Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1124
Gene name
LocationContig_1238:167..2090
Strand+
Gene length (bp)1923
Transcript length (bp)1530
Coding sequence length (bp)1530
Protein length (aa) 510

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00487 FA_desaturase Fatty acid desaturase 2.5E-29 193 468

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6CMK7|SLD1_KLULA Delta 8-(E)-sphingolipid desaturase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SLD PE=3 SV=1 1 509 3.0E-131
sp|Q8NKG8|SLD1_KLULC Delta 8-(E)-sphingolipid desaturase OS=Kluyveromyces lactis GN=SLD PE=1 SV=1 1 509 8.0E-130
sp|Q8NKG9|SLD1_LACK1 Delta 8-(E)-sphingolipid desaturase OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=SLD PE=1 SV=1 1 505 6.0E-125
sp|Q5AEK8|SLD1_CANAL Delta 8-(E)-sphingolipid desaturase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SLD1 PE=1 SV=1 4 499 3.0E-121
sp|C4QVU3|SLD1_PICPG Delta 8-(E)-sphingolipid desaturase OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAS_chr1-1_0013 PE=3 SV=1 1 496 4.0E-110
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6CMK7|SLD1_KLULA Delta 8-(E)-sphingolipid desaturase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SLD PE=3 SV=1 1 509 3.0E-131
sp|Q8NKG8|SLD1_KLULC Delta 8-(E)-sphingolipid desaturase OS=Kluyveromyces lactis GN=SLD PE=1 SV=1 1 509 8.0E-130
sp|Q8NKG9|SLD1_LACK1 Delta 8-(E)-sphingolipid desaturase OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=SLD PE=1 SV=1 1 505 6.0E-125
sp|Q5AEK8|SLD1_CANAL Delta 8-(E)-sphingolipid desaturase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SLD1 PE=1 SV=1 4 499 3.0E-121
sp|C4QVU3|SLD1_PICPG Delta 8-(E)-sphingolipid desaturase OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAS_chr1-1_0013 PE=3 SV=1 1 496 4.0E-110
sp|Q43469|SLD1_HELAN Delta(8)-fatty-acid desaturase OS=Helianthus annuus GN=sld1 PE=1 SV=1 132 495 7.0E-64
sp|Q3EBF7|SLD2_ARATH Delta(8)-fatty-acid desaturase 2 OS=Arabidopsis thaliana GN=SLD2 PE=1 SV=1 54 491 2.0E-58
sp|Q9FR82|SLD1_BOROF Delta(8)-fatty-acid desaturase OS=Borago officinalis GN=sld1 PE=1 SV=1 106 493 2.0E-52
sp|Q9ZRP7|SLD1_ARATH Delta(8)-fatty-acid desaturase 1 OS=Arabidopsis thaliana GN=SLD1 PE=1 SV=1 196 491 5.0E-51
sp|Q23221|FAT3_CAEEL Delta(6)-fatty-acid desaturase fat-3 OS=Caenorhabditis elegans GN=fat-3 PE=2 SV=2 141 491 8.0E-40
sp|G5EG11|FAT4_CAEEL Delta(5) fatty acid desaturase fat-4 OS=Caenorhabditis elegans GN=fat-4 PE=2 SV=1 146 495 3.0E-33
sp|Q9SWQ9|SLD1_EUGGR Delta(8)-fatty-acid desaturase OS=Euglena gracilis GN=efd1 PE=1 SV=1 132 467 7.0E-23
sp|Q4G2T3|DESAT_THAPS Sphingolipid 10-desaturase OS=Thalassiosira pseudonana GN=desA PE=1 SV=2 193 486 2.0E-17
sp|Q9DEX7|FADS2_DANRE Fatty acid desaturase 2 OS=Danio rerio GN=fads2 PE=2 SV=1 136 467 2.0E-16
sp|A4KDP0|D5FAD_REBSA Acyl-lipid (8-3)-desaturase OS=Rebecca salina GN=D5Des PE=1 SV=1 146 487 3.0E-16
sp|Q9JJE7|FADS3_MOUSE Fatty acid desaturase 3 OS=Mus musculus GN=Fads3 PE=2 SV=2 134 488 6.0E-16
sp|Q9Y5Q0|FADS3_HUMAN Fatty acid desaturase 3 OS=Homo sapiens GN=FADS3 PE=2 SV=1 134 488 1.0E-15
sp|A4KDP1|D8FAD_REBSA Acyl-lipid 8-desaturase OS=Rebecca salina GN=D8Des PE=2 SV=1 124 467 2.0E-15
sp|A4IFP3|FADS3_BOVIN Fatty acid desaturase 3 OS=Bos taurus GN=FADS3 PE=2 SV=1 134 488 3.0E-15
sp|Q9Z0R9|FADS2_MOUSE Fatty acid desaturase 2 OS=Mus musculus GN=Fads2 PE=1 SV=1 86 491 7.0E-15
sp|Q0VAX3|FS2P1_MOUSE Fatty acid desaturase 2-like protein FADS2P1 OS=Mus musculus GN=Fads2p1 PE=2 SV=1 78 491 8.0E-15
sp|Q8K1P9|FADS3_RAT Fatty acid desaturase 3 OS=Rattus norvegicus GN=Fads3 PE=2 SV=1 134 488 1.0E-14
sp|Q9Z122|FADS2_RAT Fatty acid desaturase 2 OS=Rattus norvegicus GN=Fads2 PE=2 SV=1 86 491 1.0E-14
sp|A4UVI1|FADS1_PAPAN Fatty acid desaturase 1 OS=Papio anubis GN=FADS1 PE=1 SV=1 134 491 3.0E-14
sp|O60427|FADS1_HUMAN Fatty acid desaturase 1 OS=Homo sapiens GN=FADS1 PE=1 SV=3 134 491 2.0E-13
sp|A4FV48|FADS2_BOVIN Fatty acid desaturase 2 OS=Bos taurus GN=FADS2 PE=2 SV=1 136 490 5.0E-12
sp|Q4R749|FADS2_MACFA Fatty acid desaturase 2 OS=Macaca fascicularis GN=FADS2 PE=2 SV=1 136 467 2.0E-11
sp|Q920L1|FADS1_MOUSE Fatty acid desaturase 1 OS=Mus musculus GN=Fads1 PE=1 SV=1 134 467 3.0E-11
sp|O95864|FADS2_HUMAN Fatty acid desaturase 2 OS=Homo sapiens GN=FADS2 PE=1 SV=1 136 467 4.0E-11
sp|Q5REA7|FADS2_PONAB Fatty acid desaturase 2 OS=Pongo abelii GN=FADS2 PE=2 SV=1 136 467 5.0E-11
sp|Q8S3C1|D5FAD_THRSP Acyl-lipid (8-3)-desaturase OS=Thraustochytrium sp. GN=Fad5 PE=1 SV=1 63 497 7.0E-11
sp|A8MWK0|FS2P1_HUMAN Putative fatty acid desaturase 2-like protein FADS2P1 OS=Homo sapiens GN=FADS2P1 PE=5 SV=2 209 491 1.0E-09
sp|Q08871|LLCD_SYNY3 Acyl-CoA 6-desaturase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=des6 PE=4 SV=1 210 469 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 180 202 22
2 222 244 22
3 305 327 22
4 347 366 19
5 373 395 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1124
MRAYRIGRKPTGPWANMTPPIRGGHFRRLDTLSPCLPPHDMGGAGAAAAPGLLVPDQADAAWDASSDMSATSSSD
LERAVRRRPPGKPAADRIRAGGLAAESDDDDEAPALIGRCPATYTDWAVQQGVEQGLRDYPSLDPAVQQGIVDSY
RALHRRVVDEGLYDCPYREYAKEMARYTCLFAAFLVALHHAWYLTSAVFLGLFWHQIMFTAHDAGHRAISQIFVV
DTLIGMFIADFCCGLSIGWWKSSHNVHHLVTNQPEHDPDIQNVPLFATCPSFFKSLTSTYYNFRFVWDAAADALV
PFQKYTYYPVMGIARFNLYLLSWLHVLSPKASALSLSSAWWIRPTEIAFMSCYWFLFGYCLLLRTLPTWPIRVAF
VLVSHIVTMPLHVQITLSHWGMSTAHLGESESFAQRQLRTTMDVDCPPWLDFVHGGLQFQAVHHLFPRLPRHNLR
RAQVLTREFCQKTGVPYTILGFVDGNQKVLGRLQDVSDQLKILVKCQKYMAETGESGLH*
Coding >Hirsu2|1124
ATGAGGGCCTACCGGATCGGCCGGAAGCCAACGGGGCCCTGGGCCAACATGACGCCGCCAATAAGAGGCGGCCAC
TTCCGCCGCCTCGACACCCTCTCGCCCTGCCTGCCGCCGCACGACATGGGTGGCGCCGGTGCCGCGGCTGCGCCT
GGTCTCCTCGTACCCGACCAGGCCGACGCCGCCTGGGACGCCTCGTCTGACATGTCGGCCACCAGCTCGTCCGAC
CTCGAGCGCGCCGTCCGCCGGCGGCCCCCCGGGAAGCCGGCCGCGGACCGGATCCGCGCCGGGGGCCTGGCTGCC
GAGAGCGACGACGACGACGAGGCGCCCGCTCTCATCGGCCGCTGTCCCGCCACCTACACCGACTGGGCCGTCCAG
CAGGGCGTCGAGCAGGGCCTGCGCGACTATCCGTCCCTCGACCCGGCCGTGCAGCAGGGCATCGTCGACAGCTAC
CGCGCCCTGCACCGGAGGGTCGTCGACGAGGGGCTCTACGACTGTCCCTACCGCGAGTACGCCAAGGAGATGGCA
CGCTACACCTGCCTGTTCGCTGCCTTTCTCGTGGCCTTGCACCACGCTTGGTACCTGACCTCGGCCGTCTTTCTT
GGCCTGTTCTGGCATCAGATCATGTTCACGGCCCACGACGCCGGCCATCGGGCCATCAGCCAGATCTTCGTCGTC
GACACCCTCATCGGCATGTTCATCGCCGACTTCTGCTGCGGCCTGTCCATCGGATGGTGGAAGAGCAGCCACAAC
GTCCACCACCTCGTCACCAACCAACCGGAGCATGATCCGGATATCCAGAACGTCCCCCTCTTCGCCACCTGCCCT
TCGTTCTTCAAGTCCCTCACCTCGACCTACTACAACTTCCGCTTCGTCTGGGACGCCGCGGCCGACGCCCTGGTG
CCCTTCCAGAAATACACCTACTACCCCGTCATGGGCATCGCCCGCTTCAACCTCTACCTGCTCTCCTGGCTGCAC
GTGCTGTCGCCCAAGGCGTCGGCCCTGTCCCTGAGCTCGGCCTGGTGGATCCGGCCGACCGAGATCGCCTTCATG
TCCTGCTACTGGTTCCTCTTCGGCTACTGCCTGCTGCTGCGCACGCTGCCGACCTGGCCGATCCGCGTCGCCTTC
GTCCTCGTCTCGCACATCGTCACCATGCCGCTGCACGTCCAGATCACGCTGTCGCACTGGGGCATGTCGACGGCC
CACCTCGGCGAGTCCGAGTCCTTCGCCCAGCGACAGCTGCGCACCACCATGGACGTCGACTGCCCGCCCTGGCTC
GACTTCGTCCACGGCGGCCTGCAGTTCCAGGCCGTCCACCACCTGTTCCCCCGCCTGCCGCGCCACAACCTGCGC
AGGGCCCAGGTCCTGACCCGCGAGTTTTGCCAGAAGACGGGCGTCCCGTATACCATCTTGGGTTTCGTCGACGGC
AACCAAAAGGTGCTCGGTCGGCTGCAGGACGTGAGCGACCAGCTCAAGATACTCGTCAAGTGCCAGAAGTACATG
GCCGAGACTGGAGAGAGCGGATTGCACTGA
Transcript >Hirsu2|1124
ATGAGGGCCTACCGGATCGGCCGGAAGCCAACGGGGCCCTGGGCCAACATGACGCCGCCAATAAGAGGCGGCCAC
TTCCGCCGCCTCGACACCCTCTCGCCCTGCCTGCCGCCGCACGACATGGGTGGCGCCGGTGCCGCGGCTGCGCCT
GGTCTCCTCGTACCCGACCAGGCCGACGCCGCCTGGGACGCCTCGTCTGACATGTCGGCCACCAGCTCGTCCGAC
CTCGAGCGCGCCGTCCGCCGGCGGCCCCCCGGGAAGCCGGCCGCGGACCGGATCCGCGCCGGGGGCCTGGCTGCC
GAGAGCGACGACGACGACGAGGCGCCCGCTCTCATCGGCCGCTGTCCCGCCACCTACACCGACTGGGCCGTCCAG
CAGGGCGTCGAGCAGGGCCTGCGCGACTATCCGTCCCTCGACCCGGCCGTGCAGCAGGGCATCGTCGACAGCTAC
CGCGCCCTGCACCGGAGGGTCGTCGACGAGGGGCTCTACGACTGTCCCTACCGCGAGTACGCCAAGGAGATGGCA
CGCTACACCTGCCTGTTCGCTGCCTTTCTCGTGGCCTTGCACCACGCTTGGTACCTGACCTCGGCCGTCTTTCTT
GGCCTGTTCTGGCATCAGATCATGTTCACGGCCCACGACGCCGGCCATCGGGCCATCAGCCAGATCTTCGTCGTC
GACACCCTCATCGGCATGTTCATCGCCGACTTCTGCTGCGGCCTGTCCATCGGATGGTGGAAGAGCAGCCACAAC
GTCCACCACCTCGTCACCAACCAACCGGAGCATGATCCGGATATCCAGAACGTCCCCCTCTTCGCCACCTGCCCT
TCGTTCTTCAAGTCCCTCACCTCGACCTACTACAACTTCCGCTTCGTCTGGGACGCCGCGGCCGACGCCCTGGTG
CCCTTCCAGAAATACACCTACTACCCCGTCATGGGCATCGCCCGCTTCAACCTCTACCTGCTCTCCTGGCTGCAC
GTGCTGTCGCCCAAGGCGTCGGCCCTGTCCCTGAGCTCGGCCTGGTGGATCCGGCCGACCGAGATCGCCTTCATG
TCCTGCTACTGGTTCCTCTTCGGCTACTGCCTGCTGCTGCGCACGCTGCCGACCTGGCCGATCCGCGTCGCCTTC
GTCCTCGTCTCGCACATCGTCACCATGCCGCTGCACGTCCAGATCACGCTGTCGCACTGGGGCATGTCGACGGCC
CACCTCGGCGAGTCCGAGTCCTTCGCCCAGCGACAGCTGCGCACCACCATGGACGTCGACTGCCCGCCCTGGCTC
GACTTCGTCCACGGCGGCCTGCAGTTCCAGGCCGTCCACCACCTGTTCCCCCGCCTGCCGCGCCACAACCTGCGC
AGGGCCCAGGTCCTGACCCGCGAGTTTTGCCAGAAGACGGGCGTCCCGTATACCATCTTGGGTTTCGTCGACGGC
AACCAAAAGGTGCTCGGTCGGCTGCAGGACGTGAGCGACCAGCTCAAGATACTCGTCAAGTGCCAGAAGTACATG
GCCGAGACTGGAGAGAGCGGATTGCACTGA
Gene >Hirsu2|1124
ATGAGGGCCTACCGGATCGGCCGGAAGCCAACGGGGCCCTGGGCCAACATGACGCCGCCAATAAGAGGCGGCCAC
TTCCGCCGCCTCGACACCCTCTCGCCCTGCCTGCCGCCGCACGACATGGGTGGCGCCGGTGCCGCGGCTGCGCCT
GGTCTCCTCGTACCCGACCAGGCCGACGCCGCCTGGGACGCCTCGTCTGACATGTCGGCCACCAGCTCGTCCGAC
CTCGAGCGCGCCGTCCGCCGGCGGCCCCCCGGGAAGCCGGCCGCGGACCGGATCCGCGCCGGGGGCCTGGCTGCC
GAGAGCGACGACGACGACGAGGCGCCCGCTCTCATCGGCCGCTGTCCCGCCACCTACACCGACTGGGCCGTCCAG
CAGGGCGTCGAGCAGGGCCTGCGCGACTATCCGTCCCTCGACCCGGCCGTGCAGCAGGGCATCGTCGACAGCTAC
CGCGCCCTGCACCGGAGGGTCGTCGACGAGGGGCTCTACGACTGTCCCTACCGCGAGTACGCCAAGGAGATGGCA
CGCTACACCTGCCTGTTCGCTGCCTTTCTCGTGGCCTTGCACCACGCTTGGTACCTGACCTCGGCCGTCTTTCTT
GGCCTGTTCTGGGTACTTTTTTTTTCCTTTTTTTTNNNNNNNNNNNNNTTTTTTTTTTTCTCTTTCCCCTTTCAG
TCTCTCCTTACCTTAGACACACCCGTTCTCTTTTTCGTCTGGCCTCGAGCAGCACGCCTTTCTTTTCCCGTCTGG
TCTCGAGAACACCTCTTTCTTTTTCTTTCTGCCTCATCCCTTCAAACTACCTCCCCCTTGCTTGGCTGTCGATGT
CTTGGACCCTTGTCCCTTGTCGTGCTGTGCCATGGCCTCTCACACACTCGACAGCATCAGATCATGTTCACGGCC
CACGACGCCGGCCATCGGGCCATCAGCCAGATCTTCGTCGTCGACACCCTCATCGGCATGTTCATCGCCGACTTC
TGCTGCGGCCTGTCCATCGGATGGTGGAAGAGCAGCCACAACGTCCACCACCTCGTCACCAACCAACCGGTACGT
TCTTGTTTCTCTCCCTCCCATCGAACCCCATCATCGCCCCAGCCTCCTGNNCCCCCCCCTTCCTCTCAACTGCGC
TGTCATGAGTGGCAGTGGCTGATGCCTGTTTCTTCGGGCGCGCAGGAGCATGATCCGGATATCCAGAACGTCCCC
CTCTTCGCCACCTGCCCTTCGTTCTTCAAGTCCCTCACCTCGACCTACTACAACTTCCGCTTCGTCTGGGACGCC
GCGGCCGACGCCCTGGTGCCCTTCCAGAAATACACCTACTACCCCGTCATGGGCATCGCCCGCTTCAACCTCTAC
CTGCTCTCCTGGCTGCACGTGCTGTCGCCCAAGGCGTCGGCCCTGTCCCTGAGCTCGGCCTGGTGGATCCGGCCG
ACCGAGATCGCCTTCATGTCCTGCTACTGGTTCCTCTTCGGCTACTGCCTGCTGCTGCGCACGCTGCCGACCTGG
CCGATCCGCGTCGCCTTCGTCCTCGTCTCGCACATCGTCACCATGCCGCTGCACGTCCAGATCACGCTGTCGCAC
TGGGGCATGTCGACGGCCCACCTCGGCGAGTCCGAGTCCTTCGCCCAGCGACAGCTGCGCACCACCATGGACGTC
GACTGCCCGCCCTGGCTCGACTTCGTCCACGGCGGCCTGCAGTTCCAGGCCGTCCACCACCTGTTCCCCCGCCTG
CCGCGCCACAACCTGCGCAGGGCCCAGGTCCTGACCCGCGAGTTTTGCCAGAAGACGGGCGTCCCGTATACCATC
TTGGGTTTCGTCGACGGCAACCAAAAGGTGCTCGGTCGGCTGCAGGACGTGAGCGACCAGCTCAAGATACTCGTC
AAGTGCCAGAAGTACATGGCCGAGACTGGAGAGAGCGGATTGCACTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail