Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11251
Gene name
LocationContig_993:9540..9955
Strand-
Gene length (bp)415
Transcript length (bp)357
Coding sequence length (bp)357
Protein length (aa) 119

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17667 Pkinase_fungal Fungal protein kinase 2.2E-13 10 59
PF17667 Pkinase_fungal Fungal protein kinase 6.0E-10 64 118

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus|Extracellular 0.2903 0.6175 0.6562 0.2852 0.0816 0.0129 0.0417 0.2168 0.1204 0.0061

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup689
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6785
Ophiocordyceps australis map64 (Brazil) OphauB2|3224
Ophiocordyceps australis map64 (Brazil) OphauB2|5420
Ophiocordyceps australis map64 (Brazil) OphauB2|5434
Ophiocordyceps kimflemingae Ophio5|6154
Ophiocordyceps subramaniannii Hirsu2|11251 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11251
MLRGAEDSLVVAGELKSNSKADTASIAWIDLARYAREVLAAQDTRRFVLGFTLCGSLMRNGGFQFVTTILGFLRM
NEEELGFDPTIVKSNGERYIKIERGGQTERLIVDEVMKRARCI*
Coding >Hirsu2|11251
ATGCTGCGAGGGGCCGAGGACTCTCTCGTCGTTGCTGGCGAACTGAAAAGCAACTCGAAGGCCGACACAGCGTCG
ATTGCATGGATTGATTTAGCGAGGTATGCGAGGGAGGTGCTCGCCGCTCAAGATACCCGTCGCTTCGTCTTGGGC
TTTACTCTCTGCGGATCTCTTATGAGGAATGGCGGGTTCCAGTTTGTGACCACAATCCTCGGGTTTTTGCGGATG
AACGAGGAGGAGCTTGGGTTTGACCCTACCATTGTCAAGTCCAACGGCGAACGGTATATCAAGATCGAGCGAGGC
GGCCAGACAGAGCGCCTCATCGTTGACGAGGTCATGAAGCGTGCACGATGTATTTAG
Transcript >Hirsu2|11251
ATGCTGCGAGGGGCCGAGGACTCTCTCGTCGTTGCTGGCGAACTGAAAAGCAACTCGAAGGCCGACACAGCGTCG
ATTGCATGGATTGATTTAGCGAGGTATGCGAGGGAGGTGCTCGCCGCTCAAGATACCCGTCGCTTCGTCTTGGGC
TTTACTCTCTGCGGATCTCTTATGAGGAATGGCGGGTTCCAGTTTGTGACCACAATCCTCGGGTTTTTGCGGATG
AACGAGGAGGAGCTTGGGTTTGACCCTACCATTGTCAAGTCCAACGGCGAACGGTATATCAAGATCGAGCGAGGC
GGCCAGACAGAGCGCCTCATCGTTGACGAGGTCATGAAGCGTGCACGATGTATTTAG
Gene >Hirsu2|11251
ATGCTGCGAGGGGCCGAGGACTCTCTCGTCGTTGCTGGCGAACTGAAAAGCAACTCGAAGGCCGACACAGCGTCG
ATTGCATGGATTGATTTAGCGAGGTATGCGAGGGAGGTGCTCGCCGCTCAAGATACCCGTCGCTTCGTCTTGGGC
TTTACTCTCTGCGGATCTCTTATGAGGGTATGGGAGTTCGACCGGCTTGGAGGGAATCGCCTCCGAACAATTCGA
CATCAACAAGAATGGCGGGTTCCAGTTTGTGACCACAATCCTCGGGTTTTTGCGGATGAACGAGGAGGAGCTTGG
GTTTGACCCTACCATTGTCAAGTCCAACGGCGAACGGTATATCAAGATCGAGCGAGGCGGCCAGACAGAGCGCCT
CATCGTTGACGAGGTCATGAAGCGTGCACGATGTATTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail