Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|113
Gene name
LocationContig_1016:8368..9370
Strand-
Gene length (bp)1002
Transcript length (bp)1002
Coding sequence length (bp)1002
Protein length (aa) 334

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01774 UreD UreD urease accessory protein 9.5E-73 59 307

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87125|URED_SCHPO Uncharacterized urease accessory protein ureD-like OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3A12.09c PE=3 SV=1 39 310 1.0E-36
sp|Q7Y0S0|URED_ARATH Urease accessory protein D OS=Arabidopsis thaliana GN=URED PE=2 SV=1 19 232 9.0E-28
sp|Q0E3I9|URED_ORYSJ Urease accessory protein D OS=Oryza sativa subsp. japonica GN=URED PE=3 SV=2 29 243 1.0E-26
sp|E0ZS45|URED_ORYSI Urease accessory protein D OS=Oryza sativa subsp. indica GN=URED PE=2 SV=1 29 243 1.0E-26
sp|A7HHM9|URED_ANADF Urease accessory protein UreD OS=Anaeromyxobacter sp. (strain Fw109-5) GN=ureD PE=3 SV=1 7 189 2.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87125|URED_SCHPO Uncharacterized urease accessory protein ureD-like OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3A12.09c PE=3 SV=1 39 310 1.0E-36
sp|Q7Y0S0|URED_ARATH Urease accessory protein D OS=Arabidopsis thaliana GN=URED PE=2 SV=1 19 232 9.0E-28
sp|Q0E3I9|URED_ORYSJ Urease accessory protein D OS=Oryza sativa subsp. japonica GN=URED PE=3 SV=2 29 243 1.0E-26
sp|E0ZS45|URED_ORYSI Urease accessory protein D OS=Oryza sativa subsp. indica GN=URED PE=2 SV=1 29 243 1.0E-26
sp|A7HHM9|URED_ANADF Urease accessory protein UreD OS=Anaeromyxobacter sp. (strain Fw109-5) GN=ureD PE=3 SV=1 7 189 2.0E-24
sp|A9GP79|URED_SORC5 Urease accessory protein UreD OS=Sorangium cellulosum (strain So ce56) GN=ureD PE=3 SV=2 8 181 2.0E-22
sp|Q733K0|URED_BACC1 Urease accessory protein UreD OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=ureD PE=3 SV=1 60 224 5.0E-17
sp|A6U418|URED_STAA2 Urease accessory protein UreD OS=Staphylococcus aureus (strain JH1) GN=ureD PE=3 SV=1 25 198 4.0E-15
sp|Q2FEJ9|URED_STAA3 Urease accessory protein UreD OS=Staphylococcus aureus (strain USA300) GN=ureD PE=3 SV=1 25 198 4.0E-15
sp|Q2G272|URED_STAA8 Urease accessory protein UreD OS=Staphylococcus aureus (strain NCTC 8325) GN=ureD PE=3 SV=1 25 198 4.0E-15
sp|A5IV75|URED_STAA9 Urease accessory protein UreD OS=Staphylococcus aureus (strain JH9) GN=ureD PE=3 SV=1 25 198 4.0E-15
sp|Q5HDR4|URED_STAAC Urease accessory protein UreD OS=Staphylococcus aureus (strain COL) GN=ureD PE=3 SV=1 25 198 4.0E-15
sp|A6QJD4|URED_STAAE Urease accessory protein UreD OS=Staphylococcus aureus (strain Newman) GN=ureD PE=3 SV=1 25 198 4.0E-15
sp|Q6GEE0|URED_STAAR Urease accessory protein UreD OS=Staphylococcus aureus (strain MRSA252) GN=ureD PE=3 SV=1 25 198 4.0E-15
sp|A8Z391|URED_STAAT Urease accessory protein UreD OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=ureD PE=3 SV=1 25 198 4.0E-15
sp|Q6G728|URED_STAAS Urease accessory protein UreD OS=Staphylococcus aureus (strain MSSA476) GN=ureD PE=3 SV=1 25 198 5.0E-15
sp|A9KJR5|URED_CLOPH Urease accessory protein UreD OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=ureD PE=3 SV=1 42 198 6.0E-15
sp|Q5HLV7|URED_STAEQ Urease accessory protein UreD OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ureD PE=3 SV=1 60 211 7.0E-15
sp|Q45347|URED_SPOPA Urease accessory protein UreD OS=Sporosarcina pasteurii GN=ureD PE=3 SV=2 28 201 9.0E-15
sp|Q8CNC5|URED_STAES Urease accessory protein UreD OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ureD PE=3 SV=1 28 211 1.0E-14
sp|Q11VN0|URED_CYTH3 Urease accessory protein UreD OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=ureD PE=3 SV=1 41 168 2.0E-14
sp|Q2YYV1|URED_STAAB Urease accessory protein UreD OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ureD PE=3 SV=1 25 198 2.0E-14
sp|Q4A0J9|URED_STAS1 Urease accessory protein UreD OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=ureD PE=3 SV=1 60 198 2.0E-13
sp|A5FAE2|URED_FLAJ1 Urease accessory protein UreD OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=ureD PE=3 SV=1 56 197 1.0E-12
sp|Q2JWA7|URED2_SYNJA Urease accessory protein UreD 2 OS=Synechococcus sp. (strain JA-3-3Ab) GN=ureD2 PE=3 SV=1 32 188 2.0E-12
sp|Q8FQW8|URED_COREF Urease accessory protein UreD OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=ureD PE=3 SV=2 42 234 3.0E-12
sp|A1R1C9|URED_ARTAT Urease accessory protein UreD OS=Arthrobacter aurescens (strain TC1) GN=ureD PE=3 SV=1 10 197 9.0E-12
sp|B5Z670|UREH_HELPG Urease accessory protein UreH OS=Helicobacter pylori (strain G27) GN=ureH PE=3 SV=1 11 168 1.0E-11
sp|B2IT63|URED_NOSP7 Urease accessory protein UreD OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=ureD PE=3 SV=1 32 209 3.0E-11
sp|Q9ZMZ8|UREH_HELPJ Urease accessory protein UreH OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=ureH PE=3 SV=1 11 168 5.0E-11
sp|B1HZE8|URED_LYSSC Urease accessory protein UreD OS=Lysinibacillus sphaericus (strain C3-41) GN=ureD PE=3 SV=2 19 180 5.0E-11
sp|Q17VS1|UREH_HELAH Urease accessory protein UreH OS=Helicobacter acinonychis (strain Sheeba) GN=ureH PE=3 SV=1 12 168 8.0E-11
sp|Q3M708|URED_ANAVT Urease accessory protein UreD OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=ureD PE=3 SV=1 39 188 9.0E-11
sp|Q9KG55|URED_BACHD Urease accessory protein UreD OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=ureD PE=3 SV=1 59 230 1.0E-10
sp|Q8YQZ4|URED_NOSS1 Urease accessory protein UreD OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=ureD PE=3 SV=1 39 188 1.0E-10
sp|B6JPH0|UREH_HELP2 Urease accessory protein UreH OS=Helicobacter pylori (strain P12) GN=ureH PE=3 SV=1 11 168 1.0E-10
sp|Q09067|UREH_HELPY Urease accessory protein UreH OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=ureH PE=1 SV=2 11 168 2.0E-10
sp|Q117Z6|URED_TRIEI Urease accessory protein UreD OS=Trichodesmium erythraeum (strain IMS101) GN=ureD PE=3 SV=1 26 177 3.0E-10
sp|B2UW64|UREH_HELPS Urease accessory protein UreH OS=Helicobacter pylori (strain Shi470) GN=ureH PE=3 SV=1 11 168 4.0E-10
sp|B0JNA9|URED_MICAN Urease accessory protein UreD OS=Microcystis aeruginosa (strain NIES-843) GN=ureD PE=3 SV=1 41 249 9.0E-10
sp|B1XIC0|URED_SYNP2 Urease accessory protein UreD OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=ureD PE=3 SV=1 29 178 9.0E-10
sp|Q1CV87|UREH_HELPH Urease accessory protein UreH OS=Helicobacter pylori (strain HPAG1) GN=ureH PE=3 SV=1 11 168 1.0E-09
sp|Q7VJ35|UREH_HELHP Urease accessory protein UreH OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=ureH PE=3 SV=2 28 234 1.0E-09
sp|A5UH41|URED_HAEIG Urease accessory protein UreD OS=Haemophilus influenzae (strain PittGG) GN=ureD PE=3 SV=2 21 193 1.0E-09
sp|A9AZE9|URED_HERA2 Urease accessory protein UreD OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=ureD PE=3 SV=1 41 195 2.0E-09
sp|Q07400|URED_BACSB Urease accessory protein UreD OS=Bacillus sp. (strain TB-90) GN=ureD PE=3 SV=1 58 200 3.0E-09
sp|Q9Z364|URED_ACTNA Urease accessory protein UreD OS=Actinomyces naeslundii GN=ureD PE=3 SV=1 53 189 3.0E-09
sp|A3N2Q9|URED_ACTP2 Urease accessory protein UreD OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=ureD PE=3 SV=1 21 168 4.0E-09
sp|A0JRH8|URED_ARTS2 Urease accessory protein UreD OS=Arthrobacter sp. (strain FB24) GN=ureD PE=3 SV=2 57 243 5.0E-09
sp|Q2JN19|URED_SYNJB Urease accessory protein UreD OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=ureD PE=3 SV=2 39 231 1.0E-08
sp|B2GI02|URED_KOCRD Urease accessory protein UreD OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=ureD PE=3 SV=2 57 180 1.0E-08
sp|B3H2K8|URED_ACTP7 Urease accessory protein UreD OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=ureD PE=3 SV=1 21 189 1.0E-08
sp|O54425|URED_ACTPL Urease accessory protein UreD OS=Actinobacillus pleuropneumoniae GN=ureD PE=3 SV=1 21 189 1.0E-08
sp|Q8DLF7|URED_THEEB Urease accessory protein UreD OS=Thermosynechococcus elongatus (strain BP-1) GN=ureD PE=3 SV=1 41 209 1.0E-08
sp|B0C790|URED_ACAM1 Urease accessory protein UreD OS=Acaryochloris marina (strain MBIC 11017) GN=ureD PE=3 SV=1 38 188 1.0E-08
sp|B0BRT7|URED_ACTPJ Urease accessory protein UreD OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=ureD PE=3 SV=1 21 189 2.0E-08
sp|Q9RYK1|URED_DEIRA Urease accessory protein UreD OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=ureD PE=3 SV=1 41 177 3.0E-08
sp|A4T7D6|URED_MYCGI Urease accessory protein UreD OS=Mycobacterium gilvum (strain PYR-GCK) GN=ureD PE=3 SV=1 39 197 5.0E-08
sp|A5U9W0|URED_HAEIE Urease accessory protein UreD OS=Haemophilus influenzae (strain PittEE) GN=ureD PE=3 SV=1 41 195 5.0E-08
sp|B1ZNZ6|URED_OPITP Urease accessory protein UreD OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=ureD PE=3 SV=1 29 195 8.0E-08
sp|Q3IH71|URED_PSEHT Urease accessory protein UreD OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=ureD PE=3 SV=1 41 151 8.0E-08
sp|A0L6E9|URED_MAGMM Urease accessory protein UreD OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=ureD PE=3 SV=1 29 165 1.0E-07
sp|Q03MD9|URED_STRTD Urease accessory protein UreD OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=ureD PE=3 SV=1 60 158 1.0E-07
sp|Q4QN13|URED_HAEI8 Urease accessory protein UreD OS=Haemophilus influenzae (strain 86-028NP) GN=ureD PE=3 SV=1 41 195 1.0E-07
sp|Q5M603|URED_STRT2 Urease accessory protein UreD OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=ureD PE=3 SV=1 60 158 1.0E-07
sp|P44397|URED_HAEIN Urease accessory protein UreD OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ureD PE=3 SV=1 41 195 1.0E-07
sp|B1VSW8|URED2_STRGG Urease accessory protein UreD 2 OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=ureD2 PE=3 SV=2 28 168 1.0E-07
sp|Q5M1G2|URED_STRT1 Urease accessory protein UreD OS=Streptococcus thermophilus (strain CNRZ 1066) GN=ureD PE=3 SV=1 60 158 1.0E-07
sp|Q11EW8|URED_CHESB Urease accessory protein UreD OS=Chelativorans sp. (strain BNC1) GN=ureD PE=3 SV=2 8 164 2.0E-07
sp|Q55058|URED_STRE5 Urease accessory protein UreD OS=Streptococcus salivarius (strain 57.I) GN=ureD PE=3 SV=1 60 158 2.0E-07
sp|A4QA27|URED_CORGB Urease accessory protein UreD OS=Corynebacterium glutamicum (strain R) GN=ureD PE=3 SV=1 27 184 4.0E-07
sp|P73047|URED_SYNY3 Urease accessory protein UreD OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ureD PE=3 SV=2 27 178 5.0E-07
sp|Q133L1|URED_RHOPS Urease accessory protein UreD OS=Rhodopseudomonas palustris (strain BisB5) GN=ureD PE=3 SV=1 50 164 9.0E-07
sp|Q79VJ0|URED_CORGL Urease accessory protein UreD OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=ureD1 PE=2 SV=1 27 184 9.0E-07
sp|Q02944|URED_KLEPN Urease accessory protein UreD OS=Klebsiella pneumoniae GN=ureD PE=3 SV=1 28 193 1.0E-06
sp|Q09063|URED_ENTAE Urease accessory protein UreD OS=Enterobacter aerogenes GN=ureD PE=1 SV=1 28 193 1.0E-06
sp|Q6N3M9|URED_RHOPA Urease accessory protein UreD OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ureD PE=3 SV=2 50 174 1.0E-06
sp|Q7U3I6|URED_SYNPX Urease accessory protein UreD OS=Synechococcus sp. (strain WH8102) GN=ureD PE=3 SV=1 13 228 2.0E-06
sp|P0CB03|URED_UREUR Urease accessory protein UreD OS=Ureaplasma urealyticum GN=ureD PE=3 SV=1 62 207 2.0E-06
sp|B5ZBS5|URED_UREU1 Urease accessory protein UreD OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=ureD PE=3 SV=1 62 207 2.0E-06
sp|A6TE39|URED_KLEP7 Urease accessory protein UreD OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=ureD PE=3 SV=1 28 193 2.0E-06
sp|Q0I659|URED_SYNS3 Urease accessory protein UreD OS=Synechococcus sp. (strain CC9311) GN=ureD PE=3 SV=1 41 223 3.0E-06
sp|Q8XXS7|URED_RALSO Urease accessory protein UreD OS=Ralstonia solanacearum (strain GMI1000) GN=ureD PE=3 SV=1 28 166 3.0E-06
sp|Q2SYF4|URED_BURTA Urease accessory protein UreD OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=ureD PE=3 SV=2 27 222 5.0E-06
sp|P0A4R4|URED_BORPE Urease accessory protein UreD OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=ureD PE=3 SV=1 53 213 5.0E-06
sp|P0A4R6|URED_BORPA Urease accessory protein UreD OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=ureD PE=3 SV=1 53 213 5.0E-06
sp|P0A4R5|URED_BORBR Urease accessory protein UreD OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=ureD PE=3 SV=1 53 213 5.0E-06
sp|O87399|URED_SYNPV Urease accessory protein UreD OS=Synechococcus sp. (strain WH7805) GN=ureD PE=3 SV=1 41 245 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0006807 nitrogen compound metabolic process Yes
GO:0016151 nickel cation binding Yes
GO:0046872 metal ion binding No
GO:0008152 metabolic process No
GO:0043169 cation binding No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0046914 transition metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|113
MVQIWSHPFPKTSASPGQGRLVAKLLPGGGSGLEAIVYQYPLKLISPNSPSGGQKSVLVFLLSYGGGLVGGDVVS
LSIDIRAGASLSLVTQGHTKIFKSPSADVVTRQDMHVRMDQDSALCLLPDPVQPFEDSVYSQAQVFKMESRCSLC
LLDWVTAGRTARGERWSFVKWTGRNEVWLSGSGQSADRLLVRDSMILSRDGSAAVGVPLREAMHQMTIFGTLILR
GAMLEPLGNFFLSEFKALPRLGARDFRSKEVRAQEAGNISAFEHWRSRRVEHEKTQGVLWSAARVRGCVVVKFAA
PAVEAGREWIGSMLFKEGTIDARFGEEALICLR*
Coding >Hirsu2|113
ATGGTTCAGATATGGAGTCATCCGTTTCCCAAGACGTCGGCGTCTCCAGGACAAGGCAGGCTCGTCGCCAAGCTT
CTCCCTGGCGGTGGCAGCGGCCTTGAGGCCATCGTCTACCAGTATCCGCTCAAGCTCATCTCGCCCAACTCTCCA
TCCGGCGGCCAGAAGAGCGTCTTGGTCTTCCTCTTGTCCTACGGCGGCGGCCTGGTCGGCGGCGACGTCGTCAGT
CTGTCCATCGACATCCGTGCCGGAGCCAGCCTGAGCCTCGTCACCCAGGGCCACACCAAGATCTTCAAGTCCCCT
TCCGCCGATGTCGTGACCAGGCAGGACATGCATGTACGCATGGACCAAGACTCTGCTCTCTGCCTCCTGCCTGAT
CCCGTCCAGCCTTTCGAGGACAGCGTGTATAGCCAGGCGCAAGTGTTCAAGATGGAAAGCCGATGCTCTCTGTGT
CTTCTCGACTGGGTGACTGCCGGCCGAACGGCTCGCGGAGAGAGGTGGAGCTTCGTCAAGTGGACGGGCCGAAAC
GAGGTCTGGCTCAGCGGTTCTGGCCAGTCGGCAGATCGTCTGCTCGTCAGAGACAGCATGATTCTCTCCCGCGAC
GGCAGTGCGGCTGTCGGCGTGCCTCTGAGGGAGGCCATGCACCAGATGACCATCTTCGGGACGCTTATCCTCCGC
GGCGCCATGCTGGAACCGCTCGGCAATTTCTTTCTGTCCGAATTCAAGGCCCTACCCCGTCTTGGCGCCCGAGAC
TTTCGCTCCAAGGAGGTCCGGGCACAAGAAGCCGGAAATATTTCCGCCTTCGAGCACTGGAGATCTCGACGGGTC
GAACACGAGAAAACCCAGGGCGTTCTGTGGTCGGCGGCACGCGTCAGAGGCTGCGTCGTCGTCAAATTCGCTGCT
CCGGCCGTCGAGGCGGGCAGGGAATGGATCGGATCCATGTTGTTCAAGGAGGGCACCATTGATGCCCGGTTCGGC
GAGGAGGCATTGATATGCCTGCGGTGA
Transcript >Hirsu2|113
ATGGTTCAGATATGGAGTCATCCGTTTCCCAAGACGTCGGCGTCTCCAGGACAAGGCAGGCTCGTCGCCAAGCTT
CTCCCTGGCGGTGGCAGCGGCCTTGAGGCCATCGTCTACCAGTATCCGCTCAAGCTCATCTCGCCCAACTCTCCA
TCCGGCGGCCAGAAGAGCGTCTTGGTCTTCCTCTTGTCCTACGGCGGCGGCCTGGTCGGCGGCGACGTCGTCAGT
CTGTCCATCGACATCCGTGCCGGAGCCAGCCTGAGCCTCGTCACCCAGGGCCACACCAAGATCTTCAAGTCCCCT
TCCGCCGATGTCGTGACCAGGCAGGACATGCATGTACGCATGGACCAAGACTCTGCTCTCTGCCTCCTGCCTGAT
CCCGTCCAGCCTTTCGAGGACAGCGTGTATAGCCAGGCGCAAGTGTTCAAGATGGAAAGCCGATGCTCTCTGTGT
CTTCTCGACTGGGTGACTGCCGGCCGAACGGCTCGCGGAGAGAGGTGGAGCTTCGTCAAGTGGACGGGCCGAAAC
GAGGTCTGGCTCAGCGGTTCTGGCCAGTCGGCAGATCGTCTGCTCGTCAGAGACAGCATGATTCTCTCCCGCGAC
GGCAGTGCGGCTGTCGGCGTGCCTCTGAGGGAGGCCATGCACCAGATGACCATCTTCGGGACGCTTATCCTCCGC
GGCGCCATGCTGGAACCGCTCGGCAATTTCTTTCTGTCCGAATTCAAGGCCCTACCCCGTCTTGGCGCCCGAGAC
TTTCGCTCCAAGGAGGTCCGGGCACAAGAAGCCGGAAATATTTCCGCCTTCGAGCACTGGAGATCTCGACGGGTC
GAACACGAGAAAACCCAGGGCGTTCTGTGGTCGGCGGCACGCGTCAGAGGCTGCGTCGTCGTCAAATTCGCTGCT
CCGGCCGTCGAGGCGGGCAGGGAATGGATCGGATCCATGTTGTTCAAGGAGGGCACCATTGATGCCCGGTTCGGC
GAGGAGGCATTGATATGCCTGCGGTGA
Gene >Hirsu2|113
ATGGTTCAGATATGGAGTCATCCGTTTCCCAAGACGTCGGCGTCTCCAGGACAAGGCAGGCTCGTCGCCAAGCTT
CTCCCTGGCGGTGGCAGCGGCCTTGAGGCCATCGTCTACCAGTATCCGCTCAAGCTCATCTCGCCCAACTCTCCA
TCCGGCGGCCAGAAGAGCGTCTTGGTCTTCCTCTTGTCCTACGGCGGCGGCCTGGTCGGCGGCGACGTCGTCAGT
CTGTCCATCGACATCCGTGCCGGAGCCAGCCTGAGCCTCGTCACCCAGGGCCACACCAAGATCTTCAAGTCCCCT
TCCGCCGATGTCGTGACCAGGCAGGACATGCATGTACGCATGGACCAAGACTCTGCTCTCTGCCTCCTGCCTGAT
CCCGTCCAGCCTTTCGAGGACAGCGTGTATAGCCAGGCGCAAGTGTTCAAGATGGAAAGCCGATGCTCTCTGTGT
CTTCTCGACTGGGTGACTGCCGGCCGAACGGCTCGCGGAGAGAGGTGGAGCTTCGTCAAGTGGACGGGCCGAAAC
GAGGTCTGGCTCAGCGGTTCTGGCCAGTCGGCAGATCGTCTGCTCGTCAGAGACAGCATGATTCTCTCCCGCGAC
GGCAGTGCGGCTGTCGGCGTGCCTCTGAGGGAGGCCATGCACCAGATGACCATCTTCGGGACGCTTATCCTCCGC
GGCGCCATGCTGGAACCGCTCGGCAATTTCTTTCTGTCCGAATTCAAGGCCCTACCCCGTCTTGGCGCCCGAGAC
TTTCGCTCCAAGGAGGTCCGGGCACAAGAAGCCGGAAATATTTCCGCCTTCGAGCACTGGAGATCTCGACGGGTC
GAACACGAGAAAACCCAGGGCGTTCTGTGGTCGGCGGCACGCGTCAGAGGCTGCGTCGTCGTCAAATTCGCTGCT
CCGGCCGTCGAGGCGGGCAGGGAATGGATCGGATCCATGTTGTTCAAGGAGGGCACCATTGATGCCCGGTTCGGC
GAGGAGGCATTGATATGCCTGCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail