Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11273
Gene name
LocationContig_998:3068..10083
Strand+
Gene length (bp)7015
Transcript length (bp)6948
Coding sequence length (bp)6948
Protein length (aa) 2316

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08083 PROCN PROCN (NUC071) domain 9.9E-235 398 804
PF12134 PRP8_domainIV PRP8 domain IV core 6.0E-126 1765 1992
PF10596 U6-snRNA_bdg U6-snRNA interacting domain of PrP8 9.5E-89 1445 1603
PF08082 PRO8NT PRO8NT (NUC069), PrP8 N-terminal domain 1.9E-78 48 199
PF10597 U5_2-snRNA_bdg U5-snRNA binding site 2 of PrP8 1.5E-70 1213 1346
PF10598 RRM_4 RNA recognition motif of the spliceosomal PrP8 5.8E-46 989 1079
PF08084 PROCT PROCT (NUC072) domain 6.9E-45 2192 2312

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q99PV0|PRP8_MOUSE Pre-mRNA-processing-splicing factor 8 OS=Mus musculus GN=Prpf8 PE=1 SV=2 2 2312 0.0E+00
sp|Q6P2Q9|PRP8_HUMAN Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens GN=PRPF8 PE=1 SV=2 2 2312 0.0E+00
sp|P34369|PRP8_CAEEL Pre-mRNA-splicing factor 8 homolog OS=Caenorhabditis elegans GN=prp-8 PE=1 SV=1 7 2314 0.0E+00
sp|O14187|SPP42_SCHPO Pre-mRNA-splicing factor spp42 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spp42 PE=1 SV=1 19 2147 0.0E+00
sp|Q8T295|PRP8_DICDI Pre-mRNA-processing-splicing factor 8 homolog OS=Dictyostelium discoideum GN=prpf8 PE=3 SV=1 22 2313 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q99PV0|PRP8_MOUSE Pre-mRNA-processing-splicing factor 8 OS=Mus musculus GN=Prpf8 PE=1 SV=2 2 2312 0.0E+00
sp|Q6P2Q9|PRP8_HUMAN Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens GN=PRPF8 PE=1 SV=2 2 2312 0.0E+00
sp|P34369|PRP8_CAEEL Pre-mRNA-splicing factor 8 homolog OS=Caenorhabditis elegans GN=prp-8 PE=1 SV=1 7 2314 0.0E+00
sp|O14187|SPP42_SCHPO Pre-mRNA-splicing factor spp42 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spp42 PE=1 SV=1 19 2147 0.0E+00
sp|Q8T295|PRP8_DICDI Pre-mRNA-processing-splicing factor 8 homolog OS=Dictyostelium discoideum GN=prpf8 PE=3 SV=1 22 2313 0.0E+00
sp|P33334|PRP8_YEAST Pre-mRNA-splicing factor 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP8 PE=1 SV=1 29 2303 0.0E+00
sp|O14187|SPP42_SCHPO Pre-mRNA-splicing factor spp42 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spp42 PE=1 SV=1 2178 2304 5.0E-29
[Show less]

GO

GO Term Description Terminal node
GO:0030623 U5 snRNA binding Yes
GO:0003723 RNA binding Yes
GO:0017070 U6 snRNA binding Yes
GO:0000398 mRNA splicing, via spliceosome Yes
GO:0008152 metabolic process No
GO:0016070 RNA metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:0003674 molecular_function No
GO:0000375 RNA splicing, via transesterification reactions No
GO:0000377 RNA splicing, via transesterification reactions with bulged adenosine as nucleophile No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006397 mRNA processing No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0017069 snRNA binding No
GO:0008380 RNA splicing No
GO:0006396 RNA processing No
GO:1901363 heterocyclic compound binding No
GO:0016071 mRNA metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11273
MPAPPPPGYQPHSDLQIAKFAQKKKEWLRNQRNRFGEKRKAGFVQTQKADMPPEHLRKIVKDIGDVSQKKYTNDK
RSYLGALKFMPHAVLKLLENMPMPWESAREVKVLYHVNGCLTLVNEIPRVVEPVFFAQWAMMWTFMRKEKADRRL
FKRMRFPPFDDEEPPLSWSENIEDVEPLEPIQMELNEDEDEAVYDWFYDHRPLLDTSHVNGPSYKSWNLTLPQMA
ALYRLSRPLISDVVDKNYFYLFDLKSFLTAKALNVALPGGPRFEPLYKDIDPNDEDFGEFNAIDRIIFRNPVRTE
FRVAFPYLYNSLPRSVRLSWHSYPQVVFNRADDPDLPTFHFDRRINPISSRTVAPKNVDVSLEDELFGPGSNEES
EEEAFELPDEIDPFLAEEDLDSEETSAAIELWWAPYPFNRRSGRMVRAQDVPLVKKWYLEHPPSDRPPVKVRVSY
QKLLKNYVLNELHKKGPKAQNKQNLLKSLKQTKFFQQTTIDWVEAGLQVCRQGFNMLNLLIHRKNLTYLHLDYNF
NLKPVKTLTTKERKKSRFGNAFHLMREILRLTKLLVDAQVQYRLGNIDAFQLADGILYAFNHVGQLTGMYRYKYK
LMHQIRTCKDLKHLIYYRFNAGPVGKGPGCGFWAPAWRVWLFFLRGIIPLLERWLGNLLSRQFEGRHSKGVAKTV
TKQRVESHFDLELRASVMADLMDMMPEGIKQNKVNTVLQHLSEAWRCWKSNIPWKVPGLPAPIENIILRYVKSKA
DWWISVAHYNRERIRRGATVDKTVAKKNVGRLTRLWLKAEQERQHNHMKDGPYVSSEEAVAIYTTTVHWLESRKF
SPIPFPSVSYKHDTKILILALERLREAYSVKGRLNQSQREELALIEQAYDSPGTTLERIKRFLLTQRAFKEVNID
MNDNYSTINPVYDIEPIEKISDAYLDQYLWYQADQRHLFPAWIKPSDSEVPPLLVYKWAQGINNLSRVWETKDGE
CNVMIETELSKVYEKMELTLLNSLLRLIMDHNLADYITAKNNVQLTYKDMNHVNSYGMIRGLQFSAFVFQYYGLV
LDLLLLGPQRASEIAGPPQNPNDFLQFRDQDTESRHPIRLYSRYIDKIWVFLRFTAEESRDLIQRFLTEQPDPNF
ENVIGYKSKKCWPRDSRMRLMRHDVNLGRAVFWDLKNRLPRSVTTIDWDDSFVSVYSRDNPNLLFSMCGFEVRIL
PKIRNKNDEFPVKDSVWSLVDNTTKERTAYAFLQVTEQDIQKFNNRIRQILMSSGSTTFTKIANKWNTALIALFT
YYREAAVSTIDLLDTIVKCETKIQTRVKIGLNSKMPSRFPPAVFYTPKELGGLGMISGSHILIPASDKRWSKQTD
TGVTHYRAGMSHDEETLIPNIFRYIIPWEAEFIDSQRVWTEYSQKRQEANQQNRRLTLEDLEDSWDRGLPRINTL
FQKDRSTLSFDKGFRARSEFKIYQLMKSNPFWWTSQRHDGKLWNLNAYRTDVIQALGGVETILEHTLFKATGFPS
WEGLFWEKASGFEESMKFKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFLHGKIPTLKIS
LIQIFRAHLWQKIHESVVMDLCQVFDQELESLGIETVQKETIHPRKSYKMNSSCADILLFASHKWNVTRPSQLHD
TKDVIEPTTTNKFWIDVQLRYGDYDSHDIERYTRAKYLDYTTDSASIYPSATGLMIGIDLAYNLYAAFGMYFPGL
KVLVQQAMAKIMKANPALYVLRERIRKGLQLYASESNQEFLNSQNYSELFSNQIQLFIDDTNVYRVTIHKTFEGN
LTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPRQLIVTRKGLLDPL
EVQLVDFPNISIRASELQLPFQAAMKVEKLGDMILRATEPQMVLFNLYDEWLKSISSYTAFSRLILILRALHVNP
DKTKMILRPDKSVITLDHHIWPSLTDEDWIKVETQLRDLILNDYGKKNNVNVSSLTSSEVRDIILGMEISAPSMQ
RQQAAEIEKQQQEQQQLTAVTTKTQNVHGEDIIVTTTSQFEQQTFASKTEWRTRAIATSNLRARTKNMYISSVDN
DVEDMTYVMPNNIIRRFITMADLRVQVAGYLYGSAPPDNEQVMEIRARCWXXXXXXXXXXXXXXXXXXXXXXXXX
XXRLLDAHEEWDKTNTVTVSVSFTPGSVSLSAWGLTPQGYKWGAENRDTQSDQPQGFTTTMGEKRKMLLSPRFRG
FFLVPEDGRWNYSFMGNEFAGMEKKAVPVRLDTPLPFYHENHRPVHFTSFAELEDIWVDRSDNFE*
Coding >Hirsu2|11273
ATGCCAGCGCCCCCGCCTCCAGGCTATCAACCTCACTCCGACCTCCAGATCGCCAAGTTCGCGCAGAAAAAGAAG
GAATGGCTCCGGAACCAGCGCAACAGATTTGGAGAGAAACGCAAGGCGGGCTTCGTCCAGACGCAAAAGGCCGAC
ATGCCACCCGAACACCTGCGCAAGATCGTCAAGGACATCGGCGACGTCTCCCAGAAGAAGTATACCAACGACAAG
AGGAGCTACCTCGGCGCGCTCAAGTTCATGCCGCACGCCGTCCTGAAGCTTTTGGAGAACATGCCGATGCCGTGG
GAGTCGGCTCGAGAGGTCAAGGTTCTTTACCACGTCAACGGCTGCCTGACCCTGGTGAACGAGATACCTCGGGTC
GTCGAGCCTGTCTTCTTTGCGCAGTGGGCGATGATGTGGACCTTCATGCGCAAGGAAAAGGCCGACAGACGGCTG
TTCAAGCGCATGCGCTTTCCGCCGTTTGATGACGAAGAGCCCCCCCTTTCGTGGTCGGAGAATATCGAGGACGTC
GAGCCCCTCGAGCCCATCCAGATGGAGCTCAACGAAGACGAGGACGAAGCCGTCTATGACTGGTTCTACGACCAT
CGCCCGCTCCTGGACACGTCGCATGTCAACGGTCCAAGCTACAAATCCTGGAACTTGACTTTGCCCCAGATGGCC
GCGCTCTACCGTCTCAGCCGACCGCTCATATCCGACGTCGTGGACAAGAACTACTTCTACCTGTTCGACCTAAAG
AGCTTCCTGACGGCCAAGGCGCTGAACGTGGCCCTCCCCGGAGGACCCAGATTCGAGCCTCTTTACAAGGATATC
GACCCGAACGACGAAGACTTTGGCGAATTCAACGCCATCGACCGCATCATCTTCCGCAACCCTGTCCGCACCGAA
TTCCGAGTCGCTTTCCCCTATCTGTACAACTCGCTACCACGAAGCGTCCGCCTGTCCTGGCACTCATATCCGCAG
GTCGTTTTCAACCGGGCCGATGATCCGGACCTCCCGACCTTCCACTTCGACCGTCGAATCAACCCCATTTCCTCG
CGAACCGTTGCCCCGAAGAACGTGGATGTGTCCCTCGAAGACGAGCTGTTCGGACCCGGCAGCAATGAGGAGTCC
GAGGAGGAGGCGTTCGAGTTGCCCGACGAGATAGACCCCTTCCTGGCCGAAGAGGACCTCGACAGCGAGGAGACC
TCGGCAGCCATCGAGCTGTGGTGGGCGCCATATCCGTTTAACAGGCGCTCTGGCCGAATGGTTCGTGCCCAGGAC
GTGCCGCTGGTCAAGAAGTGGTATCTCGAGCACCCCCCCTCTGATCGGCCGCCCGTCAAAGTTCGAGTCTCGTAC
CAAAAACTTCTCAAAAACTACGTCCTCAACGAGCTTCACAAAAAGGGCCCCAAGGCACAGAACAAGCAAAACCTG
CTGAAGTCGCTGAAACAGACCAAGTTCTTTCAGCAGACCACCATCGACTGGGTCGAGGCAGGCTTGCAGGTCTGC
CGTCAGGGCTTCAACATGTTGAACCTCCTGATTCACCGCAAAAACCTCACATACCTCCACCTTGACTACAATTTC
AACCTGAAGCCCGTCAAGACCCTGACGACCAAGGAGCGAAAGAAATCCAGATTTGGCAATGCCTTCCACCTGATG
CGGGAAATTCTGAGGTTGACCAAGCTGCTTGTGGATGCCCAGGTGCAATACCGCCTGGGTAACATCGACGCCTTC
CAACTTGCCGACGGCATCCTCTACGCCTTTAACCACGTCGGGCAGCTCACGGGAATGTACCGCTACAAATACAAG
CTCATGCACCAGATCAGGACGTGCAAGGACTTGAAGCACCTCATATACTACCGGTTCAACGCCGGCCCCGTCGGA
AAGGGTCCCGGCTGCGGATTCTGGGCCCCCGCCTGGAGGGTGTGGCTGTTCTTCTTGCGAGGCATCATTCCTCTC
CTCGAGCGGTGGCTGGGGAACCTCCTGTCCCGTCAGTTTGAGGGGCGTCACAGCAAGGGCGTCGCCAAGACTGTG
ACGAAGCAGCGCGTCGAGTCCCACTTCGACCTTGAACTGCGCGCCTCAGTCATGGCCGACCTGATGGACATGATG
CCGGAGGGCATCAAGCAGAACAAGGTCAACACGGTGCTCCAGCACCTATCCGAGGCCTGGCGCTGCTGGAAGAGC
AACATTCCGTGGAAGGTGCCTGGCTTGCCGGCGCCCATCGAGAACATCATCCTGCGATACGTCAAGTCCAAGGCC
GATTGGTGGATCTCAGTCGCCCACTACAATCGAGAGAGAATCCGGCGAGGCGCGACCGTGGACAAGACAGTGGCG
AAGAAGAACGTCGGTCGCCTGACGCGACTGTGGCTCAAGGCCGAGCAGGAGCGGCAGCACAACCACATGAAGGAC
GGACCCTATGTCTCGTCGGAGGAGGCCGTGGCCATCTACACCACCACCGTCCACTGGCTGGAGTCAAGGAAGTTC
TCGCCCATCCCCTTCCCCAGTGTCTCGTACAAGCACGACACCAAGATCCTCATCCTCGCGCTGGAGCGCCTGAGA
GAAGCGTACTCCGTCAAGGGTCGTCTCAACCAGAGCCAGAGAGAAGAACTCGCCTTGATAGAGCAGGCCTACGAT
AGCCCGGGCACCACACTCGAGAGGATCAAGCGTTTCTTGCTCACGCAGCGGGCCTTCAAGGAGGTCAACATTGAC
ATGAACGACAACTACAGCACCATCAACCCGGTGTACGACATTGAGCCCATCGAGAAGATCAGCGATGCGTACCTG
GACCAATACCTCTGGTACCAGGCCGACCAGCGACACCTCTTCCCCGCCTGGATCAAGCCGTCCGACTCCGAGGTC
CCGCCGCTGCTGGTGTACAAGTGGGCTCAGGGCATCAACAACCTGAGCCGCGTGTGGGAGACCAAGGACGGCGAG
TGCAACGTCATGATCGAGACAGAACTCTCCAAGGTCTACGAGAAGATGGAGCTCACTCTGCTGAACTCCCTGCTC
AGGCTAATCATGGACCACAATCTGGCCGATTACATCACCGCCAAGAACAACGTCCAGCTGACGTACAAGGATATG
AACCACGTTAATAGTTACGGGATGATCCGTGGCCTGCAGTTCTCTGCCTTCGTCTTCCAGTACTACGGCCTCGTA
CTGGATCTTCTGCTCCTTGGGCCGCAGCGAGCGAGCGAGATTGCTGGCCCCCCCCAGAACCCCAACGATTTCCTC
CAGTTCCGAGACCAGGACACGGAAAGTCGACATCCCATCCGCCTGTACTCGCGCTACATTGACAAGATCTGGGTT
TTCTTGCGCTTCACGGCCGAAGAATCGAGAGACCTCATCCAGCGGTTCCTCACGGAGCAGCCCGATCCGAACTTC
GAGAACGTTATCGGGTACAAGAGCAAGAAGTGCTGGCCCAGGGATTCCCGCATGCGCCTGATGCGGCACGACGTA
AACCTCGGCCGAGCCGTCTTCTGGGATCTCAAGAACCGCCTGCCTCGATCCGTCACCACCATCGACTGGGACGAC
AGCTTCGTCAGCGTCTACAGCCGCGACAACCCCAACTTGCTCTTTTCGATGTGCGGATTCGAAGTTCGGATCCTC
CCCAAGATCAGAAACAAGAACGACGAGTTCCCGGTCAAGGACAGCGTGTGGTCTCTGGTAGACAACACGACGAAG
GAGAGGACTGCATACGCCTTCCTGCAGGTCACCGAGCAGGATATCCAGAAATTCAACAACCGCATCCGGCAGATC
CTCATGTCGTCTGGCTCGACGACCTTCACCAAAATTGCCAACAAGTGGAACACGGCGCTGATTGCGCTGTTCACT
TACTACCGCGAGGCTGCGGTCTCCACCATCGACCTGCTGGACACGATTGTCAAGTGCGAGACCAAGATCCAGACC
AGAGTCAAGATCGGGCTCAACTCGAAGATGCCTTCGCGCTTCCCGCCGGCCGTGTTCTACACGCCCAAGGAACTG
GGTGGCCTGGGCATGATCTCCGGCTCGCATATACTGATTCCCGCGAGCGACAAGCGGTGGTCCAAGCAGACGGAC
ACGGGCGTCACGCACTACCGAGCGGGAATGTCGCACGACGAGGAGACTCTGATCCCCAACATCTTCCGGTACATC
ATCCCGTGGGAGGCCGAGTTCATCGACTCCCAGCGGGTCTGGACGGAGTACTCGCAGAAGCGCCAGGAGGCCAAC
CAGCAGAACCGCCGACTGACGCTCGAGGACCTCGAGGACAGCTGGGACCGCGGTCTTCCCAGGATCAACACGCTG
TTCCAGAAGGACCGGAGCACGCTGAGCTTCGACAAGGGCTTCCGTGCCCGATCCGAGTTCAAGATCTACCAGCTC
ATGAAGAGCAACCCGTTCTGGTGGACCAGCCAGCGACACGACGGAAAGCTGTGGAACCTGAACGCCTACCGGACC
GACGTCATCCAGGCCCTGGGCGGCGTGGAGACCATCCTGGAGCACACCCTCTTCAAGGCTACCGGGTTCCCGTCG
TGGGAGGGTCTCTTCTGGGAGAAGGCGTCCGGGTTCGAGGAGTCGATGAAGTTCAAGAAGTTGACCAACGCGCAG
CGGTCCGGTCTCAACCAGATCCCGAATCGTCGTTTCACCCTCTGGTGGTCGCCAACCATCAACCGCGCCAACGTG
TACGTCGGTTTCCAAGTGCAACTCGATCTGACCGGAATCTTCTTGCATGGCAAGATCCCGACCCTGAAGATTTCT
CTCATCCAAATCTTCCGAGCCCACTTGTGGCAGAAGATTCACGAATCCGTCGTCATGGATCTCTGCCAAGTGTTT
GACCAGGAGCTGGAGTCGCTCGGCATCGAGACGGTGCAGAAGGAGACGATTCACCCGCGCAAATCGTACAAGATG
AACAGCTCGTGCGCGGACATACTCCTGTTCGCCAGCCACAAGTGGAACGTGACGCGGCCGTCGCAGCTCCACGAC
ACCAAGGACGTGATTGAACCGACGACGACGAACAAGTTCTGGATCGACGTGCAGCTGCGGTACGGCGACTACGAC
TCTCACGACATCGAGCGGTATACGCGCGCCAAGTATCTGGACTACACGACCGACAGCGCGAGCATCTACCCGTCG
GCCACCGGGCTCATGATCGGCATCGACCTGGCGTACAACCTGTACGCGGCGTTCGGCATGTACTTCCCCGGACTC
AAGGTGCTCGTGCAGCAGGCCATGGCCAAGATCATGAAGGCCAACCCGGCGCTGTACGTGCTGCGGGAGCGCATC
CGGAAGGGCCTGCAGCTGTATGCGTCCGAGAGCAACCAGGAGTTCCTGAACTCGCAGAACTACTCGGAGCTGTTC
AGCAACCAGATCCAGCTCTTCATCGACGACACCAACGTGTACCGCGTCACCATCCATAAGACGTTCGAGGGCAAT
CTGACGACGAAGCCGATCAACGGGGCCATCTTCATCTTCAACCCGCGGACCGGACAGCTGTTCCTCAAGATCATC
CACACCAGCGTCTGGGCGGGACAGAAGCGCCTGGGCCAGCTGGCCAAGTGGAAGACGGCGGAAGAAGTGGCGGCG
CTGATCCGGTCGCTGCCGGTGGAGGAGCAGCCGAGACAGCTCATCGTGACGCGCAAGGGCCTGCTGGACCCGCTC
GAGGTGCAGCTGGTCGACTTCCCCAACATTTCGATCCGGGCGTCGGAGCTGCAGCTGCCCTTCCAGGCGGCGATG
AAGGTGGAGAAGCTGGGCGACATGATCTTGCGGGCGACGGAGCCGCAGATGGTGCTGTTCAACCTGTACGACGAG
TGGCTCAAGAGCATCTCGTCGTACACGGCCTTCTCGCGGCTGATCCTCATCCTGCGCGCGCTGCACGTCAACCCG
GACAAGACCAAGATGATACTGCGGCCGGACAAGTCGGTCATCACGCTCGACCATCACATCTGGCCGTCGCTGACG
GACGAGGACTGGATCAAGGTGGAGACGCAGCTGCGGGACCTGATCCTGAACGACTACGGCAAGAAGAACAACGTC
AACGTGTCGAGCCTGACGAGCAGCGAAGTGCGGGACATCATCCTGGGCATGGAGATCTCGGCGCCGTCGATGCAG
CGGCAGCAGGCGGCGGAGATTGAGAAGCAGCAGCAGGAGCAGCAGCAGCTGACGGCGGTGACGACGAAGACGCAG
AACGTGCACGGCGAGGACATCATCGTGACGACGACGTCGCAGTTTGAGCAGCAGACGTTTGCGTCCAAGACGGAG
TGGCGGACGCGGGCGATTGCGACGTCGAACCTGCGGGCGCGGACGAAGAACATGTACATCTCGTCGGTGGACAAT
GACGTCGAGGACATGACGTACGTCATGCCCAACAACATCATCCGGCGGTTCATCACGATGGCGGACCTGCGGGTG
CAGGTGGCGGGCTACCTGTACGGGTCGGCGCCGCCGGACAACGAGCAGGTGATGGAGATACGAGCCCGCTGCTGG
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNGCGGCTGCTGGACGCGCACGAGGAGTGGGACAAGACCAACACGGTGACGGTGTCGGTGTCGTTCACGCCC
GGCAGCGTCTCGCTGTCGGCCTGGGGCCTGACGCCGCAGGGCTACAAGTGGGGGGCGGAGAACAGGGACACGCAG
AGCGACCAGCCCCAGGGGTTCACGACGACGATGGGCGAGAAGCGCAAGATGCTGCTGAGCCCGCGCTTCCGGGGC
TTCTTCCTGGTGCCGGAGGACGGGCGGTGGAACTACAGCTTCATGGGCAACGAATTCGCCGGCATGGAGAAGAAG
GCGGTCCCGGTCCGGCTGGACACGCCGCTGCCCTTCTACCACGAGAACCACCGGCCGGTGCACTTCACCAGCTTC
GCGGAGCTCGAGGACATCTGGGTGGACCGGTCGGACAACTTTGAGTAA
Transcript >Hirsu2|11273
ATGCCAGCGCCCCCGCCTCCAGGCTATCAACCTCACTCCGACCTCCAGATCGCCAAGTTCGCGCAGAAAAAGAAG
GAATGGCTCCGGAACCAGCGCAACAGATTTGGAGAGAAACGCAAGGCGGGCTTCGTCCAGACGCAAAAGGCCGAC
ATGCCACCCGAACACCTGCGCAAGATCGTCAAGGACATCGGCGACGTCTCCCAGAAGAAGTATACCAACGACAAG
AGGAGCTACCTCGGCGCGCTCAAGTTCATGCCGCACGCCGTCCTGAAGCTTTTGGAGAACATGCCGATGCCGTGG
GAGTCGGCTCGAGAGGTCAAGGTTCTTTACCACGTCAACGGCTGCCTGACCCTGGTGAACGAGATACCTCGGGTC
GTCGAGCCTGTCTTCTTTGCGCAGTGGGCGATGATGTGGACCTTCATGCGCAAGGAAAAGGCCGACAGACGGCTG
TTCAAGCGCATGCGCTTTCCGCCGTTTGATGACGAAGAGCCCCCCCTTTCGTGGTCGGAGAATATCGAGGACGTC
GAGCCCCTCGAGCCCATCCAGATGGAGCTCAACGAAGACGAGGACGAAGCCGTCTATGACTGGTTCTACGACCAT
CGCCCGCTCCTGGACACGTCGCATGTCAACGGTCCAAGCTACAAATCCTGGAACTTGACTTTGCCCCAGATGGCC
GCGCTCTACCGTCTCAGCCGACCGCTCATATCCGACGTCGTGGACAAGAACTACTTCTACCTGTTCGACCTAAAG
AGCTTCCTGACGGCCAAGGCGCTGAACGTGGCCCTCCCCGGAGGACCCAGATTCGAGCCTCTTTACAAGGATATC
GACCCGAACGACGAAGACTTTGGCGAATTCAACGCCATCGACCGCATCATCTTCCGCAACCCTGTCCGCACCGAA
TTCCGAGTCGCTTTCCCCTATCTGTACAACTCGCTACCACGAAGCGTCCGCCTGTCCTGGCACTCATATCCGCAG
GTCGTTTTCAACCGGGCCGATGATCCGGACCTCCCGACCTTCCACTTCGACCGTCGAATCAACCCCATTTCCTCG
CGAACCGTTGCCCCGAAGAACGTGGATGTGTCCCTCGAAGACGAGCTGTTCGGACCCGGCAGCAATGAGGAGTCC
GAGGAGGAGGCGTTCGAGTTGCCCGACGAGATAGACCCCTTCCTGGCCGAAGAGGACCTCGACAGCGAGGAGACC
TCGGCAGCCATCGAGCTGTGGTGGGCGCCATATCCGTTTAACAGGCGCTCTGGCCGAATGGTTCGTGCCCAGGAC
GTGCCGCTGGTCAAGAAGTGGTATCTCGAGCACCCCCCCTCTGATCGGCCGCCCGTCAAAGTTCGAGTCTCGTAC
CAAAAACTTCTCAAAAACTACGTCCTCAACGAGCTTCACAAAAAGGGCCCCAAGGCACAGAACAAGCAAAACCTG
CTGAAGTCGCTGAAACAGACCAAGTTCTTTCAGCAGACCACCATCGACTGGGTCGAGGCAGGCTTGCAGGTCTGC
CGTCAGGGCTTCAACATGTTGAACCTCCTGATTCACCGCAAAAACCTCACATACCTCCACCTTGACTACAATTTC
AACCTGAAGCCCGTCAAGACCCTGACGACCAAGGAGCGAAAGAAATCCAGATTTGGCAATGCCTTCCACCTGATG
CGGGAAATTCTGAGGTTGACCAAGCTGCTTGTGGATGCCCAGGTGCAATACCGCCTGGGTAACATCGACGCCTTC
CAACTTGCCGACGGCATCCTCTACGCCTTTAACCACGTCGGGCAGCTCACGGGAATGTACCGCTACAAATACAAG
CTCATGCACCAGATCAGGACGTGCAAGGACTTGAAGCACCTCATATACTACCGGTTCAACGCCGGCCCCGTCGGA
AAGGGTCCCGGCTGCGGATTCTGGGCCCCCGCCTGGAGGGTGTGGCTGTTCTTCTTGCGAGGCATCATTCCTCTC
CTCGAGCGGTGGCTGGGGAACCTCCTGTCCCGTCAGTTTGAGGGGCGTCACAGCAAGGGCGTCGCCAAGACTGTG
ACGAAGCAGCGCGTCGAGTCCCACTTCGACCTTGAACTGCGCGCCTCAGTCATGGCCGACCTGATGGACATGATG
CCGGAGGGCATCAAGCAGAACAAGGTCAACACGGTGCTCCAGCACCTATCCGAGGCCTGGCGCTGCTGGAAGAGC
AACATTCCGTGGAAGGTGCCTGGCTTGCCGGCGCCCATCGAGAACATCATCCTGCGATACGTCAAGTCCAAGGCC
GATTGGTGGATCTCAGTCGCCCACTACAATCGAGAGAGAATCCGGCGAGGCGCGACCGTGGACAAGACAGTGGCG
AAGAAGAACGTCGGTCGCCTGACGCGACTGTGGCTCAAGGCCGAGCAGGAGCGGCAGCACAACCACATGAAGGAC
GGACCCTATGTCTCGTCGGAGGAGGCCGTGGCCATCTACACCACCACCGTCCACTGGCTGGAGTCAAGGAAGTTC
TCGCCCATCCCCTTCCCCAGTGTCTCGTACAAGCACGACACCAAGATCCTCATCCTCGCGCTGGAGCGCCTGAGA
GAAGCGTACTCCGTCAAGGGTCGTCTCAACCAGAGCCAGAGAGAAGAACTCGCCTTGATAGAGCAGGCCTACGAT
AGCCCGGGCACCACACTCGAGAGGATCAAGCGTTTCTTGCTCACGCAGCGGGCCTTCAAGGAGGTCAACATTGAC
ATGAACGACAACTACAGCACCATCAACCCGGTGTACGACATTGAGCCCATCGAGAAGATCAGCGATGCGTACCTG
GACCAATACCTCTGGTACCAGGCCGACCAGCGACACCTCTTCCCCGCCTGGATCAAGCCGTCCGACTCCGAGGTC
CCGCCGCTGCTGGTGTACAAGTGGGCTCAGGGCATCAACAACCTGAGCCGCGTGTGGGAGACCAAGGACGGCGAG
TGCAACGTCATGATCGAGACAGAACTCTCCAAGGTCTACGAGAAGATGGAGCTCACTCTGCTGAACTCCCTGCTC
AGGCTAATCATGGACCACAATCTGGCCGATTACATCACCGCCAAGAACAACGTCCAGCTGACGTACAAGGATATG
AACCACGTTAATAGTTACGGGATGATCCGTGGCCTGCAGTTCTCTGCCTTCGTCTTCCAGTACTACGGCCTCGTA
CTGGATCTTCTGCTCCTTGGGCCGCAGCGAGCGAGCGAGATTGCTGGCCCCCCCCAGAACCCCAACGATTTCCTC
CAGTTCCGAGACCAGGACACGGAAAGTCGACATCCCATCCGCCTGTACTCGCGCTACATTGACAAGATCTGGGTT
TTCTTGCGCTTCACGGCCGAAGAATCGAGAGACCTCATCCAGCGGTTCCTCACGGAGCAGCCCGATCCGAACTTC
GAGAACGTTATCGGGTACAAGAGCAAGAAGTGCTGGCCCAGGGATTCCCGCATGCGCCTGATGCGGCACGACGTA
AACCTCGGCCGAGCCGTCTTCTGGGATCTCAAGAACCGCCTGCCTCGATCCGTCACCACCATCGACTGGGACGAC
AGCTTCGTCAGCGTCTACAGCCGCGACAACCCCAACTTGCTCTTTTCGATGTGCGGATTCGAAGTTCGGATCCTC
CCCAAGATCAGAAACAAGAACGACGAGTTCCCGGTCAAGGACAGCGTGTGGTCTCTGGTAGACAACACGACGAAG
GAGAGGACTGCATACGCCTTCCTGCAGGTCACCGAGCAGGATATCCAGAAATTCAACAACCGCATCCGGCAGATC
CTCATGTCGTCTGGCTCGACGACCTTCACCAAAATTGCCAACAAGTGGAACACGGCGCTGATTGCGCTGTTCACT
TACTACCGCGAGGCTGCGGTCTCCACCATCGACCTGCTGGACACGATTGTCAAGTGCGAGACCAAGATCCAGACC
AGAGTCAAGATCGGGCTCAACTCGAAGATGCCTTCGCGCTTCCCGCCGGCCGTGTTCTACACGCCCAAGGAACTG
GGTGGCCTGGGCATGATCTCCGGCTCGCATATACTGATTCCCGCGAGCGACAAGCGGTGGTCCAAGCAGACGGAC
ACGGGCGTCACGCACTACCGAGCGGGAATGTCGCACGACGAGGAGACTCTGATCCCCAACATCTTCCGGTACATC
ATCCCGTGGGAGGCCGAGTTCATCGACTCCCAGCGGGTCTGGACGGAGTACTCGCAGAAGCGCCAGGAGGCCAAC
CAGCAGAACCGCCGACTGACGCTCGAGGACCTCGAGGACAGCTGGGACCGCGGTCTTCCCAGGATCAACACGCTG
TTCCAGAAGGACCGGAGCACGCTGAGCTTCGACAAGGGCTTCCGTGCCCGATCCGAGTTCAAGATCTACCAGCTC
ATGAAGAGCAACCCGTTCTGGTGGACCAGCCAGCGACACGACGGAAAGCTGTGGAACCTGAACGCCTACCGGACC
GACGTCATCCAGGCCCTGGGCGGCGTGGAGACCATCCTGGAGCACACCCTCTTCAAGGCTACCGGGTTCCCGTCG
TGGGAGGGTCTCTTCTGGGAGAAGGCGTCCGGGTTCGAGGAGTCGATGAAGTTCAAGAAGTTGACCAACGCGCAG
CGGTCCGGTCTCAACCAGATCCCGAATCGTCGTTTCACCCTCTGGTGGTCGCCAACCATCAACCGCGCCAACGTG
TACGTCGGTTTCCAAGTGCAACTCGATCTGACCGGAATCTTCTTGCATGGCAAGATCCCGACCCTGAAGATTTCT
CTCATCCAAATCTTCCGAGCCCACTTGTGGCAGAAGATTCACGAATCCGTCGTCATGGATCTCTGCCAAGTGTTT
GACCAGGAGCTGGAGTCGCTCGGCATCGAGACGGTGCAGAAGGAGACGATTCACCCGCGCAAATCGTACAAGATG
AACAGCTCGTGCGCGGACATACTCCTGTTCGCCAGCCACAAGTGGAACGTGACGCGGCCGTCGCAGCTCCACGAC
ACCAAGGACGTGATTGAACCGACGACGACGAACAAGTTCTGGATCGACGTGCAGCTGCGGTACGGCGACTACGAC
TCTCACGACATCGAGCGGTATACGCGCGCCAAGTATCTGGACTACACGACCGACAGCGCGAGCATCTACCCGTCG
GCCACCGGGCTCATGATCGGCATCGACCTGGCGTACAACCTGTACGCGGCGTTCGGCATGTACTTCCCCGGACTC
AAGGTGCTCGTGCAGCAGGCCATGGCCAAGATCATGAAGGCCAACCCGGCGCTGTACGTGCTGCGGGAGCGCATC
CGGAAGGGCCTGCAGCTGTATGCGTCCGAGAGCAACCAGGAGTTCCTGAACTCGCAGAACTACTCGGAGCTGTTC
AGCAACCAGATCCAGCTCTTCATCGACGACACCAACGTGTACCGCGTCACCATCCATAAGACGTTCGAGGGCAAT
CTGACGACGAAGCCGATCAACGGGGCCATCTTCATCTTCAACCCGCGGACCGGACAGCTGTTCCTCAAGATCATC
CACACCAGCGTCTGGGCGGGACAGAAGCGCCTGGGCCAGCTGGCCAAGTGGAAGACGGCGGAAGAAGTGGCGGCG
CTGATCCGGTCGCTGCCGGTGGAGGAGCAGCCGAGACAGCTCATCGTGACGCGCAAGGGCCTGCTGGACCCGCTC
GAGGTGCAGCTGGTCGACTTCCCCAACATTTCGATCCGGGCGTCGGAGCTGCAGCTGCCCTTCCAGGCGGCGATG
AAGGTGGAGAAGCTGGGCGACATGATCTTGCGGGCGACGGAGCCGCAGATGGTGCTGTTCAACCTGTACGACGAG
TGGCTCAAGAGCATCTCGTCGTACACGGCCTTCTCGCGGCTGATCCTCATCCTGCGCGCGCTGCACGTCAACCCG
GACAAGACCAAGATGATACTGCGGCCGGACAAGTCGGTCATCACGCTCGACCATCACATCTGGCCGTCGCTGACG
GACGAGGACTGGATCAAGGTGGAGACGCAGCTGCGGGACCTGATCCTGAACGACTACGGCAAGAAGAACAACGTC
AACGTGTCGAGCCTGACGAGCAGCGAAGTGCGGGACATCATCCTGGGCATGGAGATCTCGGCGCCGTCGATGCAG
CGGCAGCAGGCGGCGGAGATTGAGAAGCAGCAGCAGGAGCAGCAGCAGCTGACGGCGGTGACGACGAAGACGCAG
AACGTGCACGGCGAGGACATCATCGTGACGACGACGTCGCAGTTTGAGCAGCAGACGTTTGCGTCCAAGACGGAG
TGGCGGACGCGGGCGATTGCGACGTCGAACCTGCGGGCGCGGACGAAGAACATGTACATCTCGTCGGTGGACAAT
GACGTCGAGGACATGACGTACGTCATGCCCAACAACATCATCCGGCGGTTCATCACGATGGCGGACCTGCGGGTG
CAGGTGGCGGGCTACCTGTACGGGTCGGCGCCGCCGGACAACGAGCAGGTGATGGAGATACGAGCCCGCTGCTGG
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNGCGGCTGCTGGACGCGCACGAGGAGTGGGACAAGACCAACACGGTGACGGTGTCGGTGTCGTTCACGCCC
GGCAGCGTCTCGCTGTCGGCCTGGGGCCTGACGCCGCAGGGCTACAAGTGGGGGGCGGAGAACAGGGACACGCAG
AGCGACCAGCCCCAGGGGTTCACGACGACGATGGGCGAGAAGCGCAAGATGCTGCTGAGCCCGCGCTTCCGGGGC
TTCTTCCTGGTGCCGGAGGACGGGCGGTGGAACTACAGCTTCATGGGCAACGAATTCGCCGGCATGGAGAAGAAG
GCGGTCCCGGTCCGGCTGGACACGCCGCTGCCCTTCTACCACGAGAACCACCGGCCGGTGCACTTCACCAGCTTC
GCGGAGCTCGAGGACATCTGGGTGGACCGGTCGGACAACTTTGAGTAA
Gene >Hirsu2|11273
ATGCCAGCGCCCCCGCCTCCAGGCTATCAACCTCACTCCGACCTCCAGATCGCCAAGTTCGCGCAGAAAAAGAAG
GAATGGCTCCGGAACCAGCGCAACAGATTTGGAGAGAAACGCAAGGCGGGCTTCGTCCAGACGCAAAAGGCCGAC
ATGCCACCCGAACACCTGCGCAAGATCGTCAAGGACATCGGCGACGTCTCCCAGAAGAAGTATACCAACGACAAG
AGGAGCTACCTCGGCGCGCTCAAGTTCATGCCGCACGCCGTCCTGAAGCTTTTGGAGAACATGCCGATGCCGTGG
GAGTCGGCTCGAGAGGTCAAGGTTCTTTACCACGTCAACGGCTGCCTGACCCTGGTGAACGAGATACCTCGGGTC
GTCGAGCCTGTCTTCTTTGCGCAGTGGGCGATGATGTGGACCTTCATGCGCAAGGAAAAGGCCGACAGACGGCTG
TTCAAGCGCATGCGCTTTCCGCCGTTTGATGACGAAGAGCCCCCCCTTTCGTGGTCGGAGAATATCGAGGACGTC
GAGCCCCTCGAGCCCATCCAGATGGAGCTCAACGAAGACGAGGACGAAGCCGTCTATGACTGGTTCTACGACCAT
CGCCCGCTCCTGGACACGTCGCATGTCAACGGTCCAAGCTACAAATCCTGGAACTTGACTTTGCCCCAGATGGCC
GCGCTCTACCGTCTCAGCCGACCGCTCATATCCGACGTCGTGGACAAGAACTACTTCTACCTGTTCGACCTAAAG
AGCTTCCTGACGGCCAAGGCGCTGAACGTGGCCCTCCCCGGAGGACCCAGATTCGAGCCTCTTTACAAGGATATC
GACCCGAACGACGAAGACTTTGGCGAATTCAACGCCATCGACCGCATCATCTTCCGCAACCCTGTCCGCACCGAA
TTCCGAGTCGCTTTCCCCTATCTGTACAACTCGCTACCACGAAGCGTCCGCCTGTCCTGGCACTCATATCCGCAG
GTCGTTTTCAACCGGGCCGATGATCCGGACCTCCCGACCTTCCACTTCGACCGTCGAATCAACCCCATTTCCTCG
CGAACCGTTGCCCCGAAGAACGTGGATGTGTCCCTCGAAGACGAGCTGTTCGGACCCGGCAGCAATGAGGAGTCC
GAGGAGGAGGCGTTCGAGTTGCCCGACGAGATAGACCCCTTCCTGGCCGAAGAGGACCTCGACAGCGAGGAGACC
TCGGCAGCCATCGAGCTGTGGTGGGCGCCATATCCGTTTAACAGGCGCTCTGGCCGAATGGTTCGTGCCCAGGAC
GTGCCGCTGGTCAAGAAGTGGTATCTCGAGCACCCCCCCTCTGATCGGCCGCCCGTCAAAGTTCGAGTCTCGTAC
CAAAAACTTCTCAAAAACTACGTCCTCAACGAGCTTCACAAAAAGGGCCCCAAGGCACAGAACAAGCAAAACCTG
CTGAAGTCGCTGAAACAGACCAAGTTCTTTCAGCAGACCACCATCGACTGGGTCGAGGCAGGCTTGCAGGTCTGC
CGTCAGGGCTTCAACATGTTGAACCTCCTGATTCACCGCAAAAACCTCACATACCTCCACCTTGACTACAATTTC
AACCTGAAGCCCGTCAAGACCCTGACGACCAAGGAGCGAAAGAAATCCAGATTTGGCAATGCCTTCCACCTGATG
CGGGAAATTCTGAGGTTGACCAAGCTGCTTGTGGATGCCCAGGTGCAATACCGCCTGGGTAACATCGACGCCTTC
CAACTTGCCGACGGCATCCTCTACGCCTTTAACCACGTCGGGCAGCTCACGGGAATGTACCGCTACAAATACAAG
CTCATGCACCAGATCAGGACGTGCAAGGACTTGAAGCACCTCATATACTACCGGTTCAACGCCGGCCCCGTCGGA
AAGGGTCCCGGCTGCGGATTCTGGGCCCCCGCCTGGAGGGTGTGGCTGTTCTTCTTGCGAGGCATCATTCCTCTC
CTCGAGCGGTGGCTGGGGAACCTCCTGTCCCGTCAGTTTGAGGGGCGTCACAGCAAGGGCGTCGCCAAGACTGTG
ACGAAGCAGCGCGTCGAGTCCCACTTCGACCTTGAACTGCGCGCCTCAGTCATGGCCGACCTGATGGACATGATG
CCGGAGGGCATCAAGCAGAACAAGGTCAACACGGTGCTCCAGCACCTATCCGAGGCCTGGCGCTGCTGGAAGAGC
AACATTCCGTGGAAGGTGCCTGGCTTGCCGGCGCCCATCGAGAACATCATCCTGCGATACGTCAAGTCCAAGGCC
GATTGGTGGATCTCAGTCGCCCACTACAATCGAGAGAGAATCCGGCGAGGCGCGACCGTGGACAAGACAGTGGCG
AAGAAGAACGTCGGTCGCCTGACGCGACTGTGGCTCAAGGCCGAGCAGGAGCGGCAGCACAACCACATGAAGGAC
GGACCCTATGTCTCGTCGGAGGAGGCCGTGGCCATCTACACCACCACCGTCCACTGGCTGGAGTCAAGGAAGTTC
TCGCCCATCCCCTTCCCCAGTGTCTCGTACAAGCACGACACCAAGATCCTCATCCTCGCGCTGGAGCGCCTGAGA
GAAGCGTACTCCGTCAAGGGTCGTCTCAACCAGAGCCAGAGAGAAGAACTCGCCTTGATAGAGCAGGCCTACGAT
AGCCCGGGCACCACACTCGAGAGGATCAAGCGTTTCTTGCTCACGCAGCGGGCCTTCAAGGAGGTCAACATTGAC
ATGAACGACAACTACAGCACCATCAACCCGGTGTACGACATTGAGCCCATCGAGAAGATCAGCGATGCGTACCTG
GACCAATACCTCTGGTACCAGGCCGACCAGCGACACCTCTTCCCCGCCTGGATCAAGCCGTCCGACTCCGAGGTC
CCGCCGCTGCTGGTGTACAAGTGGGCTCAGGGCATCAACAACCTGAGCCGCGTGTGGGAGACCAAGGACGGCGAG
TGCAACGTCATGATCGAGACAGAACTCTCCAAGGTCTACGAGAAGATGGAGCTCACTCTGCTGAACTCCCTGCTC
AGGCTAATCATGGACCACAATCTGGCCGATTACATCACCGCCAAGAACAACGTCCAGCTGACGTACAAGGATATG
AACCACGTTAATAGTTACGGGATGATCCGTGGCCTGCAGTTCTCTGCCTTCGTCTTCCAGTACTACGGCCTCGTA
CTGGATCTTCTGCTCCTTGGGCCGCAGCGAGCGAGCGAGATTGCTGGCCCCCCCCAGAACCCCAACGATTTCCTC
CAGTTCCGAGACCAGGACACGGAAAGTCGACATCCCATCCGCCTGTACTCGCGCTACATTGACAAGATCTGGGTT
TTCTTGCGCTTCACGGCCGAAGAATCGAGAGACCTCATCCAGCGGTTCCTCACGGAGCAGCCCGATCCGAACTTC
GAGAACGTTATCGGGTACAAGAGCAAGAAGTGCTGGCCCAGGGATTCCCGCATGCGCCTGATGCGGCACGACGTA
AACCTCGGCCGAGCCGTCTTCTGGGATCTCAAGAACCGCCTGCCTCGATCCGTCACCACCATCGACTGGGACGAC
AGCTTCGTCAGCGTCTACAGCCGCGACAACCCCAACTTGCTCTTTTCGATGTGCGGATTCGAAGTTCGGATCCTC
CCCAAGATCAGAAACAAGAACGACGAGTTCCCGGTCAAGGACAGCGTGTGGTCTCTGGTAGACAACACGACGAAG
GAGAGGACTGCATACGCCTTCCTGCAGGTCACCGAGCAGGATATCCAGAAATTCAACAACCGCATCCGGCAGATC
CTCATGTCGTCTGGCTCGACGACCTTCACCAAAATTGCCAACAAGTGGAACACGGCGCTGATTGCGCTGTTCACT
TACTACCGCGAGGCTGCGGTCTCCACCATCGACCTGCTGGACACGATTGTCAAGTGCGAGACCAAGATCCAGACC
AGAGTCAAGATCGGGCTCAACTCGAAGATGCCTTCGCGCTTCCCGCCGGCCGTGTTCTACACGCCCAAGGAACTG
GGTGGCCTGGGCATGATCTCCGGCTCGCATATACTGATTCCCGCGAGCGACAAGCGGTGGTCCAAGCAGACGGAC
ACGGGCGTCACGCACTACCGAGCGGGAATGTCGCACGACGAGGAGACTCTGATCCCCAACATCTTCCGGTACATC
ATCCCGTGGGAGGCCGAGTTCATCGACTCCCAGCGGGTCTGGACGGAGTACTCGCAGAAGCGCCAGGAGGCCAAC
CAGCAGAACCGCCGACTGACGCTCGAGGACCTCGAGGACAGCTGGGACCGCGGTCTTCCCAGGATCAACACGCTG
TTCCAGAAGGACCGGAGCACGCTGAGCTTCGACAAGGGCTTCCGTGCCCGATCCGAGTTCAAGATCTACCAGCTC
ATGAAGAGCAACCCGTTCTGGTGGACCAGCCAGCGACACGACGGAAAGCTGTGGAACCTGAACGCCTACCGGACC
GACGTCATCCAGGCCCTGGGCGGCGTGGAGACCATCCTGGAGCACACCCTCTTCAAGGCTACCGGGTTCCCGTCG
TGGGAGGGTCTCTTCTGGGAGAAGGCGTCCGGGTTCGAGGAGTCGATGAAGTTCAAGAAGTTGACCAACGCGCAG
CGGTCCGGTCTCAACCAGATCCCGAATCGTCGTTTCACCCTCTGGTGGTCGCCAACCATCAACCGCGCCAACGTG
TACGTCGGTTTCCAAGTGCAACTCGATCTGACCGGAATCTTCTTGCATGGCAAGATCCCGACCCTGAAGATTTCT
CTCATCCAAATCTTCCGAGCCCACTTGTGGCAGAAGATTCACGAATCCGTCGTCATGGATCTCTGCCAAGTGTTT
GACCAGGAGCTGGAGTCGCTCGGCATCGAGACGGTGCAGAAGGAGACGATTCACCCGCGCAAATCGTACAAGATG
AACAGCTCGTGCGCGGACATACTCCTGTTCGCCAGCCACAAGTGGAACGTGACGCGGCCGTCGCAGCTCCACGAC
ACCAAGGACGTGATTGAACCGACGACGACGAACAAGTTCTGGATCGACGTGCAGCTGCGGTACGGCGACTACGAC
TCTCACGACATCGAGCGGTATACGCGCGCCAAGTATCTGGACTACACGACCGACAGCGCGAGCATCTACCCGTCG
GCCACCGGGCTCATGATCGGCATCGACCTGGCGTACAACCTGTACGCGGCGTTCGGCATGTACTTCCCCGGACTC
AAGGTGCTCGTGCAGCAGGCCATGGCCAAGATCATGAAGGCCAACCCGGCGCTGTACGTGCTGCGGGAGCGCATC
CGGAAGGGCCTGCAGCTGTATGCGTCCGAGAGCAACCAGGAGTTCCTGAACTCGCAGAACTACTCGGAGCTGTTC
AGCAACCAGATCCAGCTCTTCATCGACGACACCAACGTGTACCGCGTCACCATCCATAAGACGTTCGAGGGCAAT
CTGACGACGAAGCCGATCAACGGGGCCATCTTCATCTTCAACCCGCGGACCGGACAGCTGTTCCTCAAGATCATC
CACACCAGCGTCTGGGCGGGACAGAAGCGCCTGGGCCAGCTGGCCAAGTGGAAGACGGCGGAAGAAGTGGCGGCG
CTGATCCGGTCGCTGCCGGTGGAGGAGCAGCCGAGACAGCTCATCGTGACGCGCAAGGGCCTGCTGGACCCGCTC
GAGGTGCAGCTGGTCGACTTCCCCAACATTTCGATCCGGGCGTCGGAGCTGCAGCTGCCCTTCCAGGCGGCGATG
AAGGTGGAGAAGCTGGGCGACATGATCTTGCGGGCGACGGAGCCGCAGATGGTGCTGTTCAACCTGTACGACGAG
TGGCTCAAGAGCATCTCGTCGTACACGGCCTTCTCGCGGCTGATCCTCATCCTGCGCGCGCTGCACGTCAACCCG
GACAAGACCAAGATGATACTGCGGCCGGACAAGTCGGTCATCACGCTCGACCATCACATCTGGCCGTCGCTGACG
GACGAGGACTGGATCAAGGTGGAGACGCAGCTGCGGGACCTGATCCTGAACGACTACGGCAAGAAGAACAACGTC
AACGTGTCGAGCCTGACGAGCAGCGAAGTGCGGGACATCATCCTGGGCATGGAGATCTCGGCGCCGTCGATGCAG
CGGCAGCAGGCGGCGGAGATTGAGAAGCAGCAGCAGGAGCAGCAGCAGCTGACGGCGGTGACGACGAAGACGCAG
AACGTGCACGGCGAGGACATCATCGTGACGACGACGTCGCAGTTTGAGCAGCAGACGTTTGCGTCCAAGACGGAG
TGGCGGACGCGGGCGATTGCGACGTCGAACCTGCGGGCGCGGACGAAGAACATGTACATCTCGTCGGTGGACAAT
GACGTCGAGGACATGACGTACGTCATGCCCAACAACATCATCCGGCGGTTCATCACGATGGCGGACCTGCGGGTG
CAGGTGGCGGGCTACCTGTACGGGTCGGCGCCGCCGGACAACGAGCAGGTGATGGAGATACGGTGCGTGGTGATG
GTGCCGCAGATCGGGGGCCTGCGCAGCGTGCAGCTGCCGCAGCAGCTTCCGCAGAGCCCGCTGCTGGNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCG
GCTGCTGGACGCGCACGAGGAGTGGGACAAGACCAACACGGTGACGGTGTCGGTGTCGTTCACGCCCGGCAGCGT
CTCGCTGTCGGCCTGGGGCCTGACGCCGCAGGGCTACAAGTGGGGGGCGGAGAACAGGGACACGCAGAGCGACCA
GCCCCAGGGGTTCACGACGACGATGGGCGAGAAGCGCAAGATGCTGCTGAGCCCGCGCTTCCGGGGCTTCTTCCT
GGTGCCGGAGGACGGGCGGTGGAACTACAGCTTCATGGGCAACGAATTCGCCGGCATGGAGAAGAAGGCGGTCCC
GGTCCGGCTGGACACGCCGCTGCCCTTCTACCACGAGAACCACCGGCCGGTGCACTTCACCAGCTTCGCGGAGCT
CGAGGACATCTGGGTGGACCGGTCGGACAACTTTGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail