Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1132
Gene name
LocationContig_124:5160..5662
Strand+
Gene length (bp)502
Transcript length (bp)315
Coding sequence length (bp)315
Protein length (aa) 105

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like 4.9E-19 25 90
PF00240 ubiquitin Ubiquitin family 1.6E-09 24 94

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12306|SMT3_YEAST Ubiquitin-like protein SMT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMT3 PE=1 SV=1 22 99 3.0E-27
sp|O13351|PMT3_SCHPO Ubiquitin-like protein pmt3/smt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmt3 PE=1 SV=2 13 104 2.0E-25
sp|Q9FLP6|SUMO2_ARATH Small ubiquitin-related modifier 2 OS=Arabidopsis thaliana GN=SUMO2 PE=1 SV=1 8 99 3.0E-25
sp|P55857|SUMO1_ORYSJ Small ubiquitin-related modifier 1 OS=Oryza sativa subsp. japonica GN=SUMO1 PE=1 SV=1 1 97 2.0E-23
sp|Q7ZTK7|SMO2A_XENLA Small ubiquitin-related modifier 2-A OS=Xenopus laevis GN=sumo2-a PE=3 SV=1 7 97 1.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12306|SMT3_YEAST Ubiquitin-like protein SMT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMT3 PE=1 SV=1 22 99 3.0E-27
sp|O13351|PMT3_SCHPO Ubiquitin-like protein pmt3/smt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmt3 PE=1 SV=2 13 104 2.0E-25
sp|Q9FLP6|SUMO2_ARATH Small ubiquitin-related modifier 2 OS=Arabidopsis thaliana GN=SUMO2 PE=1 SV=1 8 99 3.0E-25
sp|P55857|SUMO1_ORYSJ Small ubiquitin-related modifier 1 OS=Oryza sativa subsp. japonica GN=SUMO1 PE=1 SV=1 1 97 2.0E-23
sp|Q7ZTK7|SMO2A_XENLA Small ubiquitin-related modifier 2-A OS=Xenopus laevis GN=sumo2-a PE=3 SV=1 7 97 1.0E-22
sp|Q6GPW2|SMO2B_XENLA Small ubiquitin-related modifier 2-B OS=Xenopus laevis GN=sumo2-b PE=3 SV=1 7 97 2.0E-22
sp|P61955|SUMO2_BOVIN Small ubiquitin-related modifier 2 OS=Bos taurus GN=SUMO2 PE=3 SV=1 7 97 2.0E-22
sp|Q5ZJM9|SUMO2_CHICK Small ubiquitin-related modifier 2 OS=Gallus gallus GN=SUMO2 PE=3 SV=1 7 97 2.0E-22
sp|Q6LDZ8|SUMO2_CRIGR Small ubiquitin-related modifier 2 OS=Cricetulus griseus GN=SUMO2 PE=3 SV=1 7 97 2.0E-22
sp|P61956|SUMO2_HUMAN Small ubiquitin-related modifier 2 OS=Homo sapiens GN=SUMO2 PE=1 SV=3 7 97 2.0E-22
sp|Q2PFW2|SUMO2_MACFA Small ubiquitin-related modifier 2 OS=Macaca fascicularis GN=SUMO2 PE=3 SV=1 7 97 2.0E-22
sp|P61957|SUMO2_MOUSE Small ubiquitin-related modifier 2 OS=Mus musculus GN=Sumo2 PE=1 SV=1 7 97 2.0E-22
sp|P61958|SUMO2_PIG Small ubiquitin-related modifier 2 OS=Sus scrofa GN=SUMO2 PE=3 SV=1 7 97 2.0E-22
sp|P61959|SUMO2_RAT Small ubiquitin-related modifier 2 OS=Rattus norvegicus GN=Sumo2 PE=1 SV=1 7 97 2.0E-22
sp|Q28H04|SUMO2_XENTR Small ubiquitin-related modifier 2 OS=Xenopus tropicalis GN=sumo2 PE=3 SV=1 7 97 3.0E-22
sp|Q6DHL4|SUMO2_DANRE Small ubiquitin-related modifier 2 OS=Danio rerio GN=sumo2 PE=3 SV=1 7 97 8.0E-22
sp|Q6NV25|SMO3L_DANRE Small ubiquitin-related modifier 3-like OS=Danio rerio GN=sumo3l PE=3 SV=1 20 99 8.0E-22
sp|Q6DI05|SUMO3_DANRE Small ubiquitin-related modifier 3 OS=Danio rerio GN=sumo3 PE=3 SV=1 20 99 9.0E-22
sp|Q6DK72|SUMO3_XENTR Small ubiquitin-related modifier 3 OS=Xenopus tropicalis GN=sumo3 PE=3 SV=1 20 99 2.0E-21
sp|Q7SZ22|SUMO3_XENLA Small ubiquitin-related modifier 3 OS=Xenopus laevis GN=sumo3 PE=3 SV=1 20 99 2.0E-21
sp|Q5ZHQ1|SUMO3_CHICK Small ubiquitin-related modifier 3 OS=Gallus gallus GN=SUMO3 PE=3 SV=1 20 99 3.0E-21
sp|Q17QV3|SUMO3_BOVIN Small ubiquitin-related modifier 3 OS=Bos taurus GN=SUMO3 PE=3 SV=1 21 101 4.0E-21
sp|P55852|SUMO1_ARATH Small ubiquitin-related modifier 1 OS=Arabidopsis thaliana GN=SUMO1 PE=1 SV=2 1 92 4.0E-21
sp|Q5XIF4|SUMO3_RAT Small ubiquitin-related modifier 3 OS=Rattus norvegicus GN=Sumo3 PE=3 SV=1 21 97 4.0E-21
sp|P55854|SUMO3_HUMAN Small ubiquitin-related modifier 3 OS=Homo sapiens GN=SUMO3 PE=1 SV=2 21 97 5.0E-21
sp|Q9Z172|SUMO3_MOUSE Small ubiquitin-related modifier 3 OS=Mus musculus GN=Sumo3 PE=1 SV=1 21 97 5.0E-21
sp|P55853|SUMO_CAEEL Small ubiquitin-related modifier OS=Caenorhabditis elegans GN=smo-1 PE=1 SV=1 10 97 5.0E-20
sp|Q8QGH2|SUMO1_CHICK Small ubiquitin-related modifier 1 OS=Gallus gallus GN=SUMO1 PE=3 SV=1 3 97 3.0E-19
sp|Q5I0H3|SUMO1_RAT Small ubiquitin-related modifier 1 OS=Rattus norvegicus GN=Sumo1 PE=1 SV=1 3 97 3.0E-19
sp|Q5R6J4|SUMO1_PONAB Small ubiquitin-related modifier 1 OS=Pongo abelii GN=SUMO1 PE=3 SV=1 3 97 3.0E-19
sp|A7WLH8|SUMO1_PIG Small ubiquitin-related modifier 1 OS=Sus scrofa GN=SUMO1 PE=3 SV=1 3 97 3.0E-19
sp|P63166|SUMO1_MOUSE Small ubiquitin-related modifier 1 OS=Mus musculus GN=Sumo1 PE=1 SV=1 3 97 3.0E-19
sp|P63165|SUMO1_HUMAN Small ubiquitin-related modifier 1 OS=Homo sapiens GN=SUMO1 PE=1 SV=1 3 97 3.0E-19
sp|Q5E9D1|SUMO1_BOVIN Small ubiquitin-related modifier 1 OS=Bos taurus GN=SUMO1 PE=3 SV=1 3 97 3.0E-19
sp|Q2EF74|SUMO1_ICTTR Small ubiquitin-related modifier 1 OS=Ictidomys tridecemlineatus GN=SUMO1 PE=3 SV=1 3 97 4.0E-19
sp|Q9PT08|SUMO1_ONCMY Small ubiquitin-related modifier 1 OS=Oncorhynchus mykiss GN=sumo1 PE=3 SV=1 3 97 5.0E-19
sp|Q9MZD5|SUMO1_CERNI Small ubiquitin-related modifier 1 OS=Cervus nippon GN=SUMO1 PE=3 SV=1 3 97 2.0E-18
sp|A7WLI0|SUMO4_PIG Small ubiquitin-related modifier 4 OS=Sus scrofa GN=SUMO4 PE=1 SV=1 7 97 2.0E-18
sp|Q6EEV6|SUMO4_HUMAN Small ubiquitin-related modifier 4 OS=Homo sapiens GN=SUMO4 PE=1 SV=2 7 97 2.0E-18
sp|Q6DEP7|SUMO1_XENTR Small ubiquitin-related modifier 1 OS=Xenopus tropicalis GN=sumo1 PE=3 SV=1 3 97 7.0E-18
sp|Q5EAX4|SMO1B_XENLA Small ubiquitin-related modifier 1-B OS=Xenopus laevis GN=sumo1-b PE=3 SV=1 3 97 7.0E-18
sp|Q7SZR5|SUMO1_DANRE Small ubiquitin-related modifier 1 OS=Danio rerio GN=sumo1 PE=3 SV=1 3 97 1.0E-16
sp|O57686|SMO1A_XENLA Small ubiquitin-related modifier 1-A OS=Xenopus laevis GN=sumo1-a PE=1 SV=1 3 97 6.0E-16
sp|Q9FLP5|SUMO3_ARATH Small ubiquitin-related modifier 3 OS=Arabidopsis thaliana GN=SUMO3 PE=1 SV=1 1 97 2.0E-14
sp|B3H5R8|SUMO8_ARATH Putative small ubiquitin-related modifier 8 OS=Arabidopsis thaliana GN=SUMO8 PE=1 SV=1 18 97 2.0E-14
sp|Q3E8A8|SUMO7_ARATH Putative small ubiquitin-related modifier 7 OS=Arabidopsis thaliana GN=SUMO7 PE=1 SV=2 22 97 5.0E-13
sp|Q9FKC5|SUMO4_ARATH Putative small ubiquitin-related modifier 4 OS=Arabidopsis thaliana GN=SUMO4 PE=1 SV=1 5 97 1.0E-09
sp|Q8VZI7|SUMO5_ARATH Small ubiquitin-related modifier 5 OS=Arabidopsis thaliana GN=SUMO5 PE=1 SV=1 12 101 4.0E-08
sp|Q9FKC6|SUMO6_ARATH Putative small ubiquitin-related modifier 6 OS=Arabidopsis thaliana GN=SUMO6 PE=1 SV=1 23 90 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1132
MSAENDANPSPEQHEAPVNSEHLNIKVTDNNNEVFFKIKRSTKLEKLMNAFCERQGKSMTSVRFLFEGTRVQPTD
TPDGLEMVDGDTLEVHQEQVGGGCVTLPL*
Coding >Hirsu2|1132
ATGTCGGCCGAAAACGACGCGAACCCTTCGCCCGAACAGCACGAGGCGCCGGTTAACAGCGAGCACTTGAACATA
AAAGTAACCGACAACAACAATGAGGTCTTTTTCAAGATCAAGCGGAGCACGAAGCTGGAGAAGCTCATGAACGCT
TTCTGCGAGCGGCAAGGGAAGAGCATGACTTCAGTCCGCTTCCTCTTCGAGGGCACCCGAGTGCAGCCGACAGAC
ACGCCGGACGGGCTCGAGATGGTCGACGGCGATACGTTGGAGGTGCATCAGGAACAGGTCGGGGGCGGTTGTGTT
ACTCTACCTCTGTAG
Transcript >Hirsu2|1132
ATGTCGGCCGAAAACGACGCGAACCCTTCGCCCGAACAGCACGAGGCGCCGGTTAACAGCGAGCACTTGAACATA
AAAGTAACCGACAACAACAATGAGGTCTTTTTCAAGATCAAGCGGAGCACGAAGCTGGAGAAGCTCATGAACGCT
TTCTGCGAGCGGCAAGGGAAGAGCATGACTTCAGTCCGCTTCCTCTTCGAGGGCACCCGAGTGCAGCCGACAGAC
ACGCCGGACGGGCTCGAGATGGTCGACGGCGATACGTTGGAGGTGCATCAGGAACAGGTCGGGGGCGGTTGTGTT
ACTCTACCTCTGTAG
Gene >Hirsu2|1132
ATGTCGGCCGAAAACGACGCGAACCCTTCGCCCGAACAGCACGAGGCGCCGGTTAACAGCGAGCACTTGAACATA
AAAGTAACCGACAACAACAATGAGGTCTTTTTCAAGATCAAGCGGAGCACGAAGCTGGAGAAGCTCATGAACGCT
TTCTGCGAGCGGCAAGGGAAGAGCATGACTTCAGTCCGCTTCCTCTTCGAGGGCACCCGAGTGCAGCCGACAGAC
ACGCCGGACGGGGTAGGTTTCCCCCCCATTTCATCCATTTCGTCCTCCTCATTCTTCCCCCATCTTCTCTTTGGC
CGTCCGTCGTCGGCTCCTTCACCCACCCCCCTTCCCAAGCCGGAAAACCGCGTCCTCCACCTCCACCCTCGACTT
CGGCCGTGCCGACCACGCTCATGCATGCTAACTGCCTTTTTTTCCGCAGCTCGAGATGGTCGACGGCGATACGTT
GGAGGTGCATCAGGAACAGGTCGGGGGCGGTTGTGTTACTCTACCTCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail