Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11253
Gene name
LocationContig_994:977..1661
Strand-
Gene length (bp)684
Transcript length (bp)606
Coding sequence length (bp)606
Protein length (aa) 202

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74903|YCS3_SCHPO Uncharacterized calcium-binding protein C613.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC613.03 PE=3 SV=1 32 199 1.0E-28
sp|P39931|SS120_YEAST Protein SSP120 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSP120 PE=1 SV=1 34 163 3.0E-17

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11253
MRASLRLALAALAGLALAHGDHSQKPLVDEQADWMTKHMAEEHHMTSWDADSFFTLHDYNGDNLWQPDELQRTYG
LMDPSNKDMAAERKAQVSRDLMALLDHDGDGLVSRAEWSAFLAQGKTLPDLGTGPGHHGDDEYEYEIHHWEKYHD
ENTKLEDLTHPEDIEHFKKHEQEEREQEALEAMDKKAIVEENIPSKFRRRD*
Coding >Hirsu2|11253
ATGCGCGCGTCCCTCCGCCTGGCCCTCGCGGCCCTCGCCGGCCTCGCCCTCGCCCACGGCGATCACTCCCAGAAG
CCGCTGGTGGACGAGCAGGCCGACTGGATGACCAAGCACATGGCCGAGGAGCACCACATGACTAGCTGGGATGCC
GACTCCTTCTTCACCCTGCACGACTACAACGGCGACAATCTGTGGCAGCCCGACGAGCTGCAGCGCACCTACGGC
CTCATGGACCCGTCCAACAAGGATATGGCGGCCGAGCGCAAGGCGCAGGTCTCGCGAGACCTGATGGCCCTGCTG
GACCACGACGGCGACGGCCTCGTCTCCCGCGCCGAGTGGTCTGCCTTCCTGGCCCAGGGCAAGACGCTGCCCGAC
CTGGGCACCGGCCCCGGCCACCACGGCGACGACGAGTACGAGTACGAGATCCATCACTGGGAGAAGTACCACGAC
GAGAACACCAAGCTCGAGGACCTGACCCACCCCGAGGACATCGAGCACTTCAAGAAGCACGAGCAGGAGGAGAGG
GAACAGGAGGCGCTCGAGGCCATGGACAAGAAGGCCATCGTCGAGGAGAACATCCCCAGCAAGTTCCGCCGGCGG
GACTAG
Transcript >Hirsu2|11253
ATGCGCGCGTCCCTCCGCCTGGCCCTCGCGGCCCTCGCCGGCCTCGCCCTCGCCCACGGCGATCACTCCCAGAAG
CCGCTGGTGGACGAGCAGGCCGACTGGATGACCAAGCACATGGCCGAGGAGCACCACATGACTAGCTGGGATGCC
GACTCCTTCTTCACCCTGCACGACTACAACGGCGACAATCTGTGGCAGCCCGACGAGCTGCAGCGCACCTACGGC
CTCATGGACCCGTCCAACAAGGATATGGCGGCCGAGCGCAAGGCGCAGGTCTCGCGAGACCTGATGGCCCTGCTG
GACCACGACGGCGACGGCCTCGTCTCCCGCGCCGAGTGGTCTGCCTTCCTGGCCCAGGGCAAGACGCTGCCCGAC
CTGGGCACCGGCCCCGGCCACCACGGCGACGACGAGTACGAGTACGAGATCCATCACTGGGAGAAGTACCACGAC
GAGAACACCAAGCTCGAGGACCTGACCCACCCCGAGGACATCGAGCACTTCAAGAAGCACGAGCAGGAGGAGAGG
GAACAGGAGGCGCTCGAGGCCATGGACAAGAAGGCCATCGTCGAGGAGAACATCCCCAGCAAGTTCCGCCGGCGG
GACTAG
Gene >Hirsu2|11253
ATGCGCGCGTCCCTCCGCCTGGCCCTCGCGGCCCTCGCCGGCCTCGCCCTCGCCCACGGCGATCACTCCCAGAAG
CCGCTGGTGGACGAGCAGGCCGACTGGATGACCAAGCACATGGCCGGCATGTCTCACCCTCTCCCCCTTACCTCC
CCTTGCCTCTCGTTCGTTCTGCGCTGACCCTCGTGTCTCTGGCCGGCAGAGGAGCACCACATGACTAGCTGGGAT
GCCGACTCCTTCTTCACCCTGCACGACTACAACGGCGACAATCTGTGGCAGCCCGACGAGCTGCAGCGCACCTAC
GGCCTCATGGACCCGTCCAACAAGGATATGGCGGCCGAGCGCAAGGCGCAGGTCTCGCGAGACCTGATGGCCCTG
CTGGACCACGACGGCGACGGCCTCGTCTCCCGCGCCGAGTGGTCTGCCTTCCTGGCCCAGGGCAAGACGCTGCCC
GACCTGGGCACCGGCCCCGGCCACCACGGCGACGACGAGTACGAGTACGAGATCCATCACTGGGAGAAGTACCAC
GACGAGAACACCAAGCTCGAGGACCTGACCCACCCCGAGGACATCGAGCACTTCAAGAAGCACGAGCAGGAGGAG
AGGGAACAGGAGGCGCTCGAGGCCATGGACAAGAAGGCCATCGTCGAGGAGAACATCCCCAGCAAGTTCCGCCGG
CGGGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail