Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11271
Gene name
LocationContig_998:662..1463
Strand+
Gene length (bp)801
Transcript length (bp)741
Coding sequence length (bp)741
Protein length (aa) 247

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06487 SAP18 Sin3 associated polypeptide p18 (SAP18) 1.5E-41 15 153

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O55128|SAP18_MOUSE Histone deacetylase complex subunit SAP18 OS=Mus musculus GN=Sap18 PE=1 SV=1 15 164 1.0E-09
sp|Q3T022|SAP18_BOVIN Histone deacetylase complex subunit SAP18 OS=Bos taurus GN=SAP18 PE=2 SV=1 15 164 2.0E-09
sp|Q5RDT5|SAP18_PONAB Histone deacetylase complex subunit SAP18 OS=Pongo abelii GN=SAP18 PE=2 SV=1 15 156 3.0E-09
sp|O00422|SAP18_HUMAN Histone deacetylase complex subunit SAP18 OS=Homo sapiens GN=SAP18 PE=1 SV=1 15 156 3.0E-09
sp|Q09250|SAP18_CAEEL Probable histone deacetylase complex subunit SAP18 OS=Caenorhabditis elegans GN=C16C10.4 PE=3 SV=1 15 156 9.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11271
MSSSSEDSGSDRLPAPFLLQLFYRTGAFQRPDEFAAESLPPHISIYTWPDCTLSELAMELAASNPSALPYPAVGT
RLAFQLVYPDIRGAVSGGNASPRYAAKDLGSIVIGQGGPGADTASFGDSNNPLRGDQEVGRTLDDARFVVGDFVS
CAILPPPSDGSVAPASGARRDAGYGMRDARFQRGGYAARENGFGRGAGAGAGSRGLRAGRRDGIGGGARLPMGEW
RRGEALPEMPPARPRGSGGRW*
Coding >Hirsu2|11271
ATGTCCTCCAGCTCCGAAGATAGCGGCAGCGATCGCCTCCCGGCGCCCTTCTTGCTGCAGCTCTTCTACCGGACC
GGCGCCTTCCAGCGGCCGGACGAGTTTGCCGCCGAGTCGCTGCCGCCTCACATATCCATATACACATGGCCGGAC
TGCACGCTCAGCGAGCTGGCGATGGAGCTCGCGGCGTCTAACCCGTCGGCGCTCCCGTACCCTGCCGTCGGCACC
AGACTCGCCTTCCAGCTCGTGTACCCTGACATCCGCGGCGCCGTCTCCGGCGGCAACGCGTCGCCGCGATACGCC
GCCAAGGACCTCGGCAGCATCGTCATCGGGCAGGGCGGGCCGGGCGCCGACACGGCCAGCTTCGGCGACTCCAAC
AACCCGCTGCGGGGCGACCAGGAGGTCGGCAGGACGCTGGACGACGCGCGCTTCGTCGTCGGCGACTTCGTCTCC
TGCGCCATCCTGCCCCCGCCGTCGGACGGTTCGGTGGCGCCGGCGTCCGGCGCCAGGAGAGACGCGGGCTACGGC
ATGCGGGACGCGCGCTTTCAGCGAGGTGGCTATGCCGCGCGCGAGAACGGCTTTGGGCGCGGCGCAGGCGCCGGC
GCCGGCAGTCGCGGCCTCCGAGCCGGACGGAGGGACGGGATCGGAGGCGGCGCGCGGCTGCCGATGGGAGAATGG
AGGCGCGGGGAAGCGTTGCCCGAGATGCCGCCCGCCAGACCGCGAGGGAGCGGCGGCCGCTGGTGA
Transcript >Hirsu2|11271
ATGTCCTCCAGCTCCGAAGATAGCGGCAGCGATCGCCTCCCGGCGCCCTTCTTGCTGCAGCTCTTCTACCGGACC
GGCGCCTTCCAGCGGCCGGACGAGTTTGCCGCCGAGTCGCTGCCGCCTCACATATCCATATACACATGGCCGGAC
TGCACGCTCAGCGAGCTGGCGATGGAGCTCGCGGCGTCTAACCCGTCGGCGCTCCCGTACCCTGCCGTCGGCACC
AGACTCGCCTTCCAGCTCGTGTACCCTGACATCCGCGGCGCCGTCTCCGGCGGCAACGCGTCGCCGCGATACGCC
GCCAAGGACCTCGGCAGCATCGTCATCGGGCAGGGCGGGCCGGGCGCCGACACGGCCAGCTTCGGCGACTCCAAC
AACCCGCTGCGGGGCGACCAGGAGGTCGGCAGGACGCTGGACGACGCGCGCTTCGTCGTCGGCGACTTCGTCTCC
TGCGCCATCCTGCCCCCGCCGTCGGACGGTTCGGTGGCGCCGGCGTCCGGCGCCAGGAGAGACGCGGGCTACGGC
ATGCGGGACGCGCGCTTTCAGCGAGGTGGCTATGCCGCGCGCGAGAACGGCTTTGGGCGCGGCGCAGGCGCCGGC
GCCGGCAGTCGCGGCCTCCGAGCCGGACGGAGGGACGGGATCGGAGGCGGCGCGCGGCTGCCGATGGGAGAATGG
AGGCGCGGGGAAGCGTTGCCCGAGATGCCGCCCGCCAGACCGCGAGGGAGCGGCGGCCGCTGGTGA
Gene >Hirsu2|11271
ATGTCCTCCAGCTCCGAAGATAGCGGCAGCGATCGCCTCCCGGCGCCCTTCTTGCTGCAGCTCTTCTACCGGACC
GGCGCCTTCCAGCGGTAGCTTCTCCCCGGTCTCCCCAGCGATCGTCGAGCCACGCTTACGGGACGAAACCCTAGG
CCGGACGAGTTTGCCGCCGAGTCGCTGCCGCCTCACATATCCATATACACATGGCCGGACTGCACGCTCAGCGAG
CTGGCGATGGAGCTCGCGGCGTCTAACCCGTCGGCGCTCCCGTACCCTGCCGTCGGCACCAGACTCGCCTTCCAG
CTCGTGTACCCTGACATCCGCGGCGCCGTCTCCGGCGGCAACGCGTCGCCGCGATACGCCGCCAAGGACCTCGGC
AGCATCGTCATCGGGCAGGGCGGGCCGGGCGCCGACACGGCCAGCTTCGGCGACTCCAACAACCCGCTGCGGGGC
GACCAGGAGGTCGGCAGGACGCTGGACGACGCGCGCTTCGTCGTCGGCGACTTCGTCTCCTGCGCCATCCTGCCC
CCGCCGTCGGACGGTTCGGTGGCGCCGGCGTCCGGCGCCAGGAGAGACGCGGGCTACGGCATGCGGGACGCGCGC
TTTCAGCGAGGTGGCTATGCCGCGCGCGAGAACGGCTTTGGGCGCGGCGCAGGCGCCGGCGCCGGCAGTCGCGGC
CTCCGAGCCGGACGGAGGGACGGGATCGGAGGCGGCGCGCGGCTGCCGATGGGAGAATGGAGGCGCGGGGAAGCG
TTGCCCGAGATGCCGCCCGCCAGACCGCGAGGGAGCGGCGGCCGCTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail