF5|KPRS_VIBVU | Ribose-phosphate pyrophosphokinase OS=Vibrio vulnificus (strain CMCP6) GN=prs PE=3 SV=2 | 7 | 98 | 3.0E-20 |
| sp|Q9KQ22|KPRS_VIBCH | Ribose-phosphate pyrophosphokinase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=prs PE=3 SV=1 | 7 | 98 | 4.0E-20 |
| sp|P38620|KPR2_YEAST | Ribose-phosphate pyrophosphokinase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRS2 PE=1 SV=1 | 4 | 98 | 5.0E-20 |
| sp|Q87RN8|KPRS_VIBPA | Ribose-phosphate pyrophosphokinase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=prs PE=3 SV=1 | 7 | 98 | 6.0E-20 |
| sp|P32895|KPR1_YEAST | Ribose-phosphate pyrophosphokinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRS1 PE=1 SV=1 | 312 | 436 | 6.0E-20 |
| sp|P38063|KPR4_YEAST | Ribose-phosphate pyrophosphokinase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRS4 PE=1 SV=3 | 2 | 98 | 9.0E-20 |
| sp|Q8TUT6|KPRS_METKA | Ribose-phosphate pyrophosphokinase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=prs PE=3 SV=1 | 235 | 425 | 9.0E-20 |
| sp|Q8XHJ4|KPRS_CLOPE | Ribose-phosphate pyrophosphokinase OS=Clostridium perfringens (strain 13 / Type A) GN=prs PE=3 SV=1 | 3 | 98 | 1.0E-19 |
| sp|Q7VL55|KPRS_HAEDU | Ribose-phosphate pyrophosphokinase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=prs PE=3 SV=1 | 4 | 98 | 1.0E-19 |
| sp|Q8UDA9|KPRS_AGRFC | Ribose-phosphate pyrophosphokinase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=prs PE=3 SV=2 | 7 | 98 | 1.0E-19 |
| sp|P59512|KPRS_BUCBP | Ribose-phosphate pyrophosphokinase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=prs PE=3 SV=1 | 7 | 98 | 2.0E-19 |
| sp|Q92N73|KPRS_RHIME | Ribose-phosphate pyrophosphokinase OS=Rhizobium meliloti (strain 1021) GN=prs PE=3 SV=1 | 7 | 102 | 2.0E-19 |
| sp|O26877|KPRS_METTH | Ribose-phosphate pyrophosphokinase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=prs PE=3 SV=1 | 188 | 400 | 2.0E-19 |
| sp|Q9CP22|KPRS_PASMU | Ribose-phosphate pyrophosphokinase OS=Pasteurella multocida (strain Pm70) GN=prs PE=3 SV=1 | 4 | 98 | 3.0E-19 |
| sp|Q8EAQ9|KPRS_SHEON | Ribose-phosphate pyrophosphokinase OS=Shewanella oneidensis (strain MR-1) GN=prs PE=3 SV=1 | 4 | 98 | 3.0E-19 |
| sp|P0A717|KPRS_ECOLI | Ribose-phosphate pyrophosphokinase OS=Escherichia coli (strain K12) GN=prs PE=1 SV=2 | 7 | 98 | 4.0E-19 |
| sp|P0A718|KPRS_ECOL6 | Ribose-phosphate pyrophosphokinase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=prs PE=3 SV=2 | 7 | 98 | 4.0E-19 |
| sp|P0A719|KPRS_ECO57 | Ribose-phosphate pyrophosphokinase OS=Escherichia coli O157:H7 GN=prs PE=3 SV=2 | 7 | 98 | 4.0E-19 |
| sp|P0A1V6|KPRS_SALTY | Ribose-phosphate pyrophosphokinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=prs PE=3 SV=2 | 7 | 98 | 4.0E-19 |
| sp|P0A1V7|KPRS_SALTI | Ribose-phosphate pyrophosphokinase OS=Salmonella typhi GN=prs PE=3 SV=2 | 7 | 98 | 4.0E-19 |
| sp|Q8ZEY2|KPRS_YERPE | Ribose-phosphate pyrophosphokinase OS=Yersinia pestis GN=prs PE=3 SV=1 | 7 | 98 | 4.0E-19 |
| sp|Q7N590|KPRS_PHOLL | Ribose-phosphate pyrophosphokinase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=prs PE=3 SV=1 | 7 | 98 | 7.0E-19 |
| sp|Q97E93|KPRS_CLOAB | Ribose-phosphate pyrophosphokinase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=prs PE=3 SV=1 | 3 | 98 | 7.0E-19 |
| sp|Q899I8|KPRS_CLOTE | Ribose-phosphate pyrophosphokinase OS=Clostridium tetani (strain Massachusetts / E88) GN=prs PE=3 SV=1 | 3 | 98 | 7.0E-19 |
| sp|Q88PX6|KPRS_PSEPK | Ribose-phosphate pyrophosphokinase OS=Pseudomonas putida (strain KT2440) GN=prs PE=3 SV=1 | 5 | 102 | 9.0E-19 |
| sp|Q888C6|KPRS_PSESM | Ribose-phosphate pyrophosphokinase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=prs PE=3 SV=1 | 5 | 102 | 1.0E-18 |
| sp|Q9HVC5|KPRS_PSEAE | Ribose-phosphate pyrophosphokinase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=prs PE=3 SV=1 | 5 | 102 | 2.0E-18 |
| sp|Q98HW3|KPRS_RHILO | Ribose-phosphate pyrophosphokinase OS=Rhizobium loti (strain MAFF303099) GN=prs PE=3 SV=1 | 7 | 98 | 2.0E-18 |
| sp|Q8FZF0|KPRS_BRUSU | Ribose-phosphate pyrophosphokinase OS=Brucella suis biovar 1 (strain 1330) GN=prs PE=3 SV=1 | 7 | 102 | 2.0E-18 |
| sp|Q8YIG1|KPRS_BRUME | Ribose-phosphate pyrophosphokinase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=prs PE=3 SV=2 | 7 | 102 | 2.0E-18 |
| sp|Q8K9X2|KPRS_BUCAP | Ribose-phosphate pyrophosphokinase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=prs PE=3 SV=1 | 7 | 98 | 3.0E-18 |
| sp|Q7VR76|KPRS_BLOFL | Ribose-phosphate pyrophosphokinase OS=Blochmannia floridanus GN=prs PE=3 SV=1 | 7 | 98 | 3.0E-18 |
| sp|Q7V6S2|KPRS_PROMM | Ribose-phosphate pyrophosphokinase OS=Prochlorococcus marinus (strain MIT 9313) GN=prs PE=3 SV=1 | 2 | 97 | 3.0E-18 |
| sp|A6W1C7|KPRS_MARMS | Ribose-phosphate pyrophosphokinase OS=Marinomonas sp. (strain MWYL1) GN=prs PE=3 SV=1 | 5 | 98 | 4.0E-18 |
| sp|Q7UPM4|KPRS_RHOBA | Ribose-phosphate pyrophosphokinase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=prs PE=3 SV=1 | 2 | 98 | 4.0E-18 |
| sp|Q8U458|KPRS_PYRFU | Ribose-phosphate pyrophosphokinase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=prs PE=3 SV=1 | 240 | 398 | 5.0E-18 |
| sp|Q7U7L5|KPRS_SYNPX | Ribose-phosphate pyrophosphokinase OS=Synechococcus sp. (strain WH8102) GN=prs PE=3 SV=1 | 3 | 97 | 7.0E-18 |
| sp|P57266|KPRS_BUCAI | Ribose-phosphate pyrophosphokinase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=prs PE=3 SV=1 | 7 | 98 | 1.0E-17 |
| sp|Q9PA76|KPRS_XYLFA | Ribose-phosphate pyrophosphokinase OS=Xylella fastidiosa (strain 9a5c) GN=prs PE=3 SV=2 | 3 | 98 | 2.0E-17 |
| sp|Q87A22|KPRS_XYLFT | Ribose-phosphate pyrophosphokinase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=prs PE=3 SV=1 | 3 | 98 | 2.0E-17 |
| sp|Q8PNU0|KPRS_XANAC | Ribose-phosphate pyrophosphokinase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=prs PE=3 SV=2 | 3 | 98 | 2.0E-17 |
| sp|Q1LTH2|KPRS_BAUCH | Ribose-phosphate pyrophosphokinase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=prs PE=3 SV=1 | 7 | 98 | 3.0E-17 |
| sp|O59586|KPRS_PYRHO | Ribose-phosphate pyrophosphokinase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=prs PE=3 SV=1 | 240 | 398 | 3.0E-17 |
| sp|Q8PC63|KPRS_XANCP | Ribose-phosphate pyrophosphokinase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=prs PE=3 SV=1 | 3 | 98 | 4.0E-17 |
| sp|Q7M8J0|KPRS_WOLSU | Ribose-phosphate pyrophosphokinase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=prs PE=3 SV=1 | 2 | 98 | 5.0E-17 |
| sp|O52958|KPRS_THEKO | Ribose-phosphate pyrophosphokinase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=prs PE=1 SV=1 | 240 | 398 | 5.0E-17 |
| sp|Q55848|KPRS_SYNY3 | Ribose-phosphate pyrophosphokinase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=prs PE=3 SV=1 | 7 | 97 | 8.0E-17 |
| sp|P56184|KPRS_HELPY | Ribose-phosphate pyrophosphokinase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=prs PE=3 SV=1 | 2 | 98 | 9.0E-17 |
| sp|Q9ZLA1|KPRS_HELPJ | Ribose-phosphate pyrophosphokinase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=prs PE=3 SV=1 | 2 | 98 | 1.0E-16 |
| sp|Q88Z84|KPRS1_LACPL | Ribose-phosphate pyrophosphokinase 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=prs1 PE=3 SV=1 | 11 | 98 | 1.0E-16 |
| sp|Q6AJL7|KPRS_DESPS | Ribose-phosphate pyrophosphokinase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=prs PE=3 SV=1 | 5 | 98 | 2.0E-16 |
| sp|Q8YN97|KPRS_NOSS1 | Ribose-phosphate pyrophosphokinase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=prs PE=3 SV=1 | 7 | 97 | 2.0E-16 |
| sp|Q7V111|KPRS_PROMP | Ribose-phosphate pyrophosphokinase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=prs PE=3 SV=1 | 7 | 97 | 2.0E-16 |
| sp|P41831|KPR1_SCHPO | Ribose-phosphate pyrophosphokinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4A8.14 PE=3 SV=1 | 327 | 436 | 2.0E-16 |
| sp|Q89DJ1|KPRS_BRADU | Ribose-phosphate pyrophosphokinase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=prs PE=3 SV=2 | 4 | 98 | 3.0E-16 |
| sp|Q8FQV2|KPRS_COREF | Ribose-phosphate pyrophosphokinase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=prs PE=3 SV=1 | 3 | 98 | 3.0E-16 |
| sp|Q9CEI4|KPRS2_LACLA | Ribose-phosphate pyrophosphokinase 2 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=prs2 PE=3 SV=1 | 7 | 98 | 3.0E-16 |
| sp|Q72V73|KPRS_LEPIC | Ribose-phosphate pyrophosphokinase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=prs PE=3 SV=1 | 4 | 98 | 4.0E-16 |
| sp|Q8EZN0|KPRS_LEPIN | Ribose-phosphate pyrophosphokinase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=prs PE=3 SV=1 | 4 | 98 | 4.0E-16 |
| sp|Q8DZK4|KPRS2_STRA5 | Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=prs2 PE=3 SV=1 | 3 | 98 | 4.0E-16 |
| sp|Q8E568|KPRS2_STRA3 | Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=prs2 PE=3 SV=1 | 3 | 98 | 4.0E-16 |
| sp|Q9PP15|KPRS_CAMJE | Ribose-phosphate pyrophosphokinase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=prs PE=3 SV=1 | 2 | 98 | 5.0E-16 |
| sp|Q99ZR0|KPRS2_STRP1 | Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus pyogenes serotype M1 GN=prs2 PE=3 SV=1 | 3 | 98 | 5.0E-16 |
| sp|Q9CD45|KPRS_MYCLE | Ribose-phosphate pyrophosphokinase OS=Mycobacterium leprae (strain TN) GN=prs PE=3 SV=1 | 3 | 98 | 6.0E-16 |
| sp|Q75JN8|PRPSB_DICDI | Ribose-phosphate pyrophosphokinase B OS=Dictyostelium discoideum GN=prsB PE=3 SV=1 | 5 | 111 | 7.0E-16 |
| sp|Q83AQ1|KPRS_COXBU | Ribose-phosphate pyrophosphokinase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=prs PE=3 SV=1 | 2 | 98 | 7.0E-16 |
| sp|Q5XC85|KPRS2_STRP6 | Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=prs2 PE=1 SV=1 | 3 | 98 | 7.0E-16 |
| sp|P46585|KPR1_CANAX | Ribose-phosphate pyrophosphokinase 1 OS=Candida albicans GN=PRS1 PE=3 SV=1 | 4 | 98 | 8.0E-16 |
| sp|Q7NM67|KPRS_GLOVI | Ribose-phosphate pyrophosphokinase OS=Gloeobacter violaceus (strain PCC 7421) GN=prs PE=3 SV=1 | 7 | 97 | 8.0E-16 |
| sp|Q8NRU9|KPRS_CORGL | Ribose-phosphate pyrophosphokinase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=prs PE=3 SV=1 | 3 | 98 | 8.0E-16 |
| sp|Q9UY08|KPRS_PYRAB | Ribose-phosphate pyrophosphokinase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=prs PE=3 SV=2 | 240 | 400 | 8.0E-16 |
| sp|P14193|KPRS_BACSU | Ribose-phosphate pyrophosphokinase OS=Bacillus subtilis (strain 168) GN=prs PE=1 SV=1 | 3 | 98 | 1.0E-15 |
| sp|Q59988|KPRS_SYNE7 | Ribose-phosphate pyrophosphokinase OS=Synechococcus elongatus (strain PCC 7942) GN=prs PE=3 SV=1 | 7 | 97 | 1.0E-15 |
| sp|P9WKE3|KPRS_MYCTU | Ribose-phosphate pyrophosphokinase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=prs PE=1 SV=1 | 3 | 98 | 1.0E-15 |
| sp|P9WKE2|KPRS_MYCTO | Ribose-phosphate pyrophosphokinase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=prs PE=3 SV=1 | 3 | 98 | 1.0E-15 |
| sp|P65233|KPRS_MYCBO | Ribose-phosphate pyrophosphokinase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=prs PE=3 SV=1 | 3 | 98 | 1.0E-15 |
| sp|Q8DU94|KPRS2_STRMU | Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=prs2 PE=3 SV=1 | 3 | 98 | 1.0E-15 |
| sp|Q8RHM2|KPRS_FUSNN | Ribose-phosphate pyrophosphokinase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=prs PE=3 SV=1 | 4 | 98 | 2.0E-15 |
| sp|P0DC01|KPRS2_STRPQ | Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=prs2 PE=3 SV=1 | 3 | 98 | 2.0E-15 |
| sp|P0DC00|KPRS2_STRP3 | Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=prs2 PE=3 SV=1 | 3 | 98 | 2.0E-15 |
| sp|P65242|KPRS2_STRR6 | Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=prs2 PE=3 SV=1 | 3 | 98 | 2.0E-15 |
| sp|P65241|KPRS2_STRPN | Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=prs2 PE=3 SV=1 | 3 | 98 | 2.0E-15 |
| sp|Q54PA9|PRPSA_DICDI | Ribose-phosphate pyrophosphokinase A OS=Dictyostelium discoideum GN=prsA PE=1 SV=1 | 5 | 111 | 3.0E-15 |
| sp|Q7NQS9|KPRS_CHRVO | Ribose-phosphate pyrophosphokinase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=prs PE=3 SV=1 | 4 | 102 | 3.0E-15 |
| sp|Q42583|KPRS2_ARATH | Ribose-phosphate pyrophosphokinase 2, chloroplastic OS=Arabidopsis thaliana GN=PRS2 PE=2 SV=2 | 7 | 97 | 3.0E-15 |
| sp|Q7VBH4|KPRS_PROMA | Ribose-phosphate pyrophosphokinase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=prs PE=3 SV=1 | 7 | 97 | 3.0E-15 |
| sp|Q0BPP0|KPRS_GRABC | Ribose-phosphate pyrophosphokinase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=prs PE=3 SV=1 | 7 | 98 | 3.0E-15 |
| sp|P47304|KPRS_MYCGE | Ribose-phosphate pyrophosphokinase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=prs PE=3 SV=2 | 6 | 98 | 3.0E-15 |
| sp|A5UNK4|KPRS_METS3 | Ribose-phosphate pyrophosphokinase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=prs PE=3 SV=1 | 188 | 408 | 3.0E-15 |
| sp|Q9AAV6|KPRS_CAUCR | Ribose-phosphate pyrophosphokinase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=prs PE=3 SV=1 | 7 | 98 | 4.0E-15 |
| sp|B8GZV1|KPRS_CAUCN | Ribose-phosphate pyrophosphokinase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=prs PE=3 SV=1 | 7 | 98 | 4.0E-15 |
| sp|Q8E2H0|KPRS1_STRA5 | Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=prs1 PE=3 SV=1 | 4 | 98 | 4.0E-15 |
| sp|Q8E7X8|KPRS1_STRA3 | Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=prs1 PE=3 SV=1 | 4 | 98 | 4.0E-15 |
| sp|Q88VA5|KPRS2_LACPL | Ribose-phosphate pyrophosphokinase 2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=prs2 PE=3 SV=1 | 7 | 98 | 4.0E-15 |
| sp|P65235|KPRS_NEIMB | Ribose-phosphate pyrophosphokinase OS=Neisseria meningitidis serogroup B (strain MC58) GN=prs PE=1 SV=1 | 4 | 102 | 5.0E-15 |
| sp|P65234|KPRS_NEIMA | Ribose-phosphate pyrophosphokinase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=prs PE=3 SV=1 | 4 | 102 | 5.0E-15 |
| sp|Q7W181|KPRS_BORPA | Ribose-phosphate pyrophosphokinase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=prs PE=3 SV=1 | 6 | 102 | 5.0E-15 |
| sp|Q7WNY4|KPRS_BORBR | Ribose-phosphate pyrophosphokinase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=prs PE=3 SV=1 | 6 | 102 | 5.0E-15 |
| sp|Q0ARN5|KPRS_MARMM | Ribose-phosphate pyrophosphokinase OS=Maricaulis maris (strain MCS10) GN=prs PE=3 SV=1 | 7 | 98 | 5.0E-15 |
| sp|O60256|KPRB_HUMAN | Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Homo sapiens GN=PRPSAP2 PE=1 SV=1 | 5 | 112 | 6.0E-15 |
| sp|O08618|KPRB_RAT | Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Rattus norvegicus GN=Prpsap2 PE=1 SV=1 | 5 | 112 | 6.0E-15 |
| sp|Q42581|KPRS1_ARATH | Ribose-phosphate pyrophosphokinase 1, chloroplastic OS=Arabidopsis thaliana GN=PRS1 PE=2 SV=2 | 7 | 97 | 6.0E-15 |
| sp|Q5RBA8|KPRB_PONAB | Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Pongo abelii GN=PRPSAP2 PE=2 SV=1 | 5 | 112 | 7.0E-15 |
| sp|Q5ZL26|KPRB_CHICK | Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Gallus gallus GN=PRPSAP2 PE=2 SV=1 | 5 | 112 | 7.0E-15 |
| sp|Q8DWM2|KPRS1_STRMU | Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=prs1 PE=3 SV=1 | 4 | 98 | 7.0E-15 |
| sp|Q8P137|KPRS2_STRP8 | Ribose-phosphate pyrophosphokinase 2 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=prs2 PE=3 SV=1 | 3 | 98 | 7.0E-15 |
| sp|Q8R753|KPRS_CALS4 | Ribose-phosphate pyrophosphokinase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=prs PE=3 SV=1 | 7 | 98 | 8.0E-15 |
| sp|Q8R574|KPRB_MOUSE | Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Mus musculus GN=Prpsap2 PE=1 SV=1 | 5 | 112 | 8.0E-15 |
| sp|Q9XG99|KPRS2_SPIOL | Ribose-phosphate pyrophosphokinase 2, chloroplastic OS=Spinacia oleracea GN=PRS2 PE=2 SV=1 | 7 | 97 | 8.0E-15 |
| sp|P38689|KPR3_YEAST | Ribose-phosphate pyrophosphokinase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRS3 PE=1 SV=1 | 4 | 98 | 1.0E-14 |
| sp|Q82TQ4|KPRS_NITEU | Ribose-phosphate pyrophosphokinase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=prs PE=3 SV=1 | 4 | 98 | 1.0E-14 |
| sp|Q7VUH1|KPRS_BORPE | Ribose-phosphate pyrophosphokinase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=prs PE=3 SV=2 | 6 | 102 | 1.0E-14 |
| sp|Q28DH0|KPRB_XENTR | Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Xenopus tropicalis GN=prpsap2 PE=2 SV=1 | 5 | 112 | 1.0E-14 |
| sp|A2VDS0|KPRB_BOVIN | Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Bos taurus GN=PRPSAP2 PE=2 SV=1 | 5 | 112 | 1.0E-14 |
| sp|Q9X1W3|KPRS_THEMA | Ribose-phosphate pyrophosphokinase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=prs PE=3 SV=1 | 7 | 98 | 1.0E-14 |
| sp|Q82ZA5|KPRS2_ENTFA | Ribose-phosphate pyrophosphokinase 2 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=prs2 PE=3 SV=1 | 11 | 98 | 2.0E-14 |
| sp|Q6Z2L5|KPRS1_ORYSJ | Ribose-phosphate pyrophosphokinase 1, chloroplastic OS=Oryza sativa subsp. japonica GN=Os02g0127700 PE=2 SV=2 | 7 | 97 | 2.0E-14 |
| sp|P0DB99|KPRS1_STRPQ | Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=prs1 PE=3 SV=1 | 7 | 98 | 2.0E-14 |
| sp|P65245|KPRS1_STRP8 | Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=prs1 PE=3 SV=1 | 7 | 98 | 2.0E-14 |
| sp|Q5XEL0|KPRS1_STRP6 | Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=prs1 PE=3 SV=2 | 7 | 98 | 2.0E-14 |
| sp|P0DB98|KPRS1_STRP3 | Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=prs1 PE=3 SV=1 | 7 | 98 | 2.0E-14 |
| sp|P65243|KPRS1_STRP1 | Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus pyogenes serotype M1 GN=prs1 PE=3 SV=1 | 7 | 98 | 2.0E-14 |
| sp|P42816|KPRS_BACCL | Ribose-phosphate pyrophosphokinase OS=Bacillus caldolyticus GN=prs PE=3 SV=1 | 7 | 98 | 3.0E-14 |
| sp|P65240|KPRS1_STRR6 | Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=prs1 PE=3 SV=1 | 7 | 98 | 3.0E-14 |
| sp|P65239|KPRS1_STRPN | Ribose-phosphate pyrophosphokinase 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=prs1 PE=3 SV=1 | 7 | 98 | 3.0E-14 |
| sp|Q7VFY9|KPRS_HELHP | Ribose-phosphate pyrophosphokinase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=prs PE=3 SV=1 | 2 | 98 | 4.0E-14 |
| sp|Q81J97|KPRS_BACCR | Ribose-phosphate pyrophosphokinase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=prs PE=3 SV=1 | 4 | 98 | 5.0E-14 |
| sp|Q81VZ0|KPRS_BACAN | Ribose-phosphate pyrophosphokinase OS=Bacillus anthracis GN=prs PE=3 SV=1 | 4 | 98 | 5.0E-14 |
| sp|Q7MT83|KPRS_PORGI | Ribose-phosphate pyrophosphokinase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=prs PE=3 SV=1 | 4 | 110 | 5.0E-14 |
| sp|O67556|KPRS_AQUAE | Ribose-phosphate pyrophosphokinase OS=Aquifex aeolicus (strain VF5) GN=prs PE=3 SV=1 | 7 | 110 | 6.0E-14 |
| sp|O33924|KPRS_CORAM | Ribose-phosphate pyrophosphokinase OS=Corynebacterium ammoniagenes GN=prs PE=3 SV=1 | 4 | 98 | 6.0E-14 |
| sp|Q9XG98|KPRS1_SPIOL | Ribose-phosphate pyrophosphokinase 1 OS=Spinacia oleracea GN=PRS1 PE=2 SV=1 | 7 | 97 | 6.0E-14 |
| sp|Q9KGJ5|KPRS_BACHD | Ribose-phosphate pyrophosphokinase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=prs PE=3 SV=1 | 4 | 98 | 7.0E-14 |
| sp|Q69XQ6|KPRS2_ORYSJ | Ribose-phosphate pyrophosphokinase 2, chloroplastic OS=Oryza sativa subsp. japonica GN=Os06g0617800 PE=2 SV=2 | 7 | 97 | 1.0E-13 |
| sp|O64888|KPRS5_ARATH | Ribose-phosphate pyrophosphokinase 5, chloroplastic OS=Arabidopsis thaliana GN=PRS5 PE=2 SV=2 | 7 | 97 | 2.0E-13 |
| sp|Q8G5P2|KPRS_BIFLO | Ribose-phosphate pyrophosphokinase OS=Bifidobacterium longum (strain NCC 2705) GN=prs PE=3 SV=2 | 3 | 98 | 3.0E-13 |
| sp|Q973F3|KPRS_SULTO | Ribose-phosphate pyrophosphokinase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=prs PE=3 SV=1 | 219 | 422 | 3.0E-13 |
| sp|P75044|KPRS_MYCPN | Ribose-phosphate pyrophosphokinase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=prs PE=3 SV=3 | 4 | 98 | 4.0E-13 |
| sp|Q48793|KPRS1_LISMO | Ribose-phosphate pyrophosphokinase 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=prs1 PE=3 SV=1 | 11 | 98 | 5.0E-13 |
| sp|Q724L4|KPRS1_LISMF | Ribose-phosphate pyrophosphokinase 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=prs1 PE=3 SV=1 | 11 | 98 | 5.0E-13 |
| sp|Q92F68|KPRS1_LISIN | Ribose-phosphate pyrophosphokinase 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=prs1 PE=3 SV=1 | 11 | 98 | 5.0E-13 |
| sp|Q83YI7|KPRS_LISIV | Ribose-phosphate pyrophosphokinase OS=Listeria ivanovii GN=prs PE=3 SV=1 | 11 | 98 | 6.0E-13 |
| sp|Q83TK1|KPRS_LISWE | Ribose-phosphate pyrophosphokinase OS=Listeria welshimeri GN=prs PE=3 SV=1 | 11 | 98 | 6.0E-13 |
| sp|Q8KCQ2|KPRS_CHLTE | Ribose-phosphate pyrophosphokinase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=prs PE=3 SV=1 | 5 | 98 | 1.0E-12 |
| sp|B9KPJ0|KPRS_RHOSK | Ribose-phosphate pyrophosphokinase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=prs PE=3 SV=1 | 7 | 98 | 1.0E-12 |
| sp|Q8EU34|KPRS_OCEIH | Ribose-phosphate pyrophosphokinase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=prs PE=3 SV=1 | 11 | 98 | 1.0E-12 |
| sp|Q14558|KPRA_HUMAN | Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Homo sapiens GN=PRPSAP1 PE=1 SV=2 | 15 | 98 | 2.0E-12 |
| sp|Q9D0M1|KPRA_MOUSE | Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Mus musculus GN=Prpsap1 PE=1 SV=1 | 15 | 98 | 2.0E-12 |
| sp|Q63468|KPRA_RAT | Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Rattus norvegicus GN=Prpsap1 PE=1 SV=1 | 15 | 98 | 2.0E-12 |
| sp|Q97CA5|KPRS_THEVO | Ribose-phosphate pyrophosphokinase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=prs PE=1 SV=1 | 185 | 398 | 2.0E-12 |
| sp|Q0C5A1|KPRS_HYPNA | Ribose-phosphate pyrophosphokinase OS=Hyphomonas neptunium (strain ATCC 15444) GN=prs PE=3 SV=1 | 7 | 98 | 5.0E-12 |
| sp|Q08DW2|KPRA_BOVIN | Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Bos taurus GN=PRPSAP1 PE=2 SV=1 | 15 | 98 | 6.0E-12 |
| sp|Q4L3F7|KPRS_STAHJ | Ribose-phosphate pyrophosphokinase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=prs PE=3 SV=1 | 5 | 98 | 7.0E-12 |
| sp|Q5HIH5|KPRS_STAAC | Ribose-phosphate pyrophosphokinase OS=Staphylococcus aureus (strain COL) GN=prs PE=3 SV=1 | 5 | 98 | 8.0E-12 |
| sp|P65238|KPRS_STAAW | Ribose-phosphate pyrophosphokinase OS=Staphylococcus aureus (strain MW2) GN=prs PE=3 SV=1 | 5 | 98 | 8.0E-12 |
| sp|Q6GBY8|KPRS_STAAS | Ribose-phosphate pyrophosphokinase OS=Staphylococcus aureus (strain MSSA476) GN=prs PE=3 SV=1 | 5 | 98 | 8.0E-12 |
| sp|Q6GJH1|KPRS_STAAR | Ribose-phosphate pyrophosphokinase OS=Staphylococcus aureus (strain MRSA252) GN=prs PE=3 SV=1 | 5 | 98 | 8.0E-12 |
| sp|P65237|KPRS_STAAN | Ribose-phosphate pyrophosphokinase OS=Staphylococcus aureus (strain N315) GN=prs PE=1 SV=1 | 5 | 98 | 8.0E-12 |
| sp|P65236|KPRS_STAAM | Ribose-phosphate pyrophosphokinase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=prs PE=3 SV=1 | 5 | 98 | 8.0E-12 |
| sp|Q832Z5|KPRS1_ENTFA | Ribose-phosphate pyrophosphokinase 1 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=prs1 PE=3 SV=1 | 11 | 98 | 8.0E-12 |
| sp|Q49V09|KPRS_STAS1 | Ribose-phosphate pyrophosphokinase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=prs PE=3 SV=1 | 5 | 98 | 1.0E-11 |
| sp|Q9RUD2|KPRS_DEIRA | Ribose-phosphate pyrophosphokinase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=prs PE=3 SV=2 | 5 | 97 | 2.0E-11 |
| sp|Q8CQU7|KPRS_STAES | Ribose-phosphate pyrophosphokinase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=prs PE=3 SV=1 | 5 | 98 | 2.0E-11 |
| sp|Q5HRQ5|KPRS_STAEQ | Ribose-phosphate pyrophosphokinase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=prs PE=3 SV=1 | 5 | 98 | 2.0E-11 |
| sp|Q9HLV6|KPRS_THEAC | Ribose-phosphate pyrophosphokinase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=prs PE=3 SV=2 | 203 | 397 | 2.0E-11 |
| sp|Q9CHB8|KPRS1_LACLA | Ribose-phosphate pyrophosphokinase 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=prs1 PE=3 SV=1 | 4 | 98 | 3.0E-11 |
| sp|B7IFM5|KPRS_THEAB | Ribose-phosphate pyrophosphokinase OS=Thermosipho africanus (strain TCF52B) GN=prs PE=3 SV=1 | 7 | 98 | 4.0E-11 |
| sp|Q9EWS0|KPRH_STRCO | Putative ribose-phosphate pyrophosphokinase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO0782 PE=3 SV=1 | 2 | 110 | 5.0E-11 |
| sp|Q92EF1|KPRS2_LISIN | Ribose-phosphate pyrophosphokinase 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=prs2 PE=3 SV=1 | 1 | 98 | 5.0E-11 |
| sp|O29666|KPRS1_ARCFU | Ribose-phosphate pyrophosphokinase 1 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=prs1 PE=3 SV=2 | 230 | 397 | 5.0E-11 |
| sp|Q723E1|KPRS2_LISMF | Ribose-phosphate pyrophosphokinase 2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=prs2 PE=3 SV=1 | 7 | 98 | 7.0E-11 |
| sp|Q8Y9L8|KPRS2_LISMO | Ribose-phosphate pyrophosphokinase 2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=prs2 PE=3 SV=1 | 7 | 98 | 7.0E-11 |
| sp|Q4J9A6|KPRS_SULAC | Ribose-phosphate pyrophosphokinase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=prs PE=3 SV=1 | 219 | 422 | 7.0E-11 |
| sp|Q54QU9|PRPSC_DICDI | Ribose-phosphate pyrophosphokinase C OS=Dictyostelium discoideum GN=prsC PE=3 SV=1 | 2 | 98 | 9.0E-11 |
| sp|Q58761|KPRS_METJA | Ribose-phosphate pyrophosphokinase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=prs PE=1 SV=2 | 239 | 396 | 1.0E-10 |
| sp|Q9K3U0|KPRS_STRCO | Ribose-phosphate pyrophosphokinase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=prs PE=3 SV=1 | 3 | 98 | 2.0E-10 |
| sp|Q82HE7|KPRS_STRAW | Ribose-phosphate pyrophosphokinase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=prs PE=3 SV=1 | 3 | 98 | 2.0E-10 |
| sp|Q8TRK8|KPRS_METAC | Ribose-phosphate pyrophosphokinase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=prs PE=3 SV=1 | 205 | 425 | 2.0E-10 |
| sp|Q8PUX3|KPRS_METMA | Ribose-phosphate pyrophosphokinase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=prs PE=3 SV=1 | 205 | 422 | 6.0E-10 |
| sp|Q9XGA0|KPRS3_SPIOL | Ribose-phosphate pyrophosphokinase 3, mitochondrial OS=Spinacia oleracea GN=PRS3 PE=2 SV=1 | 223 | 423 | 1.0E-09 |
| sp|Q9PQV0|KPRS_UREPA | Ribose-phosphate pyrophosphokinase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=prs PE=3 SV=1 | 4 | 98 | 2.0E-09 |
| sp|O28853|KPRS2_ARCFU | Ribose-phosphate pyrophosphokinase 2 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=prs2 PE=3 SV=1 | 212 | 397 | 6.0E-09 |
| sp|Q680A5|KPRS4_ARATH | Ribose-phosphate pyrophosphokinase 4 OS=Arabidopsis thaliana GN=PRS4 PE=1 SV=2 | 238 | 399 | 5.0E-08 |
| sp|Q8ZU24|KPRS_PYRAE | Ribose-phosphate pyrophosphokinase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=prs PE=3 SV=1 | 175 | 397 | 7.0E-08 |
| sp|Q9XGA1|KPRS4_SPIOL | Ribose-phosphate pyrophosphokinase 4 OS=Spinacia oleracea GN=PRS4 PE=2 SV=1 | 238 | 423 | 8.0E-08 |
| sp|Q98R83|KPRS_MYCPU | Ribose-phosphate pyrophosphokinase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=prs PE=3 SV=1 | 3 | 98 | 1.0E-07 |
| sp|Q8S2E5|KPRS3_ORYSJ | Ribose-phosphate pyrophosphokinase 3, chloroplastic OS=Oryza sativa subsp. japonica GN=Os01g0723600 PE=2 SV=1 | 223 | 384 | 1.0E-07 |
| sp|Q93Z66|KPRS3_ARATH | Ribose-phosphate pyrophosphokinase 3, chloroplastic OS=Arabidopsis thaliana GN=PRS3 PE=2 SV=1 | 237 | 423 | 2.0E-07 |
| sp|Q97Z86|KPRS_SULSO | Ribose-phosphate pyrophosphokinase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=prs PE=1 SV=2 | 5 | 98 | 2.0E-06 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0000287 | magnesium ion binding | Yes |
| GO:0009165 | nucleotide biosynthetic process | Yes |
| GO:0004749 | ribose phosphate diphosphokinase activity | Yes |
| GO:0005488 | binding | No |
| GO:0009987 | cellular process | No |
| GO:0006139 | nucleobase-containing compound metabolic process | No |
| GO:0019637 | organophosphate metabolic process | No |
| GO:0034641 | cellular nitrogen compound metabolic process | No |
| GO:0071704 | organic substance metabolic process | No |
| GO:0006753 | nucleoside phosphate metabolic process | No |
| GO:0006793 | phosphorus metabolic process | No |
| GO:0003824 | catalytic activity | No |
| GO:0044271 | cellular nitrogen compound biosynthetic process | No |
| GO:1901293 | nucleoside phosphate biosynthetic process | No |
| GO:0016772 | transferase activity, transferring phosphorus-containing groups | No |
| GO:0044249 | cellular biosynthetic process | No |
| GO:0009058 | biosynthetic process | No |
| GO:0008150 | biological_process | No |
| GO:0046483 | heterocycle metabolic process | No |
| GO:0016778 | diphosphotransferase activity | No |
| GO:0016740 | transferase activity | No |
| GO:0009117 | nucleotide metabolic process | No |
| GO:0055086 | nucleobase-containing small molecule metabolic process | No |
| GO:0044237 | cellular metabolic process | No |
| GO:1901576 | organic substance biosynthetic process | No |
| GO:0006725 | cellular aromatic compound metabolic process | No |
| GO:0003674 | molecular_function | No |
| GO:0044281 | small molecule metabolic process | No |
| GO:0006796 | phosphate-containing compound metabolic process | No |
| GO:0019438 | aromatic compound biosynthetic process | No |
| GO:0018130 | heterocycle biosynthetic process | No |
| GO:0034654 | nucleobase-containing compound biosynthetic process | No |
| GO:0090407 | organophosphate biosynthetic process | No |
| GO:0046872 | metal ion binding | No |
| GO:0043167 | ion binding | No |
| GO:0044238 | primary metabolic process | No |
| GO:0043169 | cation binding | No |
| GO:0006807 | nitrogen compound metabolic process | No |
| GO:1901362 | organic cyclic compound biosynthetic process | No |
| GO:1901360 | organic cyclic compound metabolic process | No |
| GO:0008152 | metabolic process | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 20 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Hirsu2|1148 MVRNIVLLGGNSHPQLTESVCNLLCIPPGDRILARFSGGESRCEIKDSVRGKDVYIIQSGSGRVNDNLIDLCIMI SACKTGSAKRVTAVIPLFPYSRQPDWPYNKMGAPLSKSSDGLPRKDYTFESVPATPRPGGPRSNGLTNGVHRLAE KLSSSAISEHPAADPGYFPKPPSDPQTQASAGPNGRAHPADASLAQPSFTTHDYENPSSISAFQPKPGYKQWVAQ AGTLVAELLTCAGADHIITMDLHDPQYQGFFDIPVDNLYGKPLLQNYIQKHIPDYKEAVVVSPDAGGAKRAAAIA DSLKMDLALIHKERRPIKFTDQRNASMMLVGDIANRVCILVDDLADTANTITRAAKLLKREGATRVYALLTHGVF SGEAISRLNASAIDKIIVTNSVPQDEHCRSCPKLEVLDISPIFAEAIRRVHHGESISRLFEHD* |
| Coding | >Hirsu2|1148 ATGGTCCGAAACATTGTCCTCCTCGGCGGCAATTCGCACCCCCAGCTGACGGAGAGCGTCTGCAACCTCCTCTGC ATCCCGCCCGGCGACCGCATCCTCGCCAGGTTCTCGGGCGGCGAGAGCCGCTGCGAGATCAAGGACTCGGTCCGC GGCAAGGATGTCTACATCATCCAGTCCGGCTCCGGCCGCGTCAACGACAACCTCATCGACCTCTGCATCATGATC TCGGCCTGCAAGACGGGCTCCGCCAAGCGCGTCACCGCCGTCATCCCGCTCTTCCCCTACTCCCGACAGCCCGAC TGGCCCTACAACAAGATGGGCGCGCCCCTGTCCAAGTCGTCCGACGGCCTGCCGCGAAAGGACTACACCTTCGAG AGCGTGCCGGCCACCCCTCGCCCCGGCGGCCCCCGCAGCAACGGCCTCACCAACGGCGTCCACCGCCTGGCCGAG AAGCTGTCCAGCAGCGCCATCTCCGAGCACCCCGCCGCCGACCCCGGCTACTTCCCCAAGCCGCCCTCCGACCCG CAGACGCAGGCCTCGGCCGGCCCCAACGGCCGCGCCCACCCTGCCGACGCCTCGCTCGCCCAGCCGAGCTTCACG ACACACGACTACGAGAACCCGAGCAGCATCTCCGCCTTCCAGCCCAAGCCCGGCTACAAGCAGTGGGTCGCCCAG GCCGGCACCCTCGTCGCCGAGCTCCTCACCTGCGCCGGCGCCGACCACATCATCACCATGGACCTGCACGACCCC CAGTACCAGGGCTTCTTCGACATCCCGGTCGACAACCTGTACGGGAAGCCGCTCCTGCAGAACTACATCCAGAAA CACATACCCGACTACAAGGAGGCCGTCGTCGTCTCCCCCGACGCCGGCGGCGCCAAGCGCGCCGCCGCCATTGCC GACAGCCTCAAGATGGACCTGGCCCTCATCCACAAGGAACGCCGGCCGATCAAGTTCACCGACCAGCGCAACGCC AGCATGATGCTCGTCGGCGATATCGCCAACCGCGTCTGCATCCTCGTCGACGACCTCGCCGACACGGCCAACACC ATCACGCGCGCGGCCAAGCTGCTCAAGCGTGAGGGCGCCACGCGCGTCTACGCCCTGCTGACGCACGGCGTCTTC AGCGGCGAGGCCATCTCGCGCCTCAACGCCTCGGCCATCGACAAGATCATCGTCACCAACTCGGTCCCCCAAGAC GAGCACTGCCGCTCGTGCCCCAAGCTCGAGGTTTTGGATATCTCGCCCATCTTCGCCGAGGCCATCCGCCGCGTC CACCACGGCGAGTCCATAAGCAGGCTGTTCGAACACGACTGA |
| Transcript | >Hirsu2|1148 ATGGTCCGAAACATTGTCCTCCTCGGCGGCAATTCGCACCCCCAGCTGACGGAGAGCGTCTGCAACCTCCTCTGC ATCCCGCCCGGCGACCGCATCCTCGCCAGGTTCTCGGGCGGCGAGAGCCGCTGCGAGATCAAGGACTCGGTCCGC GGCAAGGATGTCTACATCATCCAGTCCGGCTCCGGCCGCGTCAACGACAACCTCATCGACCTCTGCATCATGATC TCGGCCTGCAAGACGGGCTCCGCCAAGCGCGTCACCGCCGTCATCCCGCTCTTCCCCTACTCCCGACAGCCCGAC TGGCCCTACAACAAGATGGGCGCGCCCCTGTCCAAGTCGTCCGACGGCCTGCCGCGAAAGGACTACACCTTCGAG AGCGTGCCGGCCACCCCTCGCCCCGGCGGCCCCCGCAGCAACGGCCTCACCAACGGCGTCCACCGCCTGGCCGAG AAGCTGTCCAGCAGCGCCATCTCCGAGCACCCCGCCGCCGACCCCGGCTACTTCCCCAAGCCGCCCTCCGACCCG CAGACGCAGGCCTCGGCCGGCCCCAACGGCCGCGCCCACCCTGCCGACGCCTCGCTCGCCCAGCCGAGCTTCACG ACACACGACTACGAGAACCCGAGCAGCATCTCCGCCTTCCAGCCCAAGCCCGGCTACAAGCAGTGGGTCGCCCAG GCCGGCACCCTCGTCGCCGAGCTCCTCACCTGCGCCGGCGCCGACCACATCATCACCATGGACCTGCACGACCCC CAGTACCAGGGCTTCTTCGACATCCCGGTCGACAACCTGTACGGGAAGCCGCTCCTGCAGAACTACATCCAGAAA CACATACCCGACTACAAGGAGGCCGTCGTCGTCTCCCCCGACGCCGGCGGCGCCAAGCGCGCCGCCGCCATTGCC GACAGCCTCAAGATGGACCTGGCCCTCATCCACAAGGAACGCCGGCCGATCAAGTTCACCGACCAGCGCAACGCC AGCATGATGCTCGTCGGCGATATCGCCAACCGCGTCTGCATCCTCGTCGACGACCTCGCCGACACGGCCAACACC ATCACGCGCGCGGCCAAGCTGCTCAAGCGTGAGGGCGCCACGCGCGTCTACGCCCTGCTGACGCACGGCGTCTTC AGCGGCGAGGCCATCTCGCGCCTCAACGCCTCGGCCATCGACAAGATCATCGTCACCAACTCGGTCCCCCAAGAC GAGCACTGCCGCTCGTGCCCCAAGCTCGAGGTTTTGGATATCTCGCCCATCTTCGCCGAGGCCATCCGCCGCGTC CACCACGGCGAGTCCATAAGCAGGCTGTTCGAACACGACTGA |
| Gene | >Hirsu2|1148 ATGGTCCGAAACATTGTCCTCCTCGGCGGCAATTCGCACCCCCAGCTGACGGAGAGCGTCTGCAACCTCCTCTGC ATCCCGCCCGGCGACCGCATCCTCGCCAGGTTCTCGGGCGGCGAGAGCCGCTGCGAGATCAAGGACTCGGTCCGC GGCAAGGATGTCTACATCATCCAGTCCGGCTCCGGCCGCGTCAACGACAACCTCATCGACCTCTGCATCATGATC TCGGCCTGCAAGACGGGCTCCGCCAAGCGCGTCACCGCCGTCATCCCGCTCTTCCCCTACTCCCGACAGCCCGAC TGGCCCTACAACAAGATGGGCGCGCCCCTGTCCAAGTCGTCCGACGGCCTGCCGCGAAAGGACTACACCTTCGAG AGCGTGCCGGCCACCCCTCGCCCCGGCGGCCCCCGCAGCAACGGCCTCACCAACGGCGTCCACCGCCTGGCCGAG AAGCTGTCCAGCAGCGCCATCTCCGAGCACCCCGCCGCCGACCCCGGCTACTTCCCCAAGCCGCCCTCCGACCCG CAGACGCAGGCCTCGGCCGGCCCCAACGGCCGCGCCCACCCTGCCGACGCCTCGCTCGCCCAGCCGAGCTTCACG ACACACGACTACGAGAACCCGAGCAGCATCTCCGCCTTCCAGCCCAAGCCCGGCTACAAGCAGTGGGTCGCCCAG GCCGGCACCCTCGTCGCCGAGCTCCTCACCTGCGCCGGCGCCGACCACATCATCACCATGGACCTGCACGACCCC CAGTACCAGGGCTTCTTCGACATCCCGGTCGACAACCTGTACGGGAAGCCGCTCCTGCAGAACTACATCCAGAAA CACATACCCGACTACAAGGAGGCCGTCGTCGTCTCCCCCGACGCCGGCGGCGCCAAGCGCGCCGCCGCCATTGCC GACAGCCTCAAGATGGACCTGGCCCTCATCCACAAGGTAAAGGCGCTCCGGCGTGCCGTGCCCGAACGCTGCTCA CTCGCCGCTTAGGAACGCCGGCCGATCAAGTTCACCGACCAGCGCAACGCCAGCATGATGCTCGTCGGCGATATC GCCAACCGCGTCTGCATCCTCGTCGACGACCTCGCCGACACGGCCAACACCATCACGCGCGCGGCCAAGCTGCTC AAGCGTGAGGGCGCCACGCGCGTCTACGCCCTGCTGACGCACGGCGTCTTCAGCGGCGAGGCCATCTCGCGCCTC AACGCCTCGGCCATCGACAAGATCATCGTCACCAACTCGGTCCCCCAAGACGAGCACTGCCGCTCGTGCCCCAAG CTCGAGGTTTTGGATATCTCGCCCATCTTCGCCGAGGCCATCCGCCGCGTCCACCACGGCGAGTCCATAAGCAGG CTGTTCGAACACGACTGA |