Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1133
Gene name
LocationContig_124:6030..8359
Strand-
Gene length (bp)2329
Transcript length (bp)2094
Coding sequence length (bp)2094
Protein length (aa) 698

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00412 LIM LIM domain 7.1E-07 476 515
PF00412 LIM LIM domain 5.2E-08 572 625
PF00412 LIM LIM domain 4.7E-08 635 690

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74398|YOCC_SCHPO LIM domain-containing protein C4F6.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC4F6.12 PE=1 SV=1 470 697 8.0E-28
sp|P49024|PAXI_CHICK Paxillin OS=Gallus gallus GN=PXN PE=1 SV=1 313 674 3.0E-23
sp|Q66H76|PAXI_RAT Paxillin OS=Rattus norvegicus GN=Pxn PE=1 SV=1 559 674 1.0E-22
sp|Q5R7I1|PAXI_PONAB Paxillin OS=Pongo abelii GN=PXN PE=2 SV=1 559 674 2.0E-22
sp|P49023|PAXI_HUMAN Paxillin OS=Homo sapiens GN=PXN PE=1 SV=3 559 674 2.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74398|YOCC_SCHPO LIM domain-containing protein C4F6.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC4F6.12 PE=1 SV=1 470 697 8.0E-28
sp|P49024|PAXI_CHICK Paxillin OS=Gallus gallus GN=PXN PE=1 SV=1 313 674 3.0E-23
sp|Q66H76|PAXI_RAT Paxillin OS=Rattus norvegicus GN=Pxn PE=1 SV=1 559 674 1.0E-22
sp|Q5R7I1|PAXI_PONAB Paxillin OS=Pongo abelii GN=PXN PE=2 SV=1 559 674 2.0E-22
sp|P49023|PAXI_HUMAN Paxillin OS=Homo sapiens GN=PXN PE=1 SV=3 559 674 2.0E-22
sp|Q8VI36|PAXI_MOUSE Paxillin OS=Mus musculus GN=Pxn PE=1 SV=1 559 674 2.0E-22
sp|O75112|LDB3_HUMAN LIM domain-binding protein 3 OS=Homo sapiens GN=LDB3 PE=1 SV=2 473 674 3.0E-20
sp|Q9JKS4|LDB3_MOUSE LIM domain-binding protein 3 OS=Mus musculus GN=Ldb3 PE=1 SV=1 473 674 6.0E-20
sp|Q62920|PDLI5_RAT PDZ and LIM domain protein 5 OS=Rattus norvegicus GN=Pdlim5 PE=1 SV=2 431 677 7.0E-20
sp|Q99PD6|TGFI1_RAT Transforming growth factor beta-1-induced transcript 1 protein OS=Rattus norvegicus GN=Tgfb1i1 PE=1 SV=2 559 677 6.0E-19
sp|Q62219|TGFI1_MOUSE Transforming growth factor beta-1-induced transcript 1 protein OS=Mus musculus GN=Tgfb1i1 PE=1 SV=2 559 677 8.0E-19
sp|O43294|TGFI1_HUMAN Transforming growth factor beta-1-induced transcript 1 protein OS=Homo sapiens GN=TGFB1I1 PE=1 SV=2 559 677 9.0E-19
sp|Q3MHZ4|TGFI1_BOVIN Transforming growth factor beta-1-induced transcript 1 protein OS=Bos taurus GN=TGFB1I1 PE=2 SV=2 559 677 1.0E-18
sp|Q8CI51|PDLI5_MOUSE PDZ and LIM domain protein 5 OS=Mus musculus GN=Pdlim5 PE=1 SV=4 470 677 3.0E-18
sp|O60711|LPXN_HUMAN Leupaxin OS=Homo sapiens GN=LPXN PE=1 SV=1 559 680 3.0E-18
sp|Q96HC4|PDLI5_HUMAN PDZ and LIM domain protein 5 OS=Homo sapiens GN=PDLIM5 PE=1 SV=5 470 677 5.0E-18
sp|Q8MML5|PAXB_DICDI Paxillin-B OS=Dictyostelium discoideum GN=paxB PE=2 SV=1 560 674 2.0E-17
sp|Q2TCH4|TGFI1_XENLA Transforming growth factor beta-1-induced transcript 1 protein OS=Xenopus laevis GN=tgfb1i1 PE=1 SV=2 557 677 5.0E-17
sp|Q9N261|LPXN_RABIT Leupaxin OS=Oryctolagus cuniculus GN=LPXN PE=2 SV=1 559 664 3.0E-16
sp|Q6INU3|PDLI7_XENLA PDZ and LIM domain protein 7 OS=Xenopus laevis GN=pdlim7 PE=2 SV=1 397 677 4.0E-15
sp|Q09476|PXL1_CAEEL Paxillin homolog 1 OS=Caenorhabditis elegans GN=pxl-1 PE=2 SV=2 476 679 5.0E-15
sp|Q54NW4|LIMB_DICDI LIM domain-containing protein B OS=Dictyostelium discoideum GN=limB PE=2 SV=1 557 672 5.0E-15
sp|Q99N69|LPXN_MOUSE Leupaxin OS=Mus musculus GN=Lpxn PE=1 SV=2 559 664 6.0E-15
sp|Q3TJD7|PDLI7_MOUSE PDZ and LIM domain protein 7 OS=Mus musculus GN=Pdlim7 PE=1 SV=1 570 697 3.0E-14
sp|Q55BI0|Y6787_DICDI LIM domain-containing protein DDB_G0271356 OS=Dictyostelium discoideum GN=DDB_G0271356 PE=3 SV=1 570 690 4.0E-14
sp|Q96MT3|PRIC1_HUMAN Prickle-like protein 1 OS=Homo sapiens GN=PRICKLE1 PE=1 SV=2 468 677 5.0E-14
sp|Q3TJD7|PDLI7_MOUSE PDZ and LIM domain protein 7 OS=Mus musculus GN=Pdlim7 PE=1 SV=1 473 677 8.0E-14
sp|P49024|PAXI_CHICK Paxillin OS=Gallus gallus GN=PXN PE=1 SV=1 559 673 8.0E-14
sp|Q3SX40|PDLI7_BOVIN PDZ and LIM domain protein 7 OS=Bos taurus GN=PDLIM7 PE=2 SV=1 570 697 9.0E-14
sp|Q3U5C7|PRIC1_MOUSE Prickle-like protein 1 OS=Mus musculus GN=Prickle1 PE=1 SV=1 468 677 1.0E-13
sp|Q9NR12|PDLI7_HUMAN PDZ and LIM domain protein 7 OS=Homo sapiens GN=PDLIM7 PE=1 SV=1 570 664 1.0E-13
sp|Q9Z1Z9|PDLI7_RAT PDZ and LIM domain protein 7 OS=Rattus norvegicus GN=Pdlim7 PE=1 SV=1 473 677 1.0E-13
sp|Q9NR12|PDLI7_HUMAN PDZ and LIM domain protein 7 OS=Homo sapiens GN=PDLIM7 PE=1 SV=1 473 677 2.0E-13
sp|Q3SX40|PDLI7_BOVIN PDZ and LIM domain protein 7 OS=Bos taurus GN=PDLIM7 PE=2 SV=1 473 677 3.0E-13
sp|Q66H76|PAXI_RAT Paxillin OS=Rattus norvegicus GN=Pxn PE=1 SV=1 559 673 5.0E-13
sp|Q8VI36|PAXI_MOUSE Paxillin OS=Mus musculus GN=Pxn PE=1 SV=1 497 673 5.0E-13
sp|P49023|PAXI_HUMAN Paxillin OS=Homo sapiens GN=PXN PE=1 SV=3 559 673 6.0E-13
sp|Q9Z1Z9|PDLI7_RAT PDZ and LIM domain protein 7 OS=Rattus norvegicus GN=Pdlim7 PE=1 SV=1 570 697 6.0E-13
sp|Q5R7I1|PAXI_PONAB Paxillin OS=Pongo abelii GN=PXN PE=2 SV=1 497 673 8.0E-13
sp|Q679P3|PDLI7_CHICK PDZ and LIM domain protein 7 OS=Gallus gallus GN=PDLIM7 PE=1 SV=1 465 677 1.0E-12
sp|Q71QF9|PRIC1_RAT Prickle-like protein 1 OS=Rattus norvegicus GN=Prickle1 PE=2 SV=2 468 677 1.0E-12
sp|Q3MHZ4|TGFI1_BOVIN Transforming growth factor beta-1-induced transcript 1 protein OS=Bos taurus GN=TGFB1I1 PE=2 SV=2 557 664 1.0E-12
sp|O43294|TGFI1_HUMAN Transforming growth factor beta-1-induced transcript 1 protein OS=Homo sapiens GN=TGFB1I1 PE=1 SV=2 557 664 2.0E-12
sp|Q90Z06|PRI1A_XENLA Prickle-like protein 1-A OS=Xenopus laevis GN=prickle1-a PE=1 SV=1 459 690 2.0E-12
sp|Q69ZX8|ABLM3_MOUSE Actin-binding LIM protein 3 OS=Mus musculus GN=Ablim3 PE=1 SV=2 470 664 2.0E-12
sp|Q99PD6|TGFI1_RAT Transforming growth factor beta-1-induced transcript 1 protein OS=Rattus norvegicus GN=Tgfb1i1 PE=1 SV=2 467 664 4.0E-12
sp|Q62219|TGFI1_MOUSE Transforming growth factor beta-1-induced transcript 1 protein OS=Mus musculus GN=Tgfb1i1 PE=1 SV=2 467 664 4.0E-12
sp|Q54NW4|LIMB_DICDI LIM domain-containing protein B OS=Dictyostelium discoideum GN=limB PE=2 SV=1 476 668 5.0E-12
sp|O94929|ABLM3_HUMAN Actin-binding LIM protein 3 OS=Homo sapiens GN=ABLIM3 PE=1 SV=3 476 664 7.0E-12
sp|Q679P3|PDLI7_CHICK PDZ and LIM domain protein 7 OS=Gallus gallus GN=PDLIM7 PE=1 SV=1 570 697 1.0E-11
sp|Q90WV2|PRI1B_XENLA Prickle-like protein 1-B OS=Xenopus laevis GN=prickle1-b PE=2 SV=2 474 677 1.0E-11
sp|Q8MML5|PAXB_DICDI Paxillin-B OS=Dictyostelium discoideum GN=paxB PE=2 SV=1 499 664 1.0E-11
sp|Q2KJ33|LIMS2_BOVIN LIM and senescent cell antigen-like-containing domain protein 2 OS=Bos taurus GN=LIMS2 PE=2 SV=2 475 664 2.0E-11
sp|Q6P7E4|PDLI7_DANRE PDZ and LIM domain protein 7 OS=Danio rerio GN=pdlim7 PE=2 SV=1 570 664 3.0E-11
sp|Q09476|PXL1_CAEEL Paxillin homolog 1 OS=Caenorhabditis elegans GN=pxl-1 PE=2 SV=2 572 671 1.0E-10
sp|Q91XD2|LIMS2_MOUSE LIM and senescent cell antigen-like-containing domain protein 2 OS=Mus musculus GN=Lims2 PE=1 SV=1 570 665 1.0E-10
sp|Q7Z3G6|PRIC2_HUMAN Prickle-like protein 2 OS=Homo sapiens GN=PRICKLE2 PE=1 SV=2 447 677 1.0E-10
sp|Q8K4G5|ABLM1_MOUSE Actin-binding LIM protein 1 OS=Mus musculus GN=Ablim1 PE=1 SV=1 476 677 2.0E-10
sp|A1ZA47|ZASP_DROME PDZ and LIM domain protein Zasp OS=Drosophila melanogaster GN=Zasp52 PE=1 SV=2 550 674 2.0E-10
sp|Q7Z4I7|LIMS2_HUMAN LIM and senescent cell antigen-like-containing domain protein 2 OS=Homo sapiens GN=LIMS2 PE=1 SV=1 475 664 2.0E-10
sp|P48059|LIMS1_HUMAN LIM and senescent cell antigen-like-containing domain protein 1 OS=Homo sapiens GN=LIMS1 PE=1 SV=4 475 664 3.0E-10
sp|Q80Y24|PRIC2_MOUSE Prickle-like protein 2 OS=Mus musculus GN=Prickle2 PE=1 SV=3 447 677 3.0E-10
sp|Q15942|ZYX_HUMAN Zyxin OS=Homo sapiens GN=ZYX PE=1 SV=1 476 629 3.0E-10
sp|O14639|ABLM1_HUMAN Actin-binding LIM protein 1 OS=Homo sapiens GN=ABLIM1 PE=1 SV=3 476 691 4.0E-10
sp|Q3MHZ4|TGFI1_BOVIN Transforming growth factor beta-1-induced transcript 1 protein OS=Bos taurus GN=TGFB1I1 PE=2 SV=2 572 670 4.0E-10
sp|Q99JW4|LIMS1_MOUSE LIM and senescent cell antigen-like-containing domain protein 1 OS=Mus musculus GN=Lims1 PE=1 SV=3 475 664 5.0E-10
sp|O14639|ABLM1_HUMAN Actin-binding LIM protein 1 OS=Homo sapiens GN=ABLIM1 PE=1 SV=3 476 664 6.0E-10
sp|O43294|TGFI1_HUMAN Transforming growth factor beta-1-induced transcript 1 protein OS=Homo sapiens GN=TGFB1I1 PE=1 SV=2 572 670 7.0E-10
sp|Q6P7E4|PDLI7_DANRE PDZ and LIM domain protein 7 OS=Danio rerio GN=pdlim7 PE=2 SV=1 465 677 1.0E-09
sp|Q8MML5|PAXB_DICDI Paxillin-B OS=Dictyostelium discoideum GN=paxB PE=2 SV=1 572 677 1.0E-09
sp|Q6H8Q1|ABLM2_HUMAN Actin-binding LIM protein 2 OS=Homo sapiens GN=ABLIM2 PE=1 SV=2 476 672 3.0E-09
sp|Q62523|ZYX_MOUSE Zyxin OS=Mus musculus GN=Zyx PE=1 SV=2 476 629 4.0E-09
sp|Q2TCH4|TGFI1_XENLA Transforming growth factor beta-1-induced transcript 1 protein OS=Xenopus laevis GN=tgfb1i1 PE=1 SV=2 572 664 4.0E-09
sp|Q8BL65|ABLM2_MOUSE Actin-binding LIM protein 2 OS=Mus musculus GN=Ablim2 PE=1 SV=1 464 672 1.0E-08
sp|Q6H8Q1|ABLM2_HUMAN Actin-binding LIM protein 2 OS=Homo sapiens GN=ABLIM2 PE=1 SV=2 463 664 2.0E-08
sp|O60711|LPXN_HUMAN Leupaxin OS=Homo sapiens GN=LPXN PE=1 SV=1 559 664 3.0E-08
sp|P49023|PAXI_HUMAN Paxillin OS=Homo sapiens GN=PXN PE=1 SV=3 572 668 3.0E-08
sp|Q5R7I1|PAXI_PONAB Paxillin OS=Pongo abelii GN=PXN PE=2 SV=1 572 668 3.0E-08
sp|Q6KC51|ABLM2_RAT Actin-binding LIM protein 2 OS=Rattus norvegicus GN=Ablim2 PE=1 SV=1 476 672 4.0E-08
sp|Q5F464|LPP_CHICK Lipoma-preferred partner homolog OS=Gallus gallus GN=LPP PE=2 SV=1 476 629 6.0E-08
sp|Q93052|LPP_HUMAN Lipoma-preferred partner OS=Homo sapiens GN=LPP PE=1 SV=1 476 627 2.0E-07
sp|Q9N261|LPXN_RABIT Leupaxin OS=Oryctolagus cuniculus GN=LPXN PE=2 SV=1 571 677 3.0E-07
sp|Q2TCH4|TGFI1_XENLA Transforming growth factor beta-1-induced transcript 1 protein OS=Xenopus laevis GN=tgfb1i1 PE=1 SV=2 559 673 3.0E-07
sp|Q6KC51|ABLM2_RAT Actin-binding LIM protein 2 OS=Rattus norvegicus GN=Ablim2 PE=1 SV=1 464 664 3.0E-07
sp|P50464|UNC97_CAEEL LIM domain-containing protein unc-97 OS=Caenorhabditis elegans GN=unc-97 PE=1 SV=1 570 674 4.0E-07
sp|A9LS46|WTIP_XENLA Wilms tumor protein 1-interacting protein homolog OS=Xenopus laevis GN=wtip PE=2 SV=1 476 697 6.0E-07
sp|Q93052|LPP_HUMAN Lipoma-preferred partner OS=Homo sapiens GN=LPP PE=1 SV=1 566 684 6.0E-07
sp|Q13642|FHL1_HUMAN Four and a half LIM domains protein 1 OS=Homo sapiens GN=FHL1 PE=1 SV=4 566 676 7.0E-07
sp|Q99N69|LPXN_MOUSE Leupaxin OS=Mus musculus GN=Lpxn PE=1 SV=2 572 677 2.0E-06
sp|Q0VA45|ZYX_XENTR Zyxin OS=Xenopus tropicalis GN=zyx PE=2 SV=1 464 693 3.0E-06
sp|Q54NW4|LIMB_DICDI LIM domain-containing protein B OS=Dictyostelium discoideum GN=limB PE=2 SV=1 569 664 3.0E-06
sp|Q55BI0|Y6787_DICDI LIM domain-containing protein DDB_G0271356 OS=Dictyostelium discoideum GN=DDB_G0271356 PE=3 SV=1 499 664 4.0E-06
sp|Q15654|TRIP6_HUMAN Thyroid receptor-interacting protein 6 OS=Homo sapiens GN=TRIP6 PE=1 SV=3 550 669 5.0E-06
sp|Q99N69|LPXN_MOUSE Leupaxin OS=Mus musculus GN=Lpxn PE=1 SV=2 559 664 5.0E-06
sp|Q9N261|LPXN_RABIT Leupaxin OS=Oryctolagus cuniculus GN=LPXN PE=2 SV=1 559 664 6.0E-06
sp|P97447|FHL1_MOUSE Four and a half LIM domains protein 1 OS=Mus musculus GN=Fhl1 PE=1 SV=3 566 676 6.0E-06
sp|Q9WUH4|FHL1_RAT Four and a half LIM domains protein 1 OS=Rattus norvegicus GN=Fhl1 PE=2 SV=1 566 676 9.0E-06
sp|Q3SX26|TRIP6_BOVIN Thyroid receptor-interacting protein 6 OS=Bos taurus GN=TRIP6 PE=2 SV=1 566 669 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1133
MTPPSPSYMSKDQFAQYLADLRTNRTARPGGARPQPTQSSRGSLERRSDDTASQPAANPQHGRTPSEAPSTAAVS
VSSRRSTATSRGRDYYPTTPTVPLKPSDVVGTSTYMERGQRWMEKEEAVSLRSAMEDMDLRKPGAATSDDDESRI
YNAALDEAAELVWQHENGGSLPQPDGPYRYKPHLRKNSYAHARTASIGKHGDGVAPSGLSRDIVSRSLSVSSTES
SGSSKAPLQPGDPSLPAGSAGRSSKAYGGIGTGRRRTSLKRDISGEVERPFSGDQIWEEPEASSSTKSAAFGRIS
PDKLNHKPRSPMNRARLDRFQHGSNFAKSLNQVEIHRNPPTQTRNPQYTTNGPSAKTGPDPSVERKNGIEVRGQD
IRAATSRRLKDRSSRLPEPTAVSDSPGRPITGKPKSTGPEDELGGSGPTVDVPIIVTDEAADKSSAAPSRPLPSP
GARRAQRPRGHWSPAPGAIGRATAACHECGLAIEGRFVALAGNPERFHPHCFSCFVCGTSLEAMEISPEPDHVRT
ERIERIHRRAAGEAVEESAGRTAAEDGDDRLRFFCHLDWHELFAPRCKHCRTPILGEHIVALGEHWHYGHFFCAE
CGDPFEHGMTHIEKDGYAWCIGCQTKRTERRAPKCKKCKVAVIGQYIQALGGEWHEHCFRCAECHGGFDDGQIFP
KEVEGGGLVVLCTDCRARELKL*
Coding >Hirsu2|1133
ATGACGCCGCCATCGCCCTCGTACATGTCCAAGGACCAGTTTGCACAATATCTCGCCGACCTACGTACGAACCGG
ACGGCCCGCCCCGGTGGTGCCAGGCCGCAGCCGACGCAGTCGAGCCGTGGCAGCCTGGAGCGACGCAGCGACGAC
ACCGCTTCTCAGCCCGCGGCCAACCCTCAGCATGGACGCACGCCGTCGGAAGCCCCCAGCACCGCCGCCGTCAGC
GTCTCGTCTCGGCGCTCGACGGCCACCAGCCGCGGCCGGGACTACTATCCCACTACGCCGACCGTTCCCTTGAAG
CCTTCCGACGTCGTGGGCACGTCGACGTACATGGAGCGCGGGCAGAGATGGATGGAGAAGGAAGAGGCCGTGTCT
CTGCGCTCGGCCATGGAGGACATGGACCTACGCAAACCCGGGGCAGCAACATCGGACGACGACGAGAGTCGCATA
TACAACGCCGCCCTCGACGAAGCTGCTGAGCTCGTCTGGCAACATGAGAACGGAGGCAGTCTCCCACAACCGGAC
GGGCCATATCGCTATAAGCCGCATCTTAGGAAGAACAGCTATGCCCATGCCCGTACCGCTAGCATTGGAAAGCAT
GGAGACGGCGTTGCTCCCAGCGGGCTCAGCCGGGACATTGTCTCACGATCATTGTCCGTGAGCTCGACAGAGAGC
AGCGGATCTTCCAAGGCCCCTCTCCAGCCTGGAGACCCCAGCCTGCCTGCCGGCAGCGCCGGCAGGAGCTCCAAG
GCCTACGGAGGAATCGGCACTGGACGACGCCGCACCAGCCTCAAGAGGGACATCAGCGGCGAGGTCGAGCGTCCG
TTCTCCGGTGACCAAATCTGGGAGGAGCCCGAGGCATCATCCTCCACCAAATCCGCTGCCTTCGGCCGGATTTCG
CCCGACAAGTTGAACCACAAGCCTCGGAGCCCCATGAACCGTGCTCGTCTCGACCGTTTCCAGCATGGCTCTAAT
TTCGCCAAGTCTCTGAACCAGGTCGAGATACACCGCAATCCCCCCACGCAGACTCGCAACCCTCAATATACGACA
AACGGTCCGTCTGCGAAAACCGGCCCAGACCCGTCGGTGGAGCGAAAGAACGGCATCGAGGTCCGCGGCCAGGAC
ATCCGGGCAGCCACCAGCAGGAGGCTCAAGGACCGCAGCTCCAGACTCCCCGAGCCCACCGCCGTCAGCGACAGT
CCGGGACGGCCTATTACCGGCAAGCCCAAATCCACCGGTCCGGAGGATGAGCTCGGCGGCTCGGGGCCCACTGTC
GACGTGCCCATCATCGTCACGGACGAGGCAGCGGACAAGAGCAGCGCTGCGCCGTCGCGCCCACTACCGAGCCCA
GGAGCGCGCAGAGCTCAACGGCCGCGGGGCCATTGGTCGCCTGCGCCAGGGGCTATCGGAAGGGCGACGGCGGCG
TGTCATGAGTGCGGCCTTGCCATCGAGGGAAGATTCGTGGCCCTAGCCGGCAACCCCGAGCGATTTCATCCCCAC
TGCTTCAGCTGCTTCGTCTGCGGAACCAGCCTGGAGGCCATGGAGATCAGCCCGGAGCCGGACCACGTCCGCACG
GAGCGCATCGAGAGGATCCACCGGCGCGCCGCGGGTGAGGCGGTGGAGGAGTCGGCGGGCAGGACAGCGGCGGAA
GATGGCGACGACCGGCTTCGCTTCTTCTGCCACCTGGACTGGCACGAACTGTTCGCGCCGCGCTGCAAGCACTGC
AGGACGCCCATCCTGGGCGAACACATCGTGGCGCTAGGCGAGCACTGGCACTACGGGCACTTCTTCTGCGCCGAG
TGTGGGGACCCGTTCGAGCACGGCATGACTCACATCGAGAAGGACGGGTACGCGTGGTGCATCGGCTGCCAGACG
AAGCGCACGGAACGGCGCGCGCCCAAGTGCAAAAAGTGCAAGGTGGCGGTCATCGGGCAGTACATCCAGGCGCTC
GGCGGCGAGTGGCACGAACACTGCTTCCGCTGCGCCGAGTGCCACGGCGGCTTCGACGACGGGCAGATCTTCCCC
AAGGAGGTGGAGGGAGGAGGCCTGGTGGTGCTTTGCACGGACTGCCGGGCGCGAGAACTCAAGCTATGA
Transcript >Hirsu2|1133
ATGACGCCGCCATCGCCCTCGTACATGTCCAAGGACCAGTTTGCACAATATCTCGCCGACCTACGTACGAACCGG
ACGGCCCGCCCCGGTGGTGCCAGGCCGCAGCCGACGCAGTCGAGCCGTGGCAGCCTGGAGCGACGCAGCGACGAC
ACCGCTTCTCAGCCCGCGGCCAACCCTCAGCATGGACGCACGCCGTCGGAAGCCCCCAGCACCGCCGCCGTCAGC
GTCTCGTCTCGGCGCTCGACGGCCACCAGCCGCGGCCGGGACTACTATCCCACTACGCCGACCGTTCCCTTGAAG
CCTTCCGACGTCGTGGGCACGTCGACGTACATGGAGCGCGGGCAGAGATGGATGGAGAAGGAAGAGGCCGTGTCT
CTGCGCTCGGCCATGGAGGACATGGACCTACGCAAACCCGGGGCAGCAACATCGGACGACGACGAGAGTCGCATA
TACAACGCCGCCCTCGACGAAGCTGCTGAGCTCGTCTGGCAACATGAGAACGGAGGCAGTCTCCCACAACCGGAC
GGGCCATATCGCTATAAGCCGCATCTTAGGAAGAACAGCTATGCCCATGCCCGTACCGCTAGCATTGGAAAGCAT
GGAGACGGCGTTGCTCCCAGCGGGCTCAGCCGGGACATTGTCTCACGATCATTGTCCGTGAGCTCGACAGAGAGC
AGCGGATCTTCCAAGGCCCCTCTCCAGCCTGGAGACCCCAGCCTGCCTGCCGGCAGCGCCGGCAGGAGCTCCAAG
GCCTACGGAGGAATCGGCACTGGACGACGCCGCACCAGCCTCAAGAGGGACATCAGCGGCGAGGTCGAGCGTCCG
TTCTCCGGTGACCAAATCTGGGAGGAGCCCGAGGCATCATCCTCCACCAAATCCGCTGCCTTCGGCCGGATTTCG
CCCGACAAGTTGAACCACAAGCCTCGGAGCCCCATGAACCGTGCTCGTCTCGACCGTTTCCAGCATGGCTCTAAT
TTCGCCAAGTCTCTGAACCAGGTCGAGATACACCGCAATCCCCCCACGCAGACTCGCAACCCTCAATATACGACA
AACGGTCCGTCTGCGAAAACCGGCCCAGACCCGTCGGTGGAGCGAAAGAACGGCATCGAGGTCCGCGGCCAGGAC
ATCCGGGCAGCCACCAGCAGGAGGCTCAAGGACCGCAGCTCCAGACTCCCCGAGCCCACCGCCGTCAGCGACAGT
CCGGGACGGCCTATTACCGGCAAGCCCAAATCCACCGGTCCGGAGGATGAGCTCGGCGGCTCGGGGCCCACTGTC
GACGTGCCCATCATCGTCACGGACGAGGCAGCGGACAAGAGCAGCGCTGCGCCGTCGCGCCCACTACCGAGCCCA
GGAGCGCGCAGAGCTCAACGGCCGCGGGGCCATTGGTCGCCTGCGCCAGGGGCTATCGGAAGGGCGACGGCGGCG
TGTCATGAGTGCGGCCTTGCCATCGAGGGAAGATTCGTGGCCCTAGCCGGCAACCCCGAGCGATTTCATCCCCAC
TGCTTCAGCTGCTTCGTCTGCGGAACCAGCCTGGAGGCCATGGAGATCAGCCCGGAGCCGGACCACGTCCGCACG
GAGCGCATCGAGAGGATCCACCGGCGCGCCGCGGGTGAGGCGGTGGAGGAGTCGGCGGGCAGGACAGCGGCGGAA
GATGGCGACGACCGGCTTCGCTTCTTCTGCCACCTGGACTGGCACGAACTGTTCGCGCCGCGCTGCAAGCACTGC
AGGACGCCCATCCTGGGCGAACACATCGTGGCGCTAGGCGAGCACTGGCACTACGGGCACTTCTTCTGCGCCGAG
TGTGGGGACCCGTTCGAGCACGGCATGACTCACATCGAGAAGGACGGGTACGCGTGGTGCATCGGCTGCCAGACG
AAGCGCACGGAACGGCGCGCGCCCAAGTGCAAAAAGTGCAAGGTGGCGGTCATCGGGCAGTACATCCAGGCGCTC
GGCGGCGAGTGGCACGAACACTGCTTCCGCTGCGCCGAGTGCCACGGCGGCTTCGACGACGGGCAGATCTTCCCC
AAGGAGGTGGAGGGAGGAGGCCTGGTGGTGCTTTGCACGGACTGCCGGGCGCGAGAACTCAAGCTATGA
Gene >Hirsu2|1133
ATGACGCCGCCATCGCCCTCGTACATGTCCAAGGACCAGTTTGGTATGGCTCCCGAGCGTCAATTCGTCCCTGGA
TTCCTCACTGACGAGCTTCCTCTTCTCAGCACAATATCTCGCCGACCTACGTACGAACCGGACGGCCCGCCCCGG
TGGTGCCAGGCCGCAGCCGACGCAGTCGAGCCGTGGCAGCCTGGAGCGACGCAGCGACGACACCGCTTCTCAGCC
CGCGGCCAACCCTCAGCATGGACGCACGCCGTCGGAAGCCCCCAGCACCGCCGCCGTCAGCGTCTCGTCTCGGCG
CTCGACGGCCACCAGCCGCGGCCGGGACTACTATCCCACTACGCCGACCGTTCCCTTGAAGCCTTCCGACGTCGT
GGGCACGTCGACGTACATGGAGCGCGGGCAGAGATGGATGGAGAAGGAAGAGGCCGTGTCTCTGCGCTCGGCCAT
GGAGGACATGGACCTACGCAAACCCGGGGCAGCAACATCGGACGACGACGAGAGTCGCATATACAACGCCGCCCT
CGACGAAGCTGCTGAGCTCGTCTGGCAACATGAGAACGGAGGCAGTCTCCCACAACCGGACGGGCCATATCGCTA
TAAGCCGCATCTTAGGAAGAACAGCTATGCCCATGCCCGTACCGCTAGCATTGGAAAGCATGGAGACGGCGTTGC
TCCCAGCGGGCTCAGCCGGGACATTGTCTCACGATCATTGTCCGTGAGCTCGACAGAGAGCAGCGGATCTTCCAA
GGCCCCTCTCCAGCCTGGAGACCCCAGCCTGCCTGCCGGCAGCGCCGGCAGGAGCTCCAAGGCCTACGGAGGAAT
CGGCACTGGACGACGCCGCACCAGCCTCAAGAGGGACATCAGCGGCGAGGTCGAGCGTCCGTTCTCCGGTGACCA
AATCTGGGAGGAGCCCGAGGCATCATCCTCCACCAAATCCGCTGCCTTCGGCCGGATTTCGCCCGACAAGTTGAA
CCACAAGCCTCGGAGCCCCATGAACCGTGCTCGTCTCGACCGTTTCCAGCATGGCTCTAATTTCGCCAAGTCTCT
GAACCAGGTCGAGATACACCGCAATCCCCCCACGCAGACTCGCAACCCTCAATATACGACAAACGGTCCGTCTGC
GAAAACCGGCCCAGACCCGTCGGTGGAGCGAAAGAACGGCATCGAGGTCCGCGGCCAGGACATCCGGGCAGCCAC
CAGCAGGAGGCTCAAGGACCGCAGCTCCAGACTCCCCGAGCCCACCGCCGTCAGCGACAGTCCGGGACGGCCTAT
TGTAAGCTTTGATGCGAACTGGAAAGCCCCGGACGAGTCCACTGATGACAACCCAGACCGGCAAGCCCAAATCCA
GTCAAACAACTGCCACCCCCCTCGCCAGTCTGTGGATGTCCCTCGTATCACTGTGGCGGAGGACAAGGCGTCACA
GCCACAGGAGGCGCCACGCGCGGGTATACCCTCAATCGCTGTAGCCGGTCCGGAGGATGAGCTCGGCGGCTCGGG
GCCCACTGTCGACGTGCCCATCATCGTCACGGACGAGGCAGCGGACAAGAGCAGCGCTGCGCCGTCGCGCCCACT
ACCGAGCCCAGGAGCGCGCAGAGCTCAACGGCCGCGGGGCCATTGGTCGCCTGCGCCAGGGGCTATCGGAAGGGC
GACGGCGGCGTGTCATGAGTGCGGCCTTGCCATCGAGGGAAGATTCGTGGCCCTAGCCGGCAACCCCGAGCGATT
TCATCCCCACTGCTTCAGCTGCTTCGTCTGCGGAACCAGCCTGGAGGCCATGGAGATCAGCCCGGAGCCGGACCA
CGTCCGCACGGAGCGCATCGAGAGGATCCACCGGCGCGCCGCGGGTGAGGCGGTGGAGGAGTCGGCGGGCAGGAC
AGCGGCGGAAGATGGCGACGACCGGCTTCGCTTCTTCTGCCACCTGGACTGGCACGAACTGTTCGCGCCGCGCTG
CAAGCACTGCAGGACGCCCATCCTGGGCGAACACATCGTGGCGCTAGGCGAGCACTGGCACTACGGGCACTTCTT
CTGCGCCGAGTGTGGGGACCCGTTCGAGCACGGCATGACTCACATCGAGAAGGACGGGTACGCGTGGTGCATCGG
CTGCCAGACGAAGCGCACGGAACGGCGCGCGCCCAAGTGCAAAAAGTGCAAGGTGGCGGTCATCGGGCAGTACAT
CCAGGCGCTCGGCGGCGAGTGGCACGAACACTGCTTCCGCTGCGCCGAGTGCCACGGCGGCTTCGACGACGGGCA
GATCTTCCCCAAGGAGGTGGAGGGAGGAGGCCTGGTGGTGCTTTGCACGGACTGCCGGGCGCGAGAACTCAAGCT
ATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail