Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1142
Gene name
LocationContig_124:34625..35998
Strand-
Gene length (bp)1373
Transcript length (bp)1194
Coding sequence length (bp)1194
Protein length (aa) 398

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05091 eIF-3_zeta Eukaryotic translation initiation factor 3 subunit 7 (eIF-3) 4.3E-168 1 365

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A6SJW6|EIF3D_BOTFB Eukaryotic translation initiation factor 3 subunit D OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_12797 PE=3 SV=2 1 378 0.0E+00
sp|A7F8K7|EIF3D_SCLS1 Eukaryotic translation initiation factor 3 subunit D OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_13938 PE=3 SV=1 1 378 0.0E+00
sp|Q2UE04|EIF3D_ASPOR Eukaryotic translation initiation factor 3 subunit D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090026000811 PE=3 SV=1 1 371 0.0E+00
sp|A1DI25|EIF3D_NEOFI Eukaryotic translation initiation factor 3 subunit D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_089900 PE=3 SV=1 1 371 0.0E+00
sp|B0XU47|EIF3D_ASPFC Eukaryotic translation initiation factor 3 subunit D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_030310 PE=3 SV=1 1 371 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A6SJW6|EIF3D_BOTFB Eukaryotic translation initiation factor 3 subunit D OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_12797 PE=3 SV=2 1 378 0.0E+00
sp|A7F8K7|EIF3D_SCLS1 Eukaryotic translation initiation factor 3 subunit D OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_13938 PE=3 SV=1 1 378 0.0E+00
sp|Q2UE04|EIF3D_ASPOR Eukaryotic translation initiation factor 3 subunit D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090026000811 PE=3 SV=1 1 371 0.0E+00
sp|A1DI25|EIF3D_NEOFI Eukaryotic translation initiation factor 3 subunit D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_089900 PE=3 SV=1 1 371 0.0E+00
sp|B0XU47|EIF3D_ASPFC Eukaryotic translation initiation factor 3 subunit D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_030310 PE=3 SV=1 1 371 0.0E+00
sp|Q4X054|EIF3D_ASPFU Eukaryotic translation initiation factor 3 subunit D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G14670 PE=3 SV=1 1 371 0.0E+00
sp|A5ABX6|EIF3D_ASPNC Eukaryotic translation initiation factor 3 subunit D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An15g03780 PE=3 SV=1 1 371 0.0E+00
sp|Q1E4Z3|EIF3D_COCIM Eukaryotic translation initiation factor 3 subunit D OS=Coccidioides immitis (strain RS) GN=CIMG_02370 PE=3 SV=1 1 376 0.0E+00
sp|A1C777|EIF3D_ASPCL Eukaryotic translation initiation factor 3 subunit D OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_072810 PE=3 SV=1 1 380 0.0E+00
sp|Q0UVG7|EIF3D_PHANO Eukaryotic translation initiation factor 3 subunit D OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_04247 PE=3 SV=1 1 383 0.0E+00
sp|Q7S2I2|EIF3D_NEUCR Eukaryotic translation initiation factor 3 subunit D OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU07380 PE=3 SV=1 1 379 0.0E+00
sp|A4RFH6|EIF3D_MAGO7 Eukaryotic translation initiation factor 3 subunit D OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_00341 PE=3 SV=1 1 379 0.0E+00
sp|Q2H5T8|EIF3D_CHAGB Eukaryotic translation initiation factor 3 subunit D OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05977 PE=3 SV=1 1 390 0.0E+00
sp|Q5AVZ0|EIF3D_EMENI Eukaryotic translation initiation factor 3 subunit D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN7540 PE=3 SV=1 1 371 0.0E+00
sp|Q4PEZ2|EIF3D_USTMA Eukaryotic translation initiation factor 3 subunit D OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_01321 PE=3 SV=1 1 381 5.0E-144
sp|O94236|EIF3D_SCHPO Eukaryotic translation initiation factor 3 subunit D OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=moe1 PE=1 SV=1 1 373 1.0E-143
sp|P0CN48|EIF3D_CRYNJ Eukaryotic translation initiation factor 3 subunit D OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNB01420 PE=3 SV=1 1 371 2.0E-132
sp|P0CN49|EIF3D_CRYNB Eukaryotic translation initiation factor 3 subunit D OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBB4290 PE=3 SV=1 1 371 2.0E-132
sp|Q7QBW3|EIF3D_ANOGA Eukaryotic translation initiation factor 3 subunit D OS=Anopheles gambiae GN=eIF3-S7 PE=3 SV=3 1 371 3.0E-114
sp|Q0ZB77|EIF3D_BOMMO Eukaryotic translation initiation factor 3 subunit D OS=Bombyx mori GN=eIF3-S7 PE=2 SV=1 1 378 3.0E-113
sp|B0X6P7|EIF3D_CULQU Eukaryotic translation initiation factor 3 subunit D OS=Culex quinquefasciatus GN=eIF3-S7 PE=3 SV=1 1 371 2.0E-112
sp|B4JTN0|EI3D1_DROGR Eukaryotic translation initiation factor 3 subunit D-1 OS=Drosophila grimshawi GN=eIF-3p66 PE=3 SV=1 1 371 5.0E-112
sp|B4K892|EI3D1_DROMO Eukaryotic translation initiation factor 3 subunit D-1 OS=Drosophila mojavensis GN=eIF-3p66 PE=3 SV=1 1 371 1.0E-111
sp|P56820|EIF3D_ARATH Eukaryotic translation initiation factor 3 subunit D OS=Arabidopsis thaliana GN=TIF3D1 PE=1 SV=1 1 374 3.0E-111
sp|Q16UF8|EIF3D_AEDAE Eukaryotic translation initiation factor 3 subunit D OS=Aedes aegypti GN=eIF3-S7 PE=3 SV=1 1 372 5.0E-111
sp|B3P8G6|EI3D1_DROER Eukaryotic translation initiation factor 3 subunit D-1 OS=Drosophila erecta GN=eIF-3p66 PE=3 SV=1 1 371 5.0E-111
sp|B4LYI3|EI3D1_DROVI Eukaryotic translation initiation factor 3 subunit D-1 OS=Drosophila virilis GN=eIF-3p66 PE=3 SV=1 1 371 5.0E-111
sp|B4NLG2|EI3D1_DROWI Eukaryotic translation initiation factor 3 subunit D-1 OS=Drosophila willistoni GN=eIF-3p66 PE=3 SV=1 1 371 7.0E-111
sp|B4R222|EI3D1_DROSI Eukaryotic translation initiation factor 3 subunit D-1 OS=Drosophila simulans GN=eIF-3p66 PE=3 SV=1 1 371 9.0E-111
sp|B4HFV9|EI3D1_DROSE Eukaryotic translation initiation factor 3 subunit D-1 OS=Drosophila sechellia GN=eIF-3p66 PE=3 SV=1 1 371 1.0E-110
sp|B3LY71|EI3D1_DROAN Eukaryotic translation initiation factor 3 subunit D-1 OS=Drosophila ananassae GN=eIF-3p66 PE=3 SV=1 1 371 1.0E-110
sp|Q9VCK0|EI3D1_DROME Eukaryotic translation initiation factor 3 subunit D-1 OS=Drosophila melanogaster GN=eIF-3p66 PE=1 SV=1 1 371 1.0E-110
sp|B4PNV2|EI3D1_DROYA Eukaryotic translation initiation factor 3 subunit D-1 OS=Drosophila yakuba GN=eIF-3p66 PE=3 SV=1 1 371 2.0E-110
sp|B5DY99|EI3D1_DROPS Eukaryotic translation initiation factor 3 subunit D-1 OS=Drosophila pseudoobscura pseudoobscura GN=eIF-3p66 PE=3 SV=1 1 371 5.0E-110
sp|B3P1F9|EI3D2_DROER Eukaryotic translation initiation factor 3 subunit D-2 OS=Drosophila erecta GN=eIF3-S7-2 PE=3 SV=1 1 382 3.0E-109
sp|B4PNN4|EI3D2_DROYA Eukaryotic translation initiation factor 3 subunit D-2 OS=Drosophila yakuba GN=eIF3-S7-2 PE=3 SV=1 1 382 8.0E-109
sp|B3LZN3|EI3D2_DROAN Eukaryotic translation initiation factor 3 subunit D-2 OS=Drosophila ananassae GN=eIF3-S7-2 PE=3 SV=1 1 382 7.0E-108
sp|B4GFS1|EI3D2_DROPE Eukaryotic translation initiation factor 3 subunit D-2 OS=Drosophila persimilis GN=eIF3-S7-2 PE=3 SV=1 1 371 3.0E-107
sp|Q9VGC7|EI3D2_DROME Eukaryotic translation initiation factor 3 subunit D-2 OS=Drosophila melanogaster GN=eIF3-S7-2 PE=2 SV=1 1 382 3.0E-106
sp|B4HHG8|EI3D2_DROSE Eukaryotic translation initiation factor 3 subunit D-2 OS=Drosophila sechellia GN=eIF3-S7-2 PE=3 SV=1 1 381 2.0E-105
sp|Q7ZTM9|EIF3D_XENLA Eukaryotic translation initiation factor 3 subunit D OS=Xenopus laevis GN=eif3d PE=2 SV=1 2 371 3.0E-105
sp|Q295S1|EI3D2_DROPS Eukaryotic translation initiation factor 3 subunit D-2 OS=Drosophila pseudoobscura pseudoobscura GN=eIF3-S7-2 PE=3 SV=2 1 371 7.0E-105
sp|Q6AYK8|EIF3D_RAT Eukaryotic translation initiation factor 3 subunit D OS=Rattus norvegicus GN=Eif3d PE=1 SV=1 2 371 3.0E-104
sp|O70194|EIF3D_MOUSE Eukaryotic translation initiation factor 3 subunit D OS=Mus musculus GN=Eif3d PE=1 SV=2 2 371 3.0E-104
sp|Q3T122|EIF3D_BOVIN Eukaryotic translation initiation factor 3 subunit D OS=Bos taurus GN=EIF3D PE=2 SV=1 2 371 3.0E-104
sp|O15371|EIF3D_HUMAN Eukaryotic translation initiation factor 3 subunit D OS=Homo sapiens GN=EIF3D PE=1 SV=1 2 371 3.0E-104
sp|A7SMR1|EIF3D_NEMVE Eukaryotic translation initiation factor 3 subunit D OS=Nematostella vectensis GN=v1g235689 PE=3 SV=1 3 371 1.0E-103
sp|Q5R925|EIF3D_PONAB Eukaryotic translation initiation factor 3 subunit D OS=Pongo abelii GN=EIF3D PE=2 SV=1 2 371 1.0E-103
sp|Q6P8G0|EIF3D_XENTR Eukaryotic translation initiation factor 3 subunit D OS=Xenopus tropicalis GN=eif3d PE=2 SV=1 2 371 3.0E-103
sp|B4N8Z4|EI3D2_DROWI Eukaryotic translation initiation factor 3 subunit D-2 OS=Drosophila willistoni GN=eIF3-S7-2 PE=3 SV=1 1 371 3.0E-102
sp|B4KDI2|EI3D2_DROMO Eukaryotic translation initiation factor 3 subunit D-2 OS=Drosophila mojavensis GN=eIF3-S7-2 PE=3 SV=1 1 386 3.0E-102
sp|Q4R8R4|EIF3D_MACFA Eukaryotic translation initiation factor 3 subunit D OS=Macaca fascicularis GN=EIF3D PE=2 SV=1 2 371 3.0E-102
sp|B4QT07|EI3D2_DROSI Eukaryotic translation initiation factor 3 subunit D-2 OS=Drosophila simulans GN=eIF3-S7-2 PE=3 SV=1 1 371 5.0E-102
sp|B4M5A7|EI3D2_DROVI Eukaryotic translation initiation factor 3 subunit D-2 OS=Drosophila virilis GN=eIF3-S7-2 PE=3 SV=1 1 386 6.0E-102
sp|Q6TH15|EIF3D_DANRE Eukaryotic translation initiation factor 3 subunit D OS=Danio rerio GN=eif3d PE=2 SV=1 2 371 2.0E-101
sp|B4JUM0|EI3D2_DROGR Eukaryotic translation initiation factor 3 subunit D-2 OS=Drosophila grimshawi GN=eIF3-S7-2 PE=3 SV=1 1 386 1.0E-99
sp|Q6C1N1|EIF3D_YARLI Eukaryotic translation initiation factor 3 subunit D OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0F14839g PE=3 SV=1 1 369 2.0E-98
sp|B4GP93|EI3D1_DROPE Eukaryotic translation initiation factor 3 subunit D-1 OS=Drosophila persimilis GN=eIF-3p66 PE=3 SV=1 1 371 2.0E-95
sp|A8X371|EIF3D_CAEBR Eukaryotic translation initiation factor 3 subunit D OS=Caenorhabditis briggsae GN=eif-3.D PE=3 SV=1 1 371 9.0E-93
sp|P30642|EIF3D_CAEEL Eukaryotic translation initiation factor 3 subunit D OS=Caenorhabditis elegans GN=eif-3.D PE=1 SV=1 1 371 3.0E-91
sp|Q554U9|EIF3D_DICDI Eukaryotic translation initiation factor 3 subunit D OS=Dictyostelium discoideum GN=eif3d PE=3 SV=1 2 372 4.0E-67
[Show less]

GO

GO Term Description Terminal node
GO:0005737 cytoplasm Yes
GO:0003743 translation initiation factor activity Yes
GO:0005852 eukaryotic translation initiation factor 3 complex Yes
GO:0044464 cell part No
GO:0005488 binding No
GO:0045182 translation regulator activity No
GO:0003674 molecular_function No
GO:0044424 intracellular part No
GO:0003676 nucleic acid binding No
GO:0032991 protein-containing complex No
GO:0008135 translation factor activity, RNA binding No
GO:0097159 organic cyclic compound binding No
GO:0090079 translation regulator activity, nucleic acid binding No
GO:0003723 RNA binding No
GO:0044444 cytoplasmic part No
GO:1901363 heterocyclic compound binding No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1142
LEEIDFNRLAKLNLDADEGEDLEDYGFLYYYDRSYDKQPVKGAEKKLTAMDRAAYNVTTSSDPVIQELADRGEAT
IYATDSILSMLMCAPRSVYPWDMVIVRQGNKIFLDKRDNATLDMVTVNENAADAPLDAADGSKDVVNQPAALAEE
ATYINHNFATQVVDESASSKIDMSHGNPFYNASEDTDPPASKAYKYRKFDLSTNEEDPVYLVVRTEIDAVQKNAI
SGEDQLITIKALNEFDSKAQGSGGALDWRSKLVTQRGAVVATEMKNNSCKLARWTVQSILSKSDVMKLGFVSRVN
PRSNDKHVILGVVGWKPRDFANQMNLSLSNGWGIVRTIADMCLKRDEGKFVLVKDPNKAILRLYEVPAGSFDDDD
DDDDDAANAGPDAAGQGAGADQ*
Coding >Hirsu2|1142
CTGGAGGAGATTGACTTCAACCGGCTGGCCAAGCTGAACCTCGACGCCGACGAGGGCGAGGACCTCGAGGACTAC
GGCTTCCTCTACTACTACGACCGCTCCTACGACAAGCAGCCGGTCAAGGGCGCGGAGAAGAAGCTGACGGCCATG
GACCGCGCCGCCTACAACGTCACCACCTCGTCCGACCCCGTCATCCAGGAGCTGGCCGACCGGGGCGAGGCCACC
ATCTACGCGACCGACAGCATTCTGTCGATGCTCATGTGCGCGCCGCGCTCCGTCTACCCCTGGGACATGGTCATC
GTGCGCCAGGGCAACAAGATCTTCCTCGACAAGCGCGACAATGCGACGCTGGACATGGTGACGGTCAACGAGAAC
GCGGCCGACGCGCCGCTGGACGCGGCCGACGGCAGCAAGGACGTCGTCAACCAGCCGGCCGCGCTGGCCGAGGAG
GCCACCTACATCAACCACAACTTCGCGACCCAGGTCGTGGACGAGAGCGCGTCGTCCAAGATCGACATGAGCCAC
GGCAACCCCTTCTACAACGCGTCCGAGGACACGGACCCGCCGGCCAGCAAGGCCTACAAGTACCGCAAGTTCGAC
CTGTCGACCAACGAGGAGGACCCGGTCTACCTGGTGGTCCGCACCGAGATCGACGCGGTCCAGAAGAACGCCATC
AGCGGCGAGGACCAGCTCATCACCATCAAGGCGCTCAACGAGTTCGACAGCAAGGCCCAGGGCAGCGGCGGCGCC
CTCGACTGGCGGAGCAAGCTCGTCACCCAACGCGGCGCCGTCGTGGCGACCGAGATGAAGAACAACAGCTGCAAG
CTGGCCCGCTGGACCGTGCAGAGCATCCTCTCCAAGTCGGACGTCATGAAGCTCGGCTTCGTCTCGCGCGTCAAC
CCGCGCTCCAACGACAAGCACGTCATCCTCGGCGTCGTCGGCTGGAAGCCGCGCGACTTCGCCAACCAGATGAAC
CTGTCCTTGTCCAACGGCTGGGGCATCGTGCGCACCATCGCCGACATGTGCCTCAAGCGCGACGAGGGCAAGTTC
GTGCTCGTCAAGGACCCCAACAAGGCCATCCTGCGCCTCTACGAGGTGCCGGCCGGCAGCTTCGACGACGACGAC
GACGACGACGACGACGCCGCCAACGCCGGGCCCGACGCCGCCGGGCAGGGCGCCGGCGCGGACCAGTAG
Transcript >Hirsu2|1142
CTGGAGGAGATTGACTTCAACCGGCTGGCCAAGCTGAACCTCGACGCCGACGAGGGCGAGGACCTCGAGGACTAC
GGCTTCCTCTACTACTACGACCGCTCCTACGACAAGCAGCCGGTCAAGGGCGCGGAGAAGAAGCTGACGGCCATG
GACCGCGCCGCCTACAACGTCACCACCTCGTCCGACCCCGTCATCCAGGAGCTGGCCGACCGGGGCGAGGCCACC
ATCTACGCGACCGACAGCATTCTGTCGATGCTCATGTGCGCGCCGCGCTCCGTCTACCCCTGGGACATGGTCATC
GTGCGCCAGGGCAACAAGATCTTCCTCGACAAGCGCGACAATGCGACGCTGGACATGGTGACGGTCAACGAGAAC
GCGGCCGACGCGCCGCTGGACGCGGCCGACGGCAGCAAGGACGTCGTCAACCAGCCGGCCGCGCTGGCCGAGGAG
GCCACCTACATCAACCACAACTTCGCGACCCAGGTCGTGGACGAGAGCGCGTCGTCCAAGATCGACATGAGCCAC
GGCAACCCCTTCTACAACGCGTCCGAGGACACGGACCCGCCGGCCAGCAAGGCCTACAAGTACCGCAAGTTCGAC
CTGTCGACCAACGAGGAGGACCCGGTCTACCTGGTGGTCCGCACCGAGATCGACGCGGTCCAGAAGAACGCCATC
AGCGGCGAGGACCAGCTCATCACCATCAAGGCGCTCAACGAGTTCGACAGCAAGGCCCAGGGCAGCGGCGGCGCC
CTCGACTGGCGGAGCAAGCTCGTCACCCAACGCGGCGCCGTCGTGGCGACCGAGATGAAGAACAACAGCTGCAAG
CTGGCCCGCTGGACCGTGCAGAGCATCCTCTCCAAGTCGGACGTCATGAAGCTCGGCTTCGTCTCGCGCGTCAAC
CCGCGCTCCAACGACAAGCACGTCATCCTCGGCGTCGTCGGCTGGAAGCCGCGCGACTTCGCCAACCAGATGAAC
CTGTCCTTGTCCAACGGCTGGGGCATCGTGCGCACCATCGCCGACATGTGCCTCAAGCGCGACGAGGGCAAGTTC
GTGCTCGTCAAGGACCCCAACAAGGCCATCCTGCGCCTCTACGAGGTGCCGGCCGGCAGCTTCGACGACGACGAC
GACGACGACGACGACGCCGCCAACGCCGGGCCCGACGCCGCCGGGCAGGGCGCCGGCGCGGACCAGTAG
Gene >Hirsu2|1142
CTGGAGGAGATTGACTTCAACCGGCTGGCCAAGCTGAACCTCGACGCCGACGAGGGCGAGGACCTCGAGGACTAC
GGCTTCCTCTACTACTACGACCGCTCCTACGACAAGCAGCCGGTCAAGGGCGCGGAGAAGAAGCTGACGGCCATG
GACCGCGCCGCCTACAACGTCACCACCTCGTCCGACCCCGTCATCCAGGAGCTGGCCGACCGGGGCGAGGCCACC
ATCTACGCGACCGACAGCATTCTGTCGATGCTCATGTGCGCGCCGCGCTCCGTCTACCCCTGGGACATGGTCATC
GTGCGCCAGGGCAACAAGATCTTCCTCGACAAGCGCGACAATGCGACGCTGGACATGGTGACGGTCAACGAGAAC
GCGGCCGACGCGCCGCTGGACGCGGCCGACGGCAGCAAGGACGTCGTCAACCAGCCGGCCGCGCTGGCCGAGGAG
GCCACCTACATCAACCACAACTTCGCGACCCAGGTCGTGGACGAGAGCGCGTCGTCCAAGATCGACATGAGCCAC
GGCAACCCCTTCTACAACGCGTCCGAGGACACGGACCCGCCGGCCAGCAAGGCCTACAAGTACCGCAAGTTCGAC
CTGTCGACCAACGAGGAGGACCCGGTCTACCTGGTGGTCCGCACCGAGATCGACGCGGTCCAGAAGAACGCCATC
AGCGGCGAGGACCAGCTCATCACCATCAAGGCGCTCAACGAGTTCGACAGCAAGGCCCAGGGCAGCGGCGGCGCC
CTCGACTGGCGGAGCAAGCTCGTCACCCAACGCGGCGCCGTCGTGGCGACCGAGATGAAGAACAACAGCTGCAAG
CTGGCCCGCTGGACCGTGCAGAGCATCCTCTCCAAGTCGGACGTCATGAAGCTCGGGTCCGTTGTTATCCCCCCC
CCCTTTCCTTCTCCCTTCCTTCTCTGTCTTTTTTCTTTTGTTCTTGTCCCCTCGCGTCCTCCCCGGTCGCACGCA
CGCAATCTCCCCTTTTCGACAAGTCTCACAAGCAGGCGTCTGTGTGTGTGTGTGTGTGTGTGTGCGACGGCTAAC
GACGGTGCAGCTTCGTCTCGCGCGTCAACCCGCGCTCCAACGACAAGCACGTCATCCTCGGCGTCGTCGGCTGGA
AGCCGCGCGACTTCGCCAACCAGATGAACCTGTCCTTGTCCAACGGCTGGGGCATCGTGCGCACCATCGCCGACA
TGTGCCTCAAGCGCGACGAGGGCAAGTTCGTGCTCGTCAAGGACCCCAACAAGGCCATCCTGCGCCTCTACGAGG
TGCCGGCCGGCAGCTTCGACGACGACGACGACGACGACGACGACGCCGCCAACGCCGGGCCCGACGCCGCCGGGC
AGGGCGCCGGCGCGGACCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail