Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11239
Gene name
LocationContig_991:1301..5461
Strand-
Gene length (bp)4160
Transcript length (bp)4101
Coding sequence length (bp)4101
Protein length (aa) 1367

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 3.4E-50 951 1247
PF07714 Pkinase_Tyr Protein tyrosine kinase 1.5E-18 953 1159

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09690|POM1_SCHPO Dual specificity protein kinase pom1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pom1 PE=1 SV=1 826 1283 7.0E-172
sp|Q9V3D5|DYRK2_DROME Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Drosophila melanogaster GN=Dyrk2 PE=1 SV=1 925 1247 1.0E-136
sp|Q09815|PPK5_SCHPO Serine/threonine-protein kinase ppk5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk5 PE=1 SV=1 865 1257 2.0E-135
sp|Q8BI55|DYRK4_MOUSE Dual specificity tyrosine-phosphorylation-regulated kinase 4 OS=Mus musculus GN=Dyrk4 PE=2 SV=1 897 1247 2.0E-134
sp|Q9NR20|DYRK4_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 4 OS=Homo sapiens GN=DYRK4 PE=1 SV=2 859 1273 1.0E-132
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09690|POM1_SCHPO Dual specificity protein kinase pom1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pom1 PE=1 SV=1 826 1283 7.0E-172
sp|Q9V3D5|DYRK2_DROME Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Drosophila melanogaster GN=Dyrk2 PE=1 SV=1 925 1247 1.0E-136
sp|Q09815|PPK5_SCHPO Serine/threonine-protein kinase ppk5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk5 PE=1 SV=1 865 1257 2.0E-135
sp|Q8BI55|DYRK4_MOUSE Dual specificity tyrosine-phosphorylation-regulated kinase 4 OS=Mus musculus GN=Dyrk4 PE=2 SV=1 897 1247 2.0E-134
sp|Q9NR20|DYRK4_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 4 OS=Homo sapiens GN=DYRK4 PE=1 SV=2 859 1273 1.0E-132
sp|Q92630|DYRK2_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Homo sapiens GN=DYRK2 PE=1 SV=3 859 1269 3.0E-125
sp|Q5U4C9|DYRK2_MOUSE Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Mus musculus GN=Dyrk2 PE=2 SV=1 859 1269 6.0E-125
sp|Q54BC9|DYRK2_DICDI Probable serine/threonine-protein kinase dyrk2 OS=Dictyostelium discoideum GN=dyrk2 PE=3 SV=1 883 1257 2.0E-124
sp|Q5ZIU3|DYRK2_CHICK Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Gallus gallus GN=DYRK2 PE=2 SV=1 883 1269 6.0E-123
sp|Q4V8A3|DYRK3_RAT Dual specificity tyrosine-phosphorylation-regulated kinase 3 OS=Rattus norvegicus GN=Dyrk3 PE=2 SV=1 894 1255 1.0E-122
sp|Q922Y0|DYRK3_MOUSE Dual specificity tyrosine-phosphorylation-regulated kinase 3 OS=Mus musculus GN=Dyrk3 PE=1 SV=1 894 1269 3.0E-121
sp|O43781|DYRK3_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 3 OS=Homo sapiens GN=DYRK3 PE=2 SV=3 894 1248 4.0E-121
sp|Q4R6S5|DYRK3_MACFA Dual specificity tyrosine-phosphorylation-regulated kinase 3 OS=Macaca fascicularis GN=DYRK3 PE=2 SV=1 894 1269 1.0E-120
sp|A8WJR8|MBK2_CAEBR Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 OS=Caenorhabditis briggsae GN=mbk-2 PE=3 SV=2 897 1247 1.0E-117
sp|Q9XTF3|MBK2_CAEEL Dual specificity tyrosine-phosphorylation-regulated kinase mbk-2 OS=Caenorhabditis elegans GN=mbk-2 PE=1 SV=1 897 1247 1.0E-117
sp|P83102|DYRK3_DROME Putative dual specificity tyrosine-phosphorylation-regulated kinase 3 homolog OS=Drosophila melanogaster GN=Dyrk3 PE=1 SV=3 883 1247 2.0E-109
sp|Q76NV1|DYRK1_DICDI Probable serine/threonine-protein kinase dyrk1 OS=Dictyostelium discoideum GN=dyrk1 PE=3 SV=1 929 1247 3.0E-89
sp|P49657|MNB_DROME Serine/threonine-protein kinase minibrain OS=Drosophila melanogaster GN=mnb PE=2 SV=2 929 1247 5.0E-87
sp|Q9Z188|DYR1B_MOUSE Dual specificity tyrosine-phosphorylation-regulated kinase 1B OS=Mus musculus GN=Dyrk1b PE=1 SV=3 929 1247 7.0E-84
sp|Q9Y463|DYR1B_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 1B OS=Homo sapiens GN=DYRK1B PE=1 SV=1 929 1247 2.0E-83
sp|Q9P6P3|PPK15_SCHPO Serine/threonine-protein kinase ppk15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk15 PE=1 SV=1 875 1249 4.0E-82
sp|Q13627|DYR1A_HUMAN Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Homo sapiens GN=DYRK1A PE=1 SV=2 944 1247 4.0E-80
sp|Q63470|DYR1A_RAT Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Rattus norvegicus GN=Dyrk1a PE=1 SV=2 944 1247 5.0E-80
sp|Q61214|DYR1A_MOUSE Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Mus musculus GN=Dyrk1a PE=1 SV=1 944 1247 5.0E-80
sp|Q8WQL7|MBK1_CAEEL Dual specificity tyrosine-phosphorylation-regulated kinase mbk-1 OS=Caenorhabditis elegans GN=mbk-1 PE=1 SV=1 929 1335 7.0E-79
sp|Q0IJ08|DYR1A_XENTR Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Xenopus tropicalis GN=dyrk1a PE=2 SV=1 944 1247 8.0E-79
sp|Q2TAE3|DYR1A_XENLA Dual specificity tyrosine-phosphorylation-regulated kinase 1A OS=Xenopus laevis GN=dyrk1a PE=2 SV=1 944 1247 6.0E-78
sp|P14680|YAK1_YEAST Dual specificity protein kinase YAK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YAK1 PE=1 SV=1 877 1337 9.0E-76
sp|Q54QV3|YAKA_DICDI Probable serine/threonine-protein kinase yakA OS=Dictyostelium discoideum GN=yakA PE=1 SV=1 893 1291 1.0E-74
sp|A8X4H1|MBK1_CAEBR Dual specificity tyrosine-phosphorylation-regulated kinase mbk-1 OS=Caenorhabditis briggsae GN=mbk-1 PE=3 SV=2 929 1236 7.0E-74
sp|P22518|CLK1_MOUSE Dual specificity protein kinase CLK1 OS=Mus musculus GN=Clk1 PE=1 SV=2 933 1247 7.0E-67
sp|Q10156|LKH1_SCHPO Dual specificity protein kinase lkh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lkh1 PE=1 SV=3 919 1248 3.0E-65
sp|O35493|CLK4_MOUSE Dual specificity protein kinase CLK4 OS=Mus musculus GN=Clk4 PE=1 SV=1 933 1247 5.0E-65
sp|P49759|CLK1_HUMAN Dual specificity protein kinase CLK1 OS=Homo sapiens GN=CLK1 PE=1 SV=2 933 1247 6.0E-65
sp|Q9HAZ1|CLK4_HUMAN Dual specificity protein kinase CLK4 OS=Homo sapiens GN=CLK4 PE=1 SV=1 933 1247 1.0E-64
sp|P49761|CLK3_HUMAN Dual specificity protein kinase CLK3 OS=Homo sapiens GN=CLK3 PE=1 SV=3 933 1265 3.0E-61
sp|O35492|CLK3_MOUSE Dual specificity protein kinase CLK3 OS=Mus musculus GN=Clk3 PE=1 SV=2 933 1249 8.0E-61
sp|O35491|CLK2_MOUSE Dual specificity protein kinase CLK2 OS=Mus musculus GN=Clk2 PE=1 SV=2 933 1265 7.0E-59
sp|Q86Z02|HIPK1_HUMAN Homeodomain-interacting protein kinase 1 OS=Homo sapiens GN=HIPK1 PE=1 SV=1 936 1248 1.0E-58
sp|Q8SQZ4|YAK1_ENCCU Probable dual specificity protein kinase YAK1 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=YAK1 PE=3 SV=1 925 1270 2.0E-58
sp|A4L9P5|HIPK1_RAT Homeodomain-interacting protein kinase 1 OS=Rattus norvegicus GN=Hipk1 PE=2 SV=1 936 1248 2.0E-58
sp|O88904|HIPK1_MOUSE Homeodomain-interacting protein kinase 1 OS=Mus musculus GN=Hipk1 PE=1 SV=2 936 1248 2.0E-58
sp|Q63117|CLK3_RAT Dual specificity protein kinase CLK3 OS=Rattus norvegicus GN=Clk3 PE=1 SV=2 933 1265 2.0E-58
sp|Q3SX21|CLK3_BOVIN Dual specificity protein kinase CLK3 OS=Bos taurus GN=CLK3 PE=2 SV=1 933 1265 2.0E-58
sp|Q9QZR5|HIPK2_MOUSE Homeodomain-interacting protein kinase 2 OS=Mus musculus GN=Hipk2 PE=1 SV=2 929 1248 5.0E-58
sp|Q9WUM7|HIPK2_MESAU Homeodomain-interacting protein kinase 2 OS=Mesocricetus auratus GN=Hipk2 PE=1 SV=2 929 1248 9.0E-58
sp|Q9H2X6|HIPK2_HUMAN Homeodomain-interacting protein kinase 2 OS=Homo sapiens GN=HIPK2 PE=1 SV=2 929 1248 9.0E-58
sp|P49760|CLK2_HUMAN Dual specificity protein kinase CLK2 OS=Homo sapiens GN=CLK2 PE=1 SV=1 933 1255 9.0E-58
sp|P51566|AFC1_ARATH Serine/threonine-protein kinase AFC1 OS=Arabidopsis thaliana GN=AFC1 PE=2 SV=2 933 1248 1.0E-56
sp|O88850|HIPK3_RAT Homeodomain-interacting protein kinase 3 OS=Rattus norvegicus GN=Hipk3 PE=1 SV=1 936 1248 4.0E-56
sp|Q9ERH7|HIPK3_MOUSE Homeodomain-interacting protein kinase 3 OS=Mus musculus GN=Hipk3 PE=1 SV=3 936 1248 1.0E-55
sp|Q8MQ70|HIPK_CAEEL Homeodomain-interacting protein kinase 1 OS=Caenorhabditis elegans GN=hpk-1 PE=2 SV=1 929 1248 2.0E-55
sp|Q9H422|HIPK3_HUMAN Homeodomain-interacting protein kinase 3 OS=Homo sapiens GN=HIPK3 PE=1 SV=1 936 1248 3.0E-55
sp|P51567|AFC2_ARATH Serine/threonine-protein kinase AFC2 OS=Arabidopsis thaliana GN=AFC2 PE=1 SV=1 919 1251 8.0E-55
sp|Q07538|PRP4_SCHPO Serine/threonine-protein kinase prp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp4 PE=1 SV=2 931 1247 4.0E-54
sp|Q8NE63|HIPK4_HUMAN Homeodomain-interacting protein kinase 4 OS=Homo sapiens GN=HIPK4 PE=1 SV=1 951 1310 2.0E-53
sp|P51568|AFC3_ARATH Serine/threonine-protein kinase AFC3 OS=Arabidopsis thaliana GN=AFC3 PE=2 SV=2 933 1247 2.0E-53
sp|Q8WP28|HIPK4_MACFA Homeodomain-interacting protein kinase 4 OS=Macaca fascicularis GN=HIPK4 PE=2 SV=1 951 1251 4.0E-53
sp|Q4V793|HIPK4_RAT Homeodomain-interacting protein kinase 4 OS=Rattus norvegicus GN=Hipk4 PE=2 SV=1 951 1251 2.0E-52
sp|Q3V016|HIPK4_MOUSE Homeodomain-interacting protein kinase 4 OS=Mus musculus GN=Hipk4 PE=1 SV=2 951 1251 5.0E-52
sp|P49762|DOA_DROME Serine/threonine-protein kinase Doa OS=Drosophila melanogaster GN=Doa PE=1 SV=2 933 1279 2.0E-50
sp|Q08DZ2|PRP4B_BOVIN Serine/threonine-protein kinase PRP4 homolog OS=Bos taurus GN=PRPF4B PE=2 SV=1 920 1247 3.0E-50
sp|Q13523|PRP4B_HUMAN Serine/threonine-protein kinase PRP4 homolog OS=Homo sapiens GN=PRPF4B PE=1 SV=3 920 1247 4.0E-50
sp|Q5R814|PRP4B_PONAB Serine/threonine-protein kinase PRP4 homolog OS=Pongo abelii GN=PRPF4B PE=2 SV=1 920 1247 5.0E-50
sp|Q61136|PRP4B_MOUSE Serine/threonine-protein kinase PRP4 homolog OS=Mus musculus GN=Prpf4b PE=1 SV=3 920 1247 6.0E-50
sp|Q5RKH1|PRP4B_RAT Serine/threonine-protein kinase PRP4 homolog OS=Rattus norvegicus GN=Prpf4b PE=1 SV=1 920 1247 7.0E-50
sp|Q54WE5|PRP4B_DICDI Serine/threonine-protein kinase prpf4B OS=Dictyostelium discoideum GN=prpf4B PE=3 SV=1 931 1247 3.0E-49
sp|Q54UA9|CLKA_DICDI Probable serine/threonine-protein kinase clkA OS=Dictyostelium discoideum GN=clkA PE=3 SV=1 932 1247 5.0E-48
sp|P32350|KNS1_YEAST Dual specificity protein kinase KNS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KNS1 PE=1 SV=2 934 1170 1.0E-37
sp|Q3UTQ8|CDKL5_MOUSE Cyclin-dependent kinase-like 5 OS=Mus musculus GN=Cdkl5 PE=1 SV=1 950 1265 1.0E-37
sp|O76039|CDKL5_HUMAN Cyclin-dependent kinase-like 5 OS=Homo sapiens GN=CDKL5 PE=1 SV=1 950 1265 2.0E-37
sp|Q4R7T5|CDKL2_MACFA Cyclin-dependent kinase-like 2 OS=Macaca fascicularis GN=CDKL2 PE=2 SV=1 950 1247 8.0E-33
sp|Q4WSF6|HOG1_ASPFU Mitogen-activated protein kinase hog1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hog1 PE=1 SV=1 950 1253 2.0E-32
sp|A1CPG7|HOG1_ASPCL Mitogen-activated protein kinase hog1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=hog1 PE=3 SV=1 950 1253 2.0E-32
sp|Q6Z8C8|CDKF4_ORYSJ Cyclin-dependent kinase F-4 OS=Oryza sativa subsp. japonica GN=CDKF-4 PE=2 SV=1 950 1317 2.0E-32
sp|A1D2C9|HOG1_NEOFI Mitogen-activated protein kinase hog1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=hog1 PE=3 SV=1 950 1253 2.0E-32
sp|Q92772|CDKL2_HUMAN Cyclin-dependent kinase-like 2 OS=Homo sapiens GN=CDKL2 PE=1 SV=1 950 1247 3.0E-32
sp|Q9TTK0|CDKL2_RABIT Cyclin-dependent kinase-like 2 OS=Oryctolagus cuniculus GN=CDKL2 PE=2 SV=1 950 1247 4.0E-32
sp|Q5R754|CDKL2_PONAB Cyclin-dependent kinase-like 2 OS=Pongo abelii GN=CDKL2 PE=2 SV=1 950 1247 4.0E-32
sp|Q04859|MAK_MOUSE Serine/threonine-protein kinase MAK OS=Mus musculus GN=Mak PE=1 SV=2 950 1281 6.0E-32
sp|A1IVT7|HOG1_BOTFB Mitogen-activated protein kinase hog1 OS=Botryotinia fuckeliana (strain B05.10) GN=hog1 PE=1 SV=1 950 1257 1.0E-31
sp|P54666|CC2H3_TRYBB Cell division control protein 2 homolog 3 OS=Trypanosoma brucei brucei GN=CRK3 PE=3 SV=1 950 1248 1.0E-31
sp|P49841|GSK3B_HUMAN Glycogen synthase kinase-3 beta OS=Homo sapiens GN=GSK3B PE=1 SV=2 951 1324 2.0E-31
sp|P20793|MAK_RAT Serine/threonine-protein kinase MAK OS=Rattus norvegicus GN=Mak PE=1 SV=2 950 1257 2.0E-31
sp|Q5YJC2|GSK3B_SPECI Glycogen synthase kinase-3 beta OS=Spermophilus citellus GN=GSK3B PE=2 SV=1 951 1324 3.0E-31
sp|Q45FA5|SRPK_PHYPO Serine/threonine-protein kinase SRPK OS=Physarum polycephalum PE=1 SV=1 926 1248 3.0E-31
sp|P0C431|HOG1_GIBZE Mitogen-activated protein kinase HOG1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HOG1 PE=3 SV=1 950 1253 4.0E-31
sp|A2QRF6|HOG1_ASPNC Mitogen-activated protein kinase hog1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=hog1 PE=3 SV=2 950 1253 4.0E-31
sp|Q9UV50|HOG1_DEBHA Mitogen-activated protein kinase HOG1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HOG1 PE=1 SV=3 950 1253 4.0E-31
sp|Q09892|HOG1_SCHPO Mitogen-activated protein kinase sty1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sty1 PE=1 SV=1 950 1253 4.0E-31
sp|Q96TL5|HOG1_NEUCR Mitogen-activated protein kinase hog-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hog-1 PE=1 SV=1 950 1253 4.0E-31
sp|Q875L0|HOG1_CRYPA Mitogen-activated protein kinase HOG1 OS=Cryphonectria parasitica GN=HOG1 PE=1 SV=1 950 1253 5.0E-31
sp|Q2H332|HOG1_CHAGB Mitogen-activated protein kinase HOG1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HOG1 PE=3 SV=1 950 1259 6.0E-31
sp|Q9LFT8|CDKC1_ARATH Cyclin-dependent kinase C-1 OS=Arabidopsis thaliana GN=CDKC-1 PE=1 SV=1 951 1265 6.0E-31
sp|Q9UPZ9|ICK_HUMAN Serine/threonine-protein kinase ICK OS=Homo sapiens GN=ICK PE=1 SV=1 950 1247 7.0E-31
sp|P38973|CC2H1_TRYBB Cell division control protein 2 homolog 1 OS=Trypanosoma brucei brucei GN=CRK1 PE=3 SV=1 947 1248 7.0E-31
sp|P18266|GSK3B_RAT Glycogen synthase kinase-3 beta OS=Rattus norvegicus GN=Gsk3b PE=1 SV=1 951 1324 8.0E-31
sp|Q55FJ6|Y8078_DICDI Probable serine/threonine-protein kinase DDB_G0268078 OS=Dictyostelium discoideum GN=DDB_G0268078 PE=3 SV=1 950 1247 1.0E-30
sp|Q8W4P1|CDKC2_ARATH Cyclin-dependent kinase C-2 OS=Arabidopsis thaliana GN=CDKC-2 PE=1 SV=2 951 1265 1.0E-30
sp|Q9UV51|HOG1_MAGO7 Mitogen-activated protein kinase HOG1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HOG1 PE=3 SV=1 950 1253 1.0E-30
sp|Q75Q66|HOG1_COLOR Mitogen-activated protein kinase HOG1 OS=Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422) GN=HOG1 PE=3 SV=1 950 1253 2.0E-30
sp|Q2WFL5|HOG1_COCMI Mitogen-activated protein kinase HOG1 OS=Cochliobolus miyabeanus GN=HOG1 PE=3 SV=1 950 1253 2.0E-30
sp|Q1DUU8|HOG1_COCIM Mitogen-activated protein kinase HOG1 OS=Coccidioides immitis (strain RS) GN=HOG1 PE=3 SV=1 950 1253 2.0E-30
sp|Q5JK68|CDKC2_ORYSJ Cyclin-dependent kinase C-2 OS=Oryza sativa subsp. japonica GN=CDKC-2 PE=2 SV=1 951 1265 3.0E-30
sp|Q84SN3|CDKF3_ORYSJ Cyclin-dependent kinase F-3 OS=Oryza sativa subsp. japonica GN=CDKF-3 PE=2 SV=1 950 1255 3.0E-30
sp|P17157|PHO85_YEAST Cyclin-dependent protein kinase PHO85 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO85 PE=1 SV=2 950 1248 3.0E-30
sp|Q9WV60|GSK3B_MOUSE Glycogen synthase kinase-3 beta OS=Mus musculus GN=Gsk3b PE=1 SV=2 951 1324 3.0E-30
sp|Q2WGK3|HOG1_TRIHA Mitogen-activated protein kinase hog1 OS=Trichoderma harzianum GN=hog1 PE=1 SV=1 950 1253 3.0E-30
sp|P20794|MAK_HUMAN Serine/threonine-protein kinase MAK OS=Homo sapiens GN=MAK PE=1 SV=2 950 1281 4.0E-30
sp|Q8TGA9|HOG1_BLUGR Mitogen-activated protein kinase HOG1 OS=Blumeria graminis GN=HOG1 PE=3 SV=1 950 1253 4.0E-30
sp|Q6PWX2|HOG1_BEABA Mitogen-activated protein kinase HOG1 OS=Beauveria bassiana GN=HOG1 PE=3 SV=1 950 1253 4.0E-30
sp|Q38HL5|HOG1_EURHE Mitogen-activated protein kinase hog1 OS=Eurotium herbariorum GN=hog1 PE=3 SV=1 950 1253 5.0E-30
sp|A3LN91|HOG1_PICST Mitogen-activated protein kinase HOG1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=HOG1 PE=3 SV=2 950 1253 5.0E-30
sp|Q92207|HOG1_CANAL Mitogen-activated protein kinase HOG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HOG1 PE=1 SV=2 950 1253 5.0E-30
sp|Q2U469|MPKC_ASPOR Mitogen-activated protein kinase mpkC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mpkC PE=3 SV=2 950 1257 6.0E-30
sp|Q6XKY3|HOG1_HYPAT Mitogen-activated protein kinase hog1 OS=Hypocrea atroviridis GN=hog1 PE=3 SV=1 950 1253 7.0E-30
sp|Q14AX6|CDK12_MOUSE Cyclin-dependent kinase 12 OS=Mus musculus GN=Cdk12 PE=1 SV=2 944 1247 7.0E-30
sp|D2H526|CDK12_AILME Cyclin-dependent kinase 12 OS=Ailuropoda melanoleuca GN=CDK12 PE=3 SV=1 944 1247 9.0E-30
sp|Q6I5Y0|CDKC1_ORYSJ Cyclin-dependent kinase C-1 OS=Oryza sativa subsp. japonica GN=CDKC-1 PE=2 SV=1 951 1265 1.0E-29
sp|Q9NYV4|CDK12_HUMAN Cyclin-dependent kinase 12 OS=Homo sapiens GN=CDK12 PE=1 SV=2 944 1247 1.0E-29
sp|P0C865|MK07_RAT Mitogen-activated protein kinase 7 OS=Rattus norvegicus GN=Mapk7 PE=1 SV=1 938 1253 1.0E-29
sp|Q9WVS8|MK07_MOUSE Mitogen-activated protein kinase 7 OS=Mus musculus GN=Mapk7 PE=1 SV=1 938 1253 1.0E-29
sp|Q0D0P5|HOG1_ASPTN Mitogen-activated protein kinase hog1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=hog1 PE=3 SV=2 950 1253 1.0E-29
sp|Q52PH6|HOG1_ALTBR Mitogen-activated protein kinase HOG1 OS=Alternaria brassicicola GN=HOG1 PE=3 SV=1 950 1253 2.0E-29
sp|Q62726|ICK_RAT Serine/threonine-protein kinase ICK OS=Rattus norvegicus GN=Ick PE=1 SV=1 950 1247 2.0E-29
sp|Q0U4L8|HOG1_PHANO Mitogen-activated protein kinase HOG1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HOG1 PE=3 SV=2 950 1253 2.0E-29
sp|Q13164|MK07_HUMAN Mitogen-activated protein kinase 7 OS=Homo sapiens GN=MAPK7 PE=1 SV=2 938 1253 2.0E-29
sp|Q3MJK5|CDK12_RAT Cyclin-dependent kinase 12 OS=Rattus norvegicus GN=Cdk12 PE=1 SV=1 944 1247 2.0E-29
sp|Q9QUK0|CDKL2_MOUSE Cyclin-dependent kinase-like 2 OS=Mus musculus GN=Cdkl2 PE=2 SV=1 950 1247 2.0E-29
sp|Q9JKV2|ICK_MOUSE Serine/threonine-protein kinase ICK OS=Mus musculus GN=Ick PE=1 SV=2 950 1247 3.0E-29
sp|Q4W6D3|HOG1_COCHE Mitogen-activated protein kinase HOG1 OS=Cochliobolus heterostrophus GN=HOG1 PE=1 SV=1 950 1253 3.0E-29
sp|P14681|KSS1_YEAST Mitogen-activated protein kinase KSS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KSS1 PE=1 SV=1 950 1260 3.0E-29
sp|Q5XIT0|CDKL2_RAT Cyclin-dependent kinase-like 2 OS=Rattus norvegicus GN=Cdkl2 PE=2 SV=1 950 1247 3.0E-29
sp|Q1KTF2|HOG1_ZYMTI Mitogen-activated protein kinase Hog1 OS=Zymoseptoria tritici (strain CBS 115943 / IPO323) GN=Hog1 PE=3 SV=2 950 1253 4.0E-29
sp|P51136|GSK3_DICDI Glycogen synthase kinase-3 OS=Dictyostelium discoideum GN=gskA PE=1 SV=2 936 1274 4.0E-29
sp|P27638|SPK1_SCHPO Mitogen-activated protein kinase spk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spk1 PE=2 SV=1 950 1266 4.0E-29
sp|E1BB52|CDK13_BOVIN Cyclin-dependent kinase 13 OS=Bos taurus GN=CDK13 PE=3 SV=1 927 1247 5.0E-29
sp|P43450|CDK2_CARAU Cyclin-dependent kinase 2 OS=Carassius auratus GN=cdk2 PE=2 SV=1 951 1259 5.0E-29
sp|Q39023|MPK3_ARATH Mitogen-activated protein kinase 3 OS=Arabidopsis thaliana GN=MPK3 PE=1 SV=2 949 1253 6.0E-29
sp|Q39011|KSG7_ARATH Shaggy-related protein kinase eta OS=Arabidopsis thaliana GN=ASK7 PE=1 SV=2 956 1266 6.0E-29
sp|B5DE93|CDK12_XENTR Cyclin-dependent kinase 12 OS=Xenopus tropicalis GN=cdk12 PE=2 SV=1 927 1247 6.0E-29
sp|Q69ZA1|CDK13_MOUSE Cyclin-dependent kinase 13 OS=Mus musculus GN=Cdk13 PE=1 SV=3 927 1247 8.0E-29
sp|A1DES4|MPKC_NEOFI Mitogen-activated protein kinase mpkC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mpkc PE=3 SV=2 957 1257 1.0E-28
sp|Q8SRI3|MRK1_ENCCU Probable serine/threonine-protein kinase MRK1 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=MRK1 PE=3 SV=2 950 1166 1.0E-28
sp|Q14004|CDK13_HUMAN Cyclin-dependent kinase 13 OS=Homo sapiens GN=CDK13 PE=1 SV=2 927 1247 1.0E-28
sp|P43294|MHK_ARATH Serine/threonine-protein kinase MHK OS=Arabidopsis thaliana GN=MHK PE=2 SV=2 950 1262 1.0E-28
sp|P48963|CDK2_MESAU Cyclin-dependent kinase 2 OS=Mesocricetus auratus GN=CDK2 PE=2 SV=1 951 1259 2.0E-28
sp|A1CAF0|MPKC_ASPCL Mitogen-activated protein kinase mpkC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mpkC PE=3 SV=1 950 1248 2.0E-28
sp|Q9JM01|CDKL3_RAT Cyclin-dependent kinase-like 3 OS=Rattus norvegicus GN=Cdkl3 PE=2 SV=2 951 1248 2.0E-28
sp|P23437|CDK2_XENLA Cyclin-dependent kinase 2 OS=Xenopus laevis GN=cdk2 PE=1 SV=3 951 1255 2.0E-28
sp|Q6FKD4|PHO85_CANGA Negative regulator of the PHO system OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PHO85 PE=3 SV=1 950 1248 2.0E-28
sp|Q4PC06|HOG1_USTMA Mitogen-activated protein kinase HOG1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HOG1 PE=3 SV=1 950 1253 2.0E-28
sp|Q63699|CDK2_RAT Cyclin-dependent kinase 2 OS=Rattus norvegicus GN=Cdk2 PE=1 SV=1 951 1259 3.0E-28
sp|Q2NL51|GSK3A_MOUSE Glycogen synthase kinase-3 alpha OS=Mus musculus GN=Gsk3a PE=1 SV=2 951 1266 3.0E-28
sp|A5PKJ4|MK07_BOVIN Mitogen-activated protein kinase 7 OS=Bos taurus GN=MAPK7 PE=2 SV=1 938 1253 3.0E-28
sp|Q8BLF2|CDKL3_MOUSE Cyclin-dependent kinase-like 3 OS=Mus musculus GN=Cdkl3 PE=2 SV=2 951 1248 3.0E-28
sp|P24941|CDK2_HUMAN Cyclin-dependent kinase 2 OS=Homo sapiens GN=CDK2 PE=1 SV=2 951 1259 4.0E-28
sp|O14098|CTK1_SCHPO CTD kinase subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsk1 PE=1 SV=1 951 1259 4.0E-28
sp|Q8NJT7|HOG1_HORWE Mitogen-activated protein kinase HOG1 OS=Hortaea werneckii GN=HOG1 PE=3 SV=1 950 1253 4.0E-28
sp|Q5E9Y0|CDK2_BOVIN Cyclin-dependent kinase 2 OS=Bos taurus GN=CDK2 PE=2 SV=1 951 1259 4.0E-28
sp|O55076|CDK2_CRIGR Cyclin-dependent kinase 2 OS=Cricetulus griseus GN=CDK2 PE=2 SV=1 951 1259 4.0E-28
sp|E1BB50|CDK12_BOVIN Cyclin-dependent kinase 12 OS=Bos taurus GN=CDK12 PE=3 SV=1 944 1247 5.0E-28
sp|Q06309|CRK1_LEIME Cell division protein kinase 2 homolog CRK1 OS=Leishmania mexicana GN=CRK1 PE=2 SV=1 947 1250 5.0E-28
sp|A3EZ55|HOG1A_WALI9 Mitogen-activated protein kinase HOG1A OS=Wallemia ichthyophaga (strain EXF-994 / CBS 113033) GN=HOG1A PE=1 SV=2 950 1248 5.0E-28
sp|O23145|KSG2_ARATH Shaggy-related protein kinase beta OS=Arabidopsis thaliana GN=ASK2 PE=2 SV=1 947 1253 6.0E-28
sp|Q6C4M9|HOG1_YARLI Mitogen-activated protein kinase HOG1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HOG1 PE=3 SV=1 950 1254 6.0E-28
sp|Q66HE7|CDKL1_RAT Cyclin-dependent kinase-like 1 OS=Rattus norvegicus GN=Cdkl1 PE=2 SV=1 950 1262 7.0E-28
sp|Q388M1|GSK3B_TRYB2 Glycogen synthase kinase 3 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=GSK3 PE=1 SV=1 950 1266 7.0E-28
sp|P29620|CDKD1_ORYSJ Cyclin-dependent kinase D-1 OS=Oryza sativa subsp. japonica GN=CDKD-1 PE=1 SV=1 947 1273 7.0E-28
sp|P0CP68|HOG1_CRYNJ Mitogen-activated protein kinase HOG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HOG1 PE=1 SV=1 950 1248 8.0E-28
sp|Q56R42|HOG1_CRYNH Mitogen-activated protein kinase HOG1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=HOG1 PE=1 SV=1 950 1248 8.0E-28
sp|P0CP69|HOG1_CRYNB Mitogen-activated protein kinase HOG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HOG1 PE=3 SV=1 950 1248 8.0E-28
sp|Q9UQ07|MOK_HUMAN MAPK/MAK/MRK overlapping kinase OS=Homo sapiens GN=MOK PE=2 SV=1 951 1251 9.0E-28
sp|Q0CIC7|MPKC_ASPTN Mitogen-activated protein kinase mpkC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mpkC PE=3 SV=2 950 1253 9.0E-28
sp|Q8CEQ0|CDKL1_MOUSE Cyclin-dependent kinase-like 1 OS=Mus musculus GN=Cdkl1 PE=2 SV=1 950 1246 1.0E-27
sp|Q702W0|HOG1_BLAAD Mitogen-activated protein kinase hog1 OS=Blastobotrys adeninivorans GN=hog1 PE=1 SV=1 950 1254 1.0E-27
sp|O42781|MAPK2_PNECA Mitogen-activated protein kinase 2 OS=Pneumocystis carinii GN=MKP2 PE=1 SV=1 951 1247 1.0E-27
sp|Q4R8T9|CDKL3_MACFA Cyclin-dependent kinase-like 3 OS=Macaca fascicularis GN=CDKL3 PE=2 SV=1 951 1248 1.0E-27
sp|A2QN07|MPKC_ASPNC Mitogen-activated protein kinase mpkC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mpkC PE=3 SV=1 950 1253 1.0E-27
sp|Q39010|KSG6_ARATH Shaggy-related protein kinase zeta OS=Arabidopsis thaliana GN=ASK6 PE=2 SV=2 956 1266 1.0E-27
sp|Q92241|PHO85_KLULA Negative regulator of the PHO system OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PHO85 PE=3 SV=2 950 1248 2.0E-27
sp|P04551|CDK1_SCHPO Cyclin-dependent kinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc2 PE=1 SV=1 951 1247 2.0E-27
sp|P23111|CDC2_MAIZE Cell division control protein 2 homolog OS=Zea mays GN=CDC2 PE=2 SV=1 950 1246 2.0E-27
sp|Q00532|CDKL1_HUMAN Cyclin-dependent kinase-like 1 OS=Homo sapiens GN=CDKL1 PE=1 SV=5 950 1291 2.0E-27
sp|P18265|GSK3A_RAT Glycogen synthase kinase-3 alpha OS=Rattus norvegicus GN=Gsk3a PE=1 SV=1 951 1266 2.0E-27
sp|A3EZ53|HOG1_WALMU Mitogen-activated protein kinase HOG1 (Fragment) OS=Wallemia muriae GN=HOG1 PE=3 SV=1 1030 1254 2.0E-27
sp|Q5I6M2|HOG1_SETTU Mitogen-activated protein kinase HOG1 OS=Setosphaeria turcica GN=HOG1 PE=2 SV=2 960 1253 3.0E-27
sp|O44514|PMK3_CAEEL Mitogen-activated protein kinase pmk-3 OS=Caenorhabditis elegans GN=pmk-3 PE=1 SV=2 954 1258 3.0E-27
sp|P18431|SGG_DROME Protein kinase shaggy OS=Drosophila melanogaster GN=sgg PE=1 SV=3 951 1247 3.0E-27
sp|P49840|GSK3A_HUMAN Glycogen synthase kinase-3 alpha OS=Homo sapiens GN=GSK3A PE=1 SV=2 951 1266 3.0E-27
sp|P38615|RIM11_YEAST Serine/threonine-protein kinase RIM11/MSD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIM11 PE=1 SV=1 940 1236 3.0E-27
sp|A3EZ54|HOG1_WALSE Mitogen-activated protein kinase HOG1 (Fragment) OS=Wallemia sebi GN=HOG1 PE=3 SV=1 1030 1254 3.0E-27
sp|Q4KM34|CDK20_RAT Cyclin-dependent kinase 20 OS=Rattus norvegicus GN=Cdk20 PE=2 SV=2 950 1283 3.0E-27
sp|A2Y4B6|CDKD1_ORYSI Cyclin-dependent kinase D-1 OS=Oryza sativa subsp. indica GN=CDKD-1 PE=2 SV=1 947 1273 4.0E-27
sp|Q5SN53|MPK8_ORYSJ Mitogen-activated protein kinase 8 OS=Oryza sativa subsp. japonica GN=MPK8 PE=2 SV=2 948 1264 4.0E-27
sp|Q9JHU3|CDK20_MOUSE Cyclin-dependent kinase 20 OS=Mus musculus GN=Cdk20 PE=1 SV=1 950 1261 4.0E-27
sp|Q91757|GSK3B_XENLA Glycogen synthase kinase-3 beta OS=Xenopus laevis GN=gsk3b PE=1 SV=1 951 1272 5.0E-27
sp|Q9VP22|CDK12_DROME Cyclin-dependent kinase 12 OS=Drosophila melanogaster GN=Cdk12 PE=1 SV=1 944 1170 5.0E-27
sp|Q8IVW4|CDKL3_HUMAN Cyclin-dependent kinase-like 3 OS=Homo sapiens GN=CDKL3 PE=1 SV=1 951 1248 5.0E-27
sp|Q39012|KSG9_ARATH Shaggy-related protein kinase iota OS=Arabidopsis thaliana GN=ASK9 PE=2 SV=1 956 1266 5.0E-27
sp|Q54D75|Y2550_DICDI Probable cyclin-dependent serine/threonine-protein kinase DDB_G0292550 OS=Dictyostelium discoideum GN=DDB_G0292550 PE=3 SV=1 951 1170 7.0E-27
sp|Q10N20|MPK5_ORYSJ Mitogen-activated protein kinase 5 OS=Oryza sativa subsp. japonica GN=MPK5 PE=1 SV=1 957 1247 7.0E-27
sp|A2XFC8|MPK5_ORYSI Mitogen-activated protein kinase 5 OS=Oryza sativa subsp. indica GN=MPK5 PE=1 SV=2 957 1247 7.0E-27
sp|P47812|MK14_XENLA Mitogen-activated protein kinase 14 OS=Xenopus laevis GN=mapk14 PE=2 SV=1 950 1253 7.0E-27
sp|Q9U2Q9|GSK3_CAEEL Glycogen synthase kinase-3 OS=Caenorhabditis elegans GN=gsk-3 PE=1 SV=1 956 1293 9.0E-27
sp|O04160|KSGT_BRANA Shaggy-related protein kinase theta OS=Brassica napus PE=2 SV=2 956 1253 9.0E-27
sp|O96821|CDC2H_PLAKH Cell division control protein 2 homolog OS=Plasmodium knowlesi (strain H) GN=CRK2 PE=3 SV=1 950 1246 9.0E-27
sp|P46551|CDK12_CAEEL Cyclin-dependent kinase 12 OS=Caenorhabditis elegans GN=cdk-12 PE=1 SV=4 951 1247 9.0E-27
sp|Q9XZD6|CDC2H_PLAVI Cell division control protein 2 homolog OS=Plasmodium vivax GN=CRK2 PE=3 SV=1 950 1246 1.0E-26
sp|P50613|CDK7_HUMAN Cyclin-dependent kinase 7 OS=Homo sapiens GN=CDK7 PE=1 SV=1 948 1276 1.0E-26
sp|O23236|MPK14_ARATH Mitogen-activated protein kinase 14 OS=Arabidopsis thaliana GN=MPK14 PE=1 SV=1 950 1260 1.0E-26
sp|Q91727|CDK4_XENLA Cyclin-dependent kinase 4 OS=Xenopus laevis GN=cdk4 PE=1 SV=1 950 1248 1.0E-26
sp|P29618|CDKA1_ORYSJ Cyclin-dependent kinase A-1 OS=Oryza sativa subsp. japonica GN=CDKA-1 PE=1 SV=1 950 1246 2.0E-26
sp|M1T7M3|HOG1B_WALI9 Mitogen-activated protein kinase HOG1B OS=Wallemia ichthyophaga (strain EXF-994 / CBS 113033) GN=HOG1B PE=1 SV=1 950 1248 2.0E-26
sp|Q17446|PMK1_CAEEL Mitogen-activated protein kinase pmk-1 OS=Caenorhabditis elegans GN=pmk-1 PE=1 SV=1 957 1249 2.0E-26
sp|Q8TD08|MK15_HUMAN Mitogen-activated protein kinase 15 OS=Homo sapiens GN=MAPK15 PE=1 SV=1 947 1254 2.0E-26
sp|Q9WVS4|MOK_MOUSE MAPK/MAK/MRK overlapping kinase OS=Mus musculus GN=Mok PE=1 SV=1 951 1252 2.0E-26
sp|P51137|MSK1_MEDSA Glycogen synthase kinase-3 homolog MsK-1 OS=Medicago sativa GN=MSK-1 PE=2 SV=1 943 1261 2.0E-26
sp|O62618|MK14A_DROME Mitogen-activated protein kinase 14A OS=Drosophila melanogaster GN=Mpk2 PE=1 SV=1 951 1265 3.0E-26
sp|Q03147|CDK7_MOUSE Cyclin-dependent kinase 7 OS=Mus musculus GN=Cdk7 PE=1 SV=2 948 1277 3.0E-26
sp|Q750A9|HOG1_ASHGO Mitogen-activated protein kinase HOG1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HOG1 PE=3 SV=2 950 1253 3.0E-26
sp|Q40518|MSK1_TOBAC Shaggy-related protein kinase NtK-1 OS=Nicotiana tabacum GN=NTK-1 PE=2 SV=1 943 1260 3.0E-26
sp|Q16539|MK14_HUMAN Mitogen-activated protein kinase 14 OS=Homo sapiens GN=MAPK14 PE=1 SV=3 950 1264 3.0E-26
sp|P93101|CDC2_OXYRB Cell division control protein 2 homolog OS=Oxybasis rubra GN=CDC2 PE=2 SV=1 950 1246 3.0E-26
sp|O59854|HOG1_ZYGRO Mitogen-activated protein kinase HOG1 OS=Zygosaccharomyces rouxii GN=HOG1 PE=3 SV=1 950 1253 3.0E-26
sp|Q90336|MK14A_CYPCA Mitogen-activated protein kinase 14A OS=Cyprinus carpio GN=mapk14a PE=1 SV=1 950 1253 4.0E-26
sp|O93982|HOG1_ZYGRC Mitogen-activated protein kinase HOG1 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=HOG1 PE=3 SV=2 950 1253 4.0E-26
sp|P54664|CC2H1_TRYCO Cell division control protein 2 homolog 1 OS=Trypanosoma congolense GN=CRK1 PE=3 SV=1 950 1248 4.0E-26
sp|Q3TZA2|CDKL4_MOUSE Cyclin-dependent kinase-like 4 OS=Mus musculus GN=Cdkl4 PE=2 SV=1 950 1236 4.0E-26
sp|O02812|MK14_CANLF Mitogen-activated protein kinase 14 OS=Canis lupus familiaris GN=MAPK14 PE=2 SV=3 950 1264 4.0E-26
sp|Q9URT9|GSK31_SCHPO Protein kinase gsk31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gsk31 PE=1 SV=1 951 1270 4.0E-26
sp|A8X5H5|GSK3_CAEBR Glycogen synthase kinase-3 OS=Caenorhabditis briggsae GN=gsk-3 PE=3 SV=1 956 1261 4.0E-26
sp|P40417|ERKA_DROME Mitogen-activated protein kinase ERK-A OS=Drosophila melanogaster GN=rl PE=1 SV=3 950 1262 5.0E-26
sp|Q6CJA8|HOG1_KLULA Mitogen-activated protein kinase HOG1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HOG1 PE=3 SV=1 950 1253 5.0E-26
sp|Q07785|CDC2H_PLAFK Cell division control protein 2 homolog OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CRK2 PE=1 SV=1 950 1246 5.0E-26
sp|P61075|CDC2H_PLAF7 Cell division control protein 2 homolog OS=Plasmodium falciparum (isolate 3D7) GN=CRK2 PE=3 SV=1 950 1246 5.0E-26
sp|P23572|CDK1_DROME Cyclin-dependent kinase 1 OS=Drosophila melanogaster GN=Cdk1 PE=1 SV=1 951 1249 6.0E-26
sp|P32485|HOG1_YEAST Mitogen-activated protein kinase HOG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOG1 PE=1 SV=2 950 1253 6.0E-26
sp|Q9HG11|MPKC_EMENI Mitogen-activated protein kinase mpkC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mpkC PE=2 SV=2 950 1248 6.0E-26
sp|Q9U6D2|JNK1_ANCCA Stress-activated protein kinase JNK-1 OS=Ancylostoma caninum GN=JNK-1 PE=2 SV=2 950 1248 6.0E-26
sp|Q751E8|PHO85_ASHGO Negative regulator of the PHO system OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PHO85 PE=3 SV=2 950 1244 8.0E-26
sp|P34117|CDK5_DICDI Cyclin-dependent kinase 5 homolog OS=Dictyostelium discoideum GN=cdk5 PE=2 SV=2 950 1249 8.0E-26
sp|Q9XTR1|CDK4_CAEEL Cyclin-dependent kinase 4 homolog OS=Caenorhabditis elegans GN=cdk-4 PE=1 SV=2 953 1258 8.0E-26
sp|Q10452|GSK3_SCHPO Protein kinase gsk3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gsk3 PE=1 SV=3 956 1281 1.0E-25
sp|Q38772|CDC2A_ANTMA Cell division control protein 2 homolog A OS=Antirrhinum majus GN=CDC2A PE=2 SV=2 950 1246 1.0E-25
sp|P30285|CDK4_MOUSE Cyclin-dependent kinase 4 OS=Mus musculus GN=Cdk4 PE=1 SV=1 948 1254 1.0E-25
sp|P79996|MK09_CHICK Mitogen-activated protein kinase 9 OS=Gallus gallus GN=MAPK9 PE=2 SV=1 950 1260 1.0E-25
sp|O94737|MAPK1_PNECA Mitogen-activated protein kinase 1 OS=Pneumocystis carinii GN=MKP1 PE=1 SV=1 951 1247 1.0E-25
sp|P47811|MK14_MOUSE Mitogen-activated protein kinase 14 OS=Mus musculus GN=Mapk14 PE=1 SV=3 950 1264 1.0E-25
sp|Q5EAB2|CDK9_BOVIN Cyclin-dependent kinase 9 OS=Bos taurus GN=CDK9 PE=2 SV=1 950 1254 1.0E-25
sp|Q9FVS6|KSG4_ARATH Shaggy-related protein kinase delta OS=Arabidopsis thaliana GN=ASK4 PE=2 SV=1 956 1266 1.0E-25
sp|Q95NE7|MK14_PANTR Mitogen-activated protein kinase 14 OS=Pan troglodytes GN=MAPK14 PE=2 SV=3 950 1264 1.0E-25
sp|Q9DGE1|MK14B_DANRE Mitogen-activated protein kinase 14B OS=Danio rerio GN=mapk14b PE=1 SV=1 950 1253 2.0E-25
sp|Q6FIU2|HOG1_CANGA Mitogen-activated protein kinase HOG1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HOG1 PE=3 SV=1 950 1253 2.0E-25
sp|P83101|GSK3H_DROME Putative glycogen synthase kinase-3 homolog OS=Drosophila melanogaster GN=gskt PE=2 SV=1 956 1247 2.0E-25
sp|O59853|HOG2_ZYGRO Mitogen-activated protein kinase HOG2 OS=Zygosaccharomyces rouxii GN=HOG2 PE=3 SV=1 950 1253 2.0E-25
sp|Q9C5C0|MPK18_ARATH Mitogen-activated protein kinase 18 OS=Arabidopsis thaliana GN=MPK18 PE=1 SV=4 948 1175 2.0E-25
sp|P70618|MK14_RAT Mitogen-activated protein kinase 14 OS=Rattus norvegicus GN=Mapk14 PE=1 SV=3 950 1253 2.0E-25
sp|P34112|CDK1_DICDI Cyclin-dependent kinase 1 OS=Dictyostelium discoideum GN=cdk1 PE=2 SV=1 950 1246 2.0E-25
sp|P46196|MK01_BOVIN Mitogen-activated protein kinase 1 OS=Bos taurus GN=MAPK1 PE=2 SV=3 950 1260 2.0E-25
sp|P35426|CDK4_RAT Cyclin-dependent kinase 4 OS=Rattus norvegicus GN=Cdk4 PE=1 SV=1 950 1252 2.0E-25
sp|P27361|MK03_HUMAN Mitogen-activated protein kinase 3 OS=Homo sapiens GN=MAPK3 PE=1 SV=4 950 1260 2.0E-25
sp|P0CP66|CPK1_CRYNJ Mitogen-activated protein kinase CPK1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CPK1 PE=3 SV=1 951 1253 3.0E-25
sp|P0CP67|CPK1_CRYNB Mitogen-activated protein kinase CPK1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CPK1 PE=3 SV=1 951 1253 3.0E-25
sp|Q4Z6R1|CDC2H_PLABA Cell division control protein 2 homolog OS=Plasmodium berghei (strain Anka) GN=CRK2 PE=2 SV=1 950 1246 3.0E-25
sp|P51952|CDK7_RAT Cyclin-dependent kinase 7 (Fragment) OS=Rattus norvegicus GN=Cdk7 PE=1 SV=2 948 1276 3.0E-25
sp|Q39019|KSG10_ARATH Shaggy-related protein kinase kappa OS=Arabidopsis thaliana GN=ASK10 PE=2 SV=2 956 1266 3.0E-25
sp|Q9Y7W4|BUR1_CANAL Serine/threonine-protein kinase BUR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CRK1 PE=3 SV=2 951 1265 3.0E-25
sp|P28482|MK01_HUMAN Mitogen-activated protein kinase 1 OS=Homo sapiens GN=MAPK1 PE=1 SV=3 950 1260 3.0E-25
sp|Q1L5Z8|HOG1_TORDE Mitogen-activated protein kinase HOG1 OS=Torulaspora delbrueckii GN=HOG1 PE=1 SV=1 950 1253 3.0E-25
sp|P63086|MK01_RAT Mitogen-activated protein kinase 1 OS=Rattus norvegicus GN=Mapk1 PE=1 SV=3 950 1260 4.0E-25
sp|P63085|MK01_MOUSE Mitogen-activated protein kinase 1 OS=Mus musculus GN=Mapk1 PE=1 SV=3 950 1260 4.0E-25
sp|Q641Z4|CDK9_RAT Cyclin-dependent kinase 9 OS=Rattus norvegicus GN=Cdk9 PE=2 SV=1 950 1254 4.0E-25
sp|Q99J95|CDK9_MOUSE Cyclin-dependent kinase 9 OS=Mus musculus GN=Cdk9 PE=1 SV=1 950 1254 4.0E-25
sp|Q39025|MPK5_ARATH Mitogen-activated protein kinase 5 OS=Arabidopsis thaliana GN=MPK5 PE=2 SV=2 954 1249 4.0E-25
sp|Q9LUC3|MPK19_ARATH Mitogen-activated protein kinase 19 OS=Arabidopsis thaliana GN=MPK19 PE=2 SV=2 948 1175 4.0E-25
sp|Q9WUI1|MK11_MOUSE Mitogen-activated protein kinase 11 OS=Mus musculus GN=Mapk11 PE=1 SV=2 957 1279 4.0E-25
sp|Q8IZL9|CDK20_HUMAN Cyclin-dependent kinase 20 OS=Homo sapiens GN=CDK20 PE=1 SV=1 950 1283 5.0E-25
sp|Q75KK8|MPK14_ORYSJ Mitogen-activated protein kinase 14 OS=Oryza sativa subsp. japonica GN=MPK14 PE=2 SV=1 950 1242 5.0E-25
sp|Q39027|MPK7_ARATH Mitogen-activated protein kinase 7 OS=Arabidopsis thaliana GN=MPK7 PE=1 SV=2 950 1260 5.0E-25
sp|Q40532|NTF4_TOBAC Mitogen-activated protein kinase homolog NTF4 OS=Nicotiana tabacum GN=NTF4 PE=2 SV=1 957 1248 5.0E-25
sp|Q67C40|MPK7_ORYSJ Mitogen-activated protein kinase 7 OS=Oryza sativa subsp. japonica GN=MPK7 PE=2 SV=1 950 1177 5.0E-25
sp|Q04899|CDK18_MOUSE Cyclin-dependent kinase 18 OS=Mus musculus GN=Cdk18 PE=1 SV=1 951 1170 5.0E-25
sp|Q6L5F7|MPK17_ORYSJ Mitogen-activated protein kinase 17 OS=Oryza sativa subsp. japonica GN=MPK17 PE=2 SV=2 948 1249 5.0E-25
sp|Q6BRY2|PHO85_DEBHA Negative regulator of the PHO system OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PHO85 PE=3 SV=2 950 1255 5.0E-25
sp|P39951|CDK1_RAT Cyclin-dependent kinase 1 OS=Rattus norvegicus GN=Cdk1 PE=1 SV=1 951 1246 5.0E-25
sp|Q5R7I7|CDK20_PONAB Cyclin-dependent kinase 20 OS=Pongo abelii GN=CDK20 PE=2 SV=1 950 1283 5.0E-25
sp|Q5Z859|MPK4_ORYSJ Mitogen-activated protein kinase 4 OS=Oryza sativa subsp. japonica GN=MPK4 PE=2 SV=1 950 1260 6.0E-25
sp|P83100|MK14C_DROME Putative mitogen-activated protein kinase 14C OS=Drosophila melanogaster GN=p38c PE=2 SV=1 951 1271 6.0E-25
sp|Q9W739|CDK1_RANDY Cyclin-dependent kinase 1 OS=Rana dybowskii GN=CDK1 PE=2 SV=1 951 1259 6.0E-25
sp|O35832|CKD18_RAT Cyclin-dependent kinase 18 OS=Rattus norvegicus GN=Cdk18 PE=1 SV=1 951 1170 7.0E-25
sp|P41808|SMK1_YEAST Sporulation-specific mitogen-activated protein kinase SMK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMK1 PE=1 SV=1 951 1253 7.0E-25
sp|P11440|CDK1_MOUSE Cyclin-dependent kinase 1 OS=Mus musculus GN=Cdk1 PE=1 SV=3 951 1246 7.0E-25
sp|P24100|CDKA1_ARATH Cyclin-dependent kinase A-1 OS=Arabidopsis thaliana GN=CDKA-1 PE=1 SV=1 950 1246 7.0E-25
sp|Q15759|MK11_HUMAN Mitogen-activated protein kinase 11 OS=Homo sapiens GN=MAPK11 PE=1 SV=2 957 1279 7.0E-25
sp|Q55C57|GLKA_DICDI Probable serine/threonine-protein kinase glkA OS=Dictyostelium discoideum GN=glkA PE=3 SV=1 948 1247 7.0E-25
sp|Q05006|CDC22_MEDSA Cell division control protein 2 homolog 2 OS=Medicago sativa GN=CDC2B PE=2 SV=1 950 1251 8.0E-25
sp|Q63844|MK03_MOUSE Mitogen-activated protein kinase 3 OS=Mus musculus GN=Mapk3 PE=1 SV=5 950 1260 8.0E-25
sp|O61443|MK14B_DROME Mitogen-activated protein kinase 14B OS=Drosophila melanogaster GN=p38b PE=1 SV=1 951 1253 9.0E-25
sp|Q4Y4B1|CDC2H_PLACH Cell division control protein 2 homolog OS=Plasmodium chabaudi GN=CRK2 PE=3 SV=1 950 1246 9.0E-25
sp|P79432|CDK4_PIG Cyclin-dependent kinase 4 OS=Sus scrofa GN=CDK4 PE=3 SV=1 950 1247 9.0E-25
sp|Q9I958|MK14B_CYPCA Mitogen-activated protein kinase 14B OS=Cyprinus carpio GN=mapk14b PE=1 SV=1 950 1253 9.0E-25
sp|Q5MAI5|CDKL4_HUMAN Cyclin-dependent kinase-like 4 OS=Homo sapiens GN=CDKL4 PE=2 SV=2 950 1236 1.0E-24
sp|Q6Z437|MPK3_ORYSJ Mitogen-activated protein kinase 3 OS=Oryza sativa subsp. japonica GN=MPK3 PE=2 SV=1 950 1260 1.0E-24
sp|P29619|CDKA2_ORYSJ Cyclin-dependent kinase A-2 OS=Oryza sativa subsp. japonica GN=CDKA-2 PE=2 SV=1 950 1246 1.0E-24
sp|Q8LF80|CKB21_ARATH Cyclin-dependent kinase B2-1 OS=Arabidopsis thaliana GN=CDKB2-1 PE=1 SV=2 951 1246 1.0E-24
sp|Q07002|CDK18_HUMAN Cyclin-dependent kinase 18 OS=Homo sapiens GN=CDK18 PE=1 SV=3 951 1170 1.0E-24
sp|P21708|MK03_RAT Mitogen-activated protein kinase 3 OS=Rattus norvegicus GN=Mapk3 PE=1 SV=5 950 1260 1.0E-24
sp|P50750|CDK9_HUMAN Cyclin-dependent kinase 9 OS=Homo sapiens GN=CDK9 PE=1 SV=3 950 1254 1.0E-24
sp|Q5RD01|CDK18_PONAB Cyclin-dependent kinase 18 OS=Pongo abelii GN=CDK18 PE=2 SV=2 951 1170 1.0E-24
sp|Q53N72|MPK15_ORYSJ Mitogen-activated protein kinase 15 OS=Oryza sativa subsp. japonica GN=MPK15 PE=2 SV=1 950 1242 1.0E-24
sp|Q40517|NTF3_TOBAC Mitogen-activated protein kinase homolog NTF3 OS=Nicotiana tabacum GN=NTF3 PE=1 SV=1 950 1260 1.0E-24
sp|C4YGK0|ERK1_CANAW Extracellular signal-regulated kinase 1 OS=Candida albicans (strain WO-1) GN=CEK1 PE=3 SV=1 951 1188 1.0E-24
sp|Q5A1D3|ERK1_CANAL Extracellular signal-regulated kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CEK1 PE=1 SV=2 951 1188 1.0E-24
sp|Q7XUF4|CDKG2_ORYSJ Cyclin-dependent kinase G-2 OS=Oryza sativa subsp. japonica GN=CDKG-2 PE=2 SV=2 951 1261 1.0E-24
sp|A2XUW1|CDKG2_ORYSI Cyclin-dependent kinase G-2 OS=Oryza sativa subsp. indica GN=CDKG-2 PE=3 SV=1 951 1261 1.0E-24
sp|Q39022|MPK2_ARATH Mitogen-activated protein kinase 2 OS=Arabidopsis thaliana GN=MPK2 PE=1 SV=2 950 1260 1.0E-24
sp|B2MVY4|CDK4_SHEEP Cyclin-dependent kinase 4 OS=Ovis aries PE=2 SV=1 950 1247 1.0E-24
sp|Q32KY4|CDK4_BOVIN Cyclin-dependent kinase 4 OS=Bos taurus GN=CDK4 PE=2 SV=1 950 1247 1.0E-24
sp|Q40353|MMK2_MEDSA Mitogen-activated protein kinase homolog MMK2 OS=Medicago sativa GN=MMK2 PE=2 SV=1 954 1248 2.0E-24
sp|Q5ZCI1|MPK10_ORYSJ Mitogen-activated protein kinase 10 OS=Oryza sativa subsp. japonica GN=MPK10 PE=2 SV=2 937 1249 2.0E-24
sp|P48734|CDK1_BOVIN Cyclin-dependent kinase 1 OS=Bos taurus GN=CDK1 PE=2 SV=2 951 1248 2.0E-24
sp|Q4WUN7|MPKC_ASPFU Mitogen-activated protein kinase mpkC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mpkC PE=2 SV=2 957 1248 2.0E-24
sp|Q8I7M8|CDK17_CAEEL Cyclin-dependent kinase 17 OS=Caenorhabditis elegans GN=pct-1 PE=1 SV=1 951 1247 2.0E-24
sp|Q6AXJ9|CDKL1_DANRE Cyclin-dependent kinase-like 1 OS=Danio rerio GN=cdkl1 PE=2 SV=1 950 1284 2.0E-24
sp|P06493|CDK1_HUMAN Cyclin-dependent kinase 1 OS=Homo sapiens GN=CDK1 PE=1 SV=3 951 1248 2.0E-24
sp|Q7RM49|CDC2H_PLAYO Cell division control protein 2 homolog OS=Plasmodium yoelii yoelii GN=CRK2 PE=3 SV=1 950 1246 2.0E-24
sp|Q64261|CDK6_MOUSE Cyclin-dependent kinase 6 OS=Mus musculus GN=Cdk6 PE=1 SV=2 950 1244 2.0E-24
sp|Q9DGE2|MK14A_DANRE Mitogen-activated protein kinase 14A OS=Danio rerio GN=mapk14a PE=1 SV=1 950 1253 2.0E-24
sp|Q00534|CDK6_HUMAN Cyclin-dependent kinase 6 OS=Homo sapiens GN=CDK6 PE=1 SV=1 950 1247 2.0E-24
sp|Q96287|KSG8_ARATH Shaggy-related protein kinase theta OS=Arabidopsis thaliana GN=ASK8 PE=2 SV=3 956 1253 3.0E-24
sp|Q63686|CDK16_RAT Cyclin-dependent kinase 16 OS=Rattus norvegicus GN=Cdk16 PE=1 SV=1 951 1278 3.0E-24
sp|Q9LV37|MPK9_ARATH Mitogen-activated protein kinase 9 OS=Arabidopsis thaliana GN=MPK9 PE=2 SV=2 948 1170 4.0E-24
sp|Q9FGW5|CDKG1_ARATH Cyclin-dependent kinase G1 OS=Arabidopsis thaliana GN=CDKG1 PE=1 SV=1 937 1264 4.0E-24
sp|P43289|KSG3_ARATH Shaggy-related protein kinase gamma OS=Arabidopsis thaliana GN=ASK3 PE=2 SV=1 943 1260 4.0E-24
sp|Q84UI5|MPK1_ORYSJ Mitogen-activated protein kinase 1 OS=Oryza sativa subsp. japonica GN=MPK1 PE=1 SV=1 957 1248 5.0E-24
sp|Q5VN19|MPK11_ORYSJ Mitogen-activated protein kinase 11 OS=Oryza sativa subsp. japonica GN=MPK11 PE=2 SV=2 938 1170 5.0E-24
sp|Q6GLD8|CDK9_XENTR Cyclin-dependent kinase 9 OS=Xenopus tropicalis GN=cdk9 PE=2 SV=1 950 1254 5.0E-24
sp|Q8VZD5|KSG5_ARATH Shaggy-related protein kinase epsilon OS=Arabidopsis thaliana GN=ASK5 PE=2 SV=1 943 1266 5.0E-24
sp|P45984|MK09_HUMAN Mitogen-activated protein kinase 9 OS=Homo sapiens GN=MAPK9 PE=1 SV=2 950 1260 6.0E-24
sp|P20911|CDK7_XENLA Cyclin-dependent kinase 7 OS=Xenopus laevis GN=cdk7 PE=1 SV=1 948 1170 6.0E-24
sp|P43063|CDK1_CANAL Cyclin-dependent kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC28 PE=1 SV=1 951 1246 6.0E-24
sp|Q5Z9J0|MPK12_ORYSJ Mitogen-activated protein kinase 12 OS=Oryza sativa subsp. japonica GN=MPK12 PE=1 SV=2 948 1170 6.0E-24
sp|Q9Z2A6|MK15_RAT Mitogen-activated protein kinase 15 OS=Rattus norvegicus GN=Mapk15 PE=1 SV=2 946 1253 6.0E-24
sp|Q96WV9|CDK9_SCHPO Probable cyclin-dependent kinase 9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdk9 PE=1 SV=1 951 1259 6.0E-24
sp|Q5RCH1|CDK1_PONAB Cyclin-dependent kinase 1 OS=Pongo abelii GN=CDK1 PE=2 SV=1 951 1248 7.0E-24
sp|P49186|MK09_RAT Mitogen-activated protein kinase 9 OS=Rattus norvegicus GN=Mapk9 PE=1 SV=1 950 1260 7.0E-24
sp|Q39021|MPK1_ARATH Mitogen-activated protein kinase 1 OS=Arabidopsis thaliana GN=MPK1 PE=1 SV=2 950 1260 8.0E-24
sp|Q8WQG9|JNK1_CAEEL Stress-activated protein kinase jnk-1 OS=Caenorhabditis elegans GN=jnk-1 PE=1 SV=2 950 1248 8.0E-24
sp|Q336X9|MPK6_ORYSJ Mitogen-activated protein kinase 6 OS=Oryza sativa subsp. japonica GN=MPK6 PE=2 SV=1 954 1248 8.0E-24
sp|Q9HGY5|PHO85_CANAX Negative regulator of the PHO system OS=Candida albicans GN=PHO85 PE=3 SV=1 950 1244 9.0E-24
sp|P34556|CDK1_CAEEL Cyclin-dependent kinase 1 OS=Caenorhabditis elegans GN=cdk-1 PE=1 SV=1 954 1258 9.0E-24
sp|Q40884|MPK_PETHY Mitogen-activated protein kinase homolog 1 OS=Petunia hybrida GN=MPK1 PE=2 SV=1 950 1260 1.0E-23
sp|P51958|CDK1_CARAU Cyclin-dependent kinase 1 OS=Carassius auratus GN=cdk1 PE=2 SV=1 951 1259 1.0E-23
sp|Q0J4I1|CKB21_ORYSJ Cyclin-dependent kinase B2-1 OS=Oryza sativa subsp. japonica GN=CDKB2-1 PE=1 SV=1 951 1248 1.0E-23
sp|G5EFV5|CDK7_CAEEL Cyclin-dependent kinase 7 OS=Caenorhabditis elegans GN=cdk-7 PE=1 SV=1 947 1270 1.0E-23
sp|P39745|MPK1_CAEEL Mitogen-activated protein kinase mpk-1 OS=Caenorhabditis elegans GN=mpk-1 PE=1 SV=2 950 1253 1.0E-23
sp|Q5VP69|MPK16_ORYSJ Mitogen-activated protein kinase 16 OS=Oryza sativa subsp. japonica GN=MPK16 PE=2 SV=1 948 1249 1.0E-23
sp|Q26671|CDC2H_THEAN Cell division control protein 2 homolog OS=Theileria annulata GN=CRK2 PE=2 SV=1 950 1254 1.0E-23
sp|P11802|CDK4_HUMAN Cyclin-dependent kinase 4 OS=Homo sapiens GN=CDK4 PE=1 SV=2 950 1247 1.0E-23
sp|Q9ZVM9|Y1461_ARATH Probable serine/threonine-protein kinase At1g54610 OS=Arabidopsis thaliana GN=At1g54610 PE=1 SV=1 951 1265 1.0E-23
sp|Q6C7U8|PHO85_YARLI Negative regulator of the PHO system OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PHO85 PE=3 SV=1 950 1172 1.0E-23
sp|Q00536|CDK16_HUMAN Cyclin-dependent kinase 16 OS=Homo sapiens GN=CDK16 PE=1 SV=1 951 1170 2.0E-23
sp|O42376|MK12_DANRE Mitogen-activated protein kinase 12 OS=Danio rerio GN=mapk12 PE=2 SV=1 950 1248 2.0E-23
sp|Q06060|MPK_PEA Mitogen-activated protein kinase homolog D5 OS=Pisum sativum PE=2 SV=1 949 1248 2.0E-23
sp|Q00859|MAPK_FUSSO Mitogen-activated protein kinase OS=Fusarium solani subsp. pisi GN=MAPK PE=2 SV=1 950 1170 2.0E-23
sp|Q9C9M7|CDKD2_ARATH Cyclin-dependent kinase D-2 OS=Arabidopsis thaliana GN=CDKD-2 PE=1 SV=1 950 1284 2.0E-23
sp|Q9P419|HOG1_EMENI Mitogen-activated protein kinase hog1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hog1 PE=1 SV=1 950 1176 2.0E-23
sp|P35567|CDK1A_XENLA Cyclin-dependent kinase 1-A OS=Xenopus laevis GN=cdk1-a PE=1 SV=1 951 1246 2.0E-23
sp|Q27032|CDC2H_THEPA Cell division control protein 2 homolog OS=Theileria parva GN=CRK2 PE=3 SV=1 950 1253 2.0E-23
sp|P43288|KSG1_ARATH Shaggy-related protein kinase alpha OS=Arabidopsis thaliana GN=ASK1 PE=1 SV=3 943 1260 3.0E-23
sp|Q04735|CDK16_MOUSE Cyclin-dependent kinase 16 OS=Mus musculus GN=Cdk16 PE=1 SV=1 951 1170 3.0E-23
sp|Q6L5D4|MPK9_ORYSJ Mitogen-activated protein kinase 9 OS=Oryza sativa subsp. japonica GN=MPK9 PE=3 SV=2 948 1182 3.0E-23
sp|O74456|PEF1_SCHPO Serine/threonine-protein kinase pef1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pef1 PE=3 SV=2 951 1173 3.0E-23
sp|Q00772|SLT2_YEAST Mitogen-activated protein kinase SLT2/MPK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLT2 PE=1 SV=2 950 1254 3.0E-23
sp|Q9WTU6|MK09_MOUSE Mitogen-activated protein kinase 9 OS=Mus musculus GN=Mapk9 PE=1 SV=2 950 1260 3.0E-23
sp|Q4V862|CDK9A_XENLA Cyclin-dependent kinase 9-A OS=Xenopus laevis GN=cdk9-a PE=2 SV=1 950 1254 3.0E-23
sp|Q6K5F8|CDKG1_ORYSJ Cyclin-dependent kinase G-1 OS=Oryza sativa subsp. japonica GN=CDKG-1 PE=2 SV=1 951 1261 4.0E-23
sp|P42525|ERK1_DICDI Extracellular signal-regulated kinase 1 OS=Dictyostelium discoideum GN=erkA PE=2 SV=2 950 1254 4.0E-23
sp|P26696|MK01_XENLA Mitogen-activated protein kinase 1 OS=Xenopus laevis GN=mapk1 PE=1 SV=3 950 1260 4.0E-23
sp|Q41639|CDC2_VIGAC Cell division control protein 2 homolog OS=Vigna aconitifolia GN=CDC2 PE=2 SV=1 950 1251 5.0E-23
sp|A2X6X1|CDKG1_ORYSI Cyclin-dependent kinase G-1 OS=Oryza sativa subsp. indica GN=CDKG-1 PE=3 SV=1 951 1261 5.0E-23
sp|Q80Y86|MK15_MOUSE Mitogen-activated protein kinase 15 OS=Mus musculus GN=Mapk15 PE=1 SV=1 946 1253 5.0E-23
sp|O15264|MK13_HUMAN Mitogen-activated protein kinase 13 OS=Homo sapiens GN=MAPK13 PE=1 SV=1 957 1264 6.0E-23
sp|P24033|CDK1B_XENLA Cyclin-dependent kinase 1-B OS=Xenopus laevis GN=cdk1-b PE=1 SV=2 951 1259 6.0E-23
sp|Q0E459|MPK13_ORYSJ Mitogen-activated protein kinase 13 OS=Oryza sativa subsp. japonica GN=MPK13 PE=2 SV=1 948 1170 6.0E-23
sp|A2X0M1|MPK13_ORYSI Mitogen-activated protein kinase 13 OS=Oryza sativa subsp. indica GN=MPK13 PE=2 SV=2 948 1170 6.0E-23
sp|Q07176|MMK1_MEDSA Mitogen-activated protein kinase homolog MMK1 OS=Medicago sativa GN=MMK1 PE=1 SV=1 957 1248 6.0E-23
sp|P51139|MSK3_MEDSA Glycogen synthase kinase-3 homolog MsK-3 OS=Medicago sativa GN=MSK-3 PE=2 SV=2 943 1280 6.0E-23
sp|Q39026|MPK6_ARATH Mitogen-activated protein kinase 6 OS=Arabidopsis thaliana GN=MPK6 PE=1 SV=1 957 1248 6.0E-23
sp|Q40531|NTF6_TOBAC Mitogen-activated protein kinase homolog NTF6 OS=Nicotiana tabacum GN=NTF6 PE=2 SV=1 954 1247 6.0E-23
sp|Q5ZKN1|CDK9_CHICK Cyclin-dependent kinase 9 OS=Gallus gallus GN=CDK9 PE=2 SV=1 950 1254 7.0E-23
sp|Q9DGA5|CDK1_ORYCU Cyclin-dependent kinase 1 OS=Oryzias curvinotus GN=cdk1 PE=2 SV=1 951 1257 7.0E-23
sp|Q9N272|MK13_PANTR Mitogen-activated protein kinase 13 OS=Pan troglodytes GN=MAPK13 PE=2 SV=1 957 1264 8.0E-23
sp|B0VXL7|CDK14_CALMO Cyclin-dependent kinase 14 OS=Callicebus moloch GN=CDK14 PE=3 SV=1 951 1248 8.0E-23
sp|Q8GYQ5|MPK12_ARATH Mitogen-activated protein kinase 12 OS=Arabidopsis thaliana GN=MPK12 PE=1 SV=1 954 1248 9.0E-23
sp|Q9DG98|CDK1_ORYLU Cyclin-dependent kinase 1 OS=Oryzias luzonensis GN=cdk1 PE=2 SV=1 951 1257 1.0E-22
sp|Q9DGD3|CDK1_ORYLA Cyclin-dependent kinase 1 OS=Oryzias latipes GN=cdk1 PE=2 SV=1 951 1257 1.0E-22
sp|Q9LMT0|CDKD3_ARATH Cyclin-dependent kinase D-3 OS=Arabidopsis thaliana GN=CDKD-3 PE=1 SV=1 947 1260 1.0E-22
sp|A8WIP6|CDK20_DANRE Cyclin-dependent kinase 20 OS=Danio rerio GN=cdk20 PE=2 SV=1 950 1261 1.0E-22
sp|B0VXE8|CDK14_CALJA Cyclin-dependent kinase 14 OS=Callithrix jacchus GN=CDK14 PE=3 SV=1 951 1248 1.0E-22
sp|Q9DGA2|CDK1_ORYJA Cyclin-dependent kinase 1 OS=Oryzias javanicus GN=cdk1 PE=2 SV=1 951 1257 1.0E-22
sp|Q8W4J2|MPK16_ARATH Mitogen-activated protein kinase 16 OS=Arabidopsis thaliana GN=MPK16 PE=2 SV=2 950 1249 1.0E-22
sp|P51138|MSK2_MEDSA Glycogen synthase kinase-3 homolog MsK-2 OS=Medicago sativa GN=MSK-2 PE=2 SV=1 957 1260 1.0E-22
sp|O08911|MK12_MOUSE Mitogen-activated protein kinase 12 OS=Mus musculus GN=Mapk12 PE=1 SV=1 951 1246 1.0E-22
sp|O44408|KGB1_CAEEL GLH-binding kinase 1 OS=Caenorhabditis elegans GN=kgb-1 PE=1 SV=2 950 1247 1.0E-22
sp|Q4PKS0|HOG1_GIBIN Mitogen-activated protein kinase HOG1 (Fragment) OS=Gibberella intermedia GN=HOG1 PE=3 SV=1 1030 1175 1.0E-22
sp|P32581|IME2_YEAST Meiosis induction protein kinase IME2/SME1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IME2 PE=3 SV=1 942 1258 1.0E-22
sp|P54665|CC2H2_TRYBB Cell division control protein 2 homolog 2 OS=Trypanosoma brucei brucei GN=CRK2 PE=3 SV=1 950 1247 1.0E-22
sp|Q32MK0|MYLK3_HUMAN Myosin light chain kinase 3 OS=Homo sapiens GN=MYLK3 PE=2 SV=3 951 1262 2.0E-22
sp|Q00526|CDK3_HUMAN Cyclin-dependent kinase 3 OS=Homo sapiens GN=CDK3 PE=1 SV=1 951 1258 2.0E-22
sp|Q9C9U2|CDKD1_ARATH Cyclin-dependent kinase D-1 OS=Arabidopsis thaliana GN=CDKD-1 PE=1 SV=1 947 1279 2.0E-22
sp|Q4PNJ1|HOG1_FUSCU Mitogen-activated protein kinase HOG1 (Fragment) OS=Fusarium culmorum GN=HOG1 PE=3 SV=1 1030 1175 2.0E-22
sp|P16892|FUS3_YEAST Mitogen-activated protein kinase FUS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUS3 PE=1 SV=2 951 1253 2.0E-22
sp|P13863|CDK1_CHICK Cyclin-dependent kinase 1 OS=Gallus gallus GN=CDK1 PE=1 SV=1 951 1256 2.0E-22
sp|Q00537|CDK17_HUMAN Cyclin-dependent kinase 17 OS=Homo sapiens GN=CDK17 PE=1 SV=2 951 1247 2.0E-22
sp|O35495|CDK14_MOUSE Cyclin-dependent kinase 14 OS=Mus musculus GN=Cdk14 PE=1 SV=2 951 1248 2.0E-22
sp|Q00535|CDK5_HUMAN Cyclin-dependent-like kinase 5 OS=Homo sapiens GN=CDK5 PE=1 SV=3 950 1248 3.0E-22
sp|Q9LM33|MPK8_ARATH Mitogen-activated protein kinase 8 OS=Arabidopsis thaliana GN=MPK8 PE=1 SV=2 948 1170 3.0E-22
sp|P49615|CDK5_MOUSE Cyclin-dependent-like kinase 5 OS=Mus musculus GN=Cdk5 PE=1 SV=1 950 1248 3.0E-22
sp|Q02399|CDK5_BOVIN Cyclin-dependent-like kinase 5 OS=Bos taurus GN=CDK5 PE=1 SV=2 950 1248 3.0E-22
sp|Q3T0N5|MK13_BOVIN Mitogen-activated protein kinase 13 OS=Bos taurus GN=MAPK13 PE=2 SV=1 957 1264 3.0E-22
sp|P00546|CDK1_YEAST Cyclin-dependent kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC28 PE=1 SV=1 951 1246 4.0E-22
sp|Q9SJG9|MPK20_ARATH Mitogen-activated protein kinase 20 OS=Arabidopsis thaliana GN=MPK20 PE=1 SV=2 948 1170 4.0E-22
sp|Q5RDG7|MYLK3_PONAB Myosin light chain kinase 3 OS=Pongo abelii GN=MYLK3 PE=2 SV=3 951 1262 4.0E-22
sp|C0RW22|CDK14_DASNO Cyclin-dependent kinase 14 OS=Dasypus novemcinctus GN=CDK14 PE=3 SV=1 951 1248 4.0E-22
sp|Q63538|MK12_RAT Mitogen-activated protein kinase 12 OS=Rattus norvegicus GN=Mapk12 PE=1 SV=1 951 1246 4.0E-22
sp|P53778|MK12_HUMAN Mitogen-activated protein kinase 12 OS=Homo sapiens GN=MAPK12 PE=1 SV=3 951 1246 4.0E-22
sp|Q8LG64|CKB22_ARATH Cyclin-dependent kinase B2-2 OS=Arabidopsis thaliana GN=CDKB2-2 PE=1 SV=2 951 1246 4.0E-22
sp|O94921|CDK14_HUMAN Cyclin-dependent kinase 14 OS=Homo sapiens GN=CDK14 PE=1 SV=3 951 1248 5.0E-22
sp|Q3V3A1|CDK15_MOUSE Cyclin-dependent kinase 15 OS=Mus musculus GN=Cdk15 PE=2 SV=2 951 1170 5.0E-22
sp|Q38773|CDC2B_ANTMA Cell division control protein 2 homolog B (Fragment) OS=Antirrhinum majus GN=CDC2B PE=2 SV=1 961 1246 5.0E-22
sp|Q9DGD9|MK08_DANRE Mitogen-activated protein kinase 8 OS=Danio rerio GN=mapk8 PE=2 SV=1 935 1256 5.0E-22
sp|P21965|MCK1_YEAST Protein kinase MCK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCK1 PE=1 SV=1 1051 1248 5.0E-22
sp|Q8K0D0|CDK17_MOUSE Cyclin-dependent kinase 17 OS=Mus musculus GN=Cdk17 PE=1 SV=2 951 1247 6.0E-22
sp|O14132|PIT1_SCHPO Sporulation protein kinase pit1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pit1 PE=1 SV=1 951 1263 6.0E-22
sp|Q8SR86|CDK1_ENCCU Cyclin-dependent kinase 1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC28 PE=3 SV=1 951 1249 7.0E-22
sp|B6A7Q3|CDK14_RABIT Cyclin-dependent kinase 14 OS=Oryctolagus cuniculus GN=CDK14 PE=3 SV=1 951 1248 8.0E-22
sp|Q39024|MPK4_ARATH Mitogen-activated protein kinase 4 OS=Arabidopsis thaliana GN=MPK4 PE=1 SV=2 957 1248 9.0E-22
sp|P92208|JNK_DROME Stress-activated protein kinase JNK OS=Drosophila melanogaster GN=bsk PE=1 SV=1 939 1279 1.0E-21
sp|P51166|CDK5_XENLA Cyclin-dependent-like kinase 5 OS=Xenopus laevis GN=cdk5 PE=2 SV=1 950 1248 1.0E-21
sp|Q54QB1|ERK2_DICDI Extracellular signal-regulated kinase 2 OS=Dictyostelium discoideum GN=erkB PE=1 SV=1 946 1254 1.0E-21
sp|Q9WTY9|MK13_RAT Mitogen-activated protein kinase 13 OS=Rattus norvegicus GN=Mapk13 PE=1 SV=1 957 1264 1.0E-21
sp|Q03114|CDK5_RAT Cyclin-dependent-like kinase 5 OS=Rattus norvegicus GN=Cdk5 PE=1 SV=1 950 1248 2.0E-21
sp|O35831|CDK17_RAT Cyclin-dependent kinase 17 OS=Rattus norvegicus GN=Cdk17 PE=1 SV=1 951 1170 2.0E-21
sp|Q04770|CDK2_ENTHI Cell division protein kinase 2 homolog OS=Entamoeba histolytica GN=CDC2 PE=3 SV=1 950 1253 2.0E-21
sp|Q09437|YP62_CAEEL Putative serine/threonine-protein kinase B0495.2 OS=Caenorhabditis elegans GN=B0495.2 PE=3 SV=1 951 1248 2.0E-21
sp|A8XA58|CDK1_CAEBR Cyclin-dependent kinase 1 OS=Caenorhabditis briggsae GN=cdk-1 PE=3 SV=1 954 1258 2.0E-21
sp|O61847|CDK2_CAEEL Cyclin-dependent kinase 2 OS=Caenorhabditis elegans GN=cdk-2 PE=1 SV=2 941 1246 2.0E-21
sp|Q2V419|CKB12_ARATH Cyclin-dependent kinase B1-2 OS=Arabidopsis thaliana GN=CDKB1-2 PE=1 SV=2 950 1170 2.0E-21
sp|Q9M1Z5|MPK10_ARATH Mitogen-activated protein kinase 10 OS=Arabidopsis thaliana GN=MPK10 PE=1 SV=1 954 1248 2.0E-21
sp|Q6ZAG3|CDKC3_ORYSJ Cyclin-dependent kinase C-3 OS=Oryza sativa subsp. japonica GN=CDKC-1 PE=3 SV=2 954 1242 3.0E-21
sp|O42099|MK08B_CYPCA Mitogen-activated protein kinase 8B OS=Cyprinus carpio GN=mapk8b PE=2 SV=1 935 1260 3.0E-21
sp|Q9C9U4|MPK15_ARATH Mitogen-activated protein kinase 15 OS=Arabidopsis thaliana GN=MPK15 PE=1 SV=3 948 1249 3.0E-21
sp|O60145|PPK23_SCHPO Serine/threonine-protein kinase ppk23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk23 PE=3 SV=1 951 1268 4.0E-21
sp|Q3UIZ8|MYLK3_MOUSE Myosin light chain kinase 3 OS=Mus musculus GN=Mylk3 PE=1 SV=1 955 1164 4.0E-21
sp|E9PT87|MYLK3_RAT Myosin light chain kinase 3 OS=Rattus norvegicus GN=Mylk3 PE=1 SV=1 955 1164 4.0E-21
sp|Q9LMM5|MPK11_ARATH Mitogen-activated protein kinase 11 OS=Arabidopsis thaliana GN=MPK11 PE=1 SV=1 926 1248 5.0E-21
sp|Q871M9|BUR1_NEUCR Serine/threonine-protein kinase bur1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=stk-1 PE=3 SV=2 951 1296 5.0E-21
sp|Q12222|YGK3_YEAST Glycogen synthase kinase-3 homolog YGK3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGK3 PE=1 SV=1 957 1246 5.0E-21
sp|P54685|CDK7_DICDI Cyclin-dependent kinase 7 OS=Dictyostelium discoideum GN=cdk7 PE=2 SV=2 950 1256 5.0E-21
sp|Q9Z1B7|MK13_MOUSE Mitogen-activated protein kinase 13 OS=Mus musculus GN=Mapk13 PE=1 SV=2 957 1264 5.0E-21
sp|Q8SRF5|Y823_ENCCU Probable cell division protein kinase ECU08_0230 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_0230 PE=3 SV=1 950 1163 8.0E-21
sp|Q556J6|Y4007_DICDI Putative cyclin-dependent serine/threonine-protein kinase DDB_G0272797/DDB_G0274007 OS=Dictyostelium discoideum GN=DDB_G0272797 PE=3 SV=1 951 1170 9.0E-21
sp|Q966Y3|JNK_SUBDO Stress-activated protein kinase JNK OS=Suberites domuncula GN=JNK PE=2 SV=1 950 1262 1.0E-20
sp|P36005|KDX1_YEAST Serine/threonine-protein kinase KDX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KDX1 PE=1 SV=1 1020 1248 1.0E-20
sp|Q2PQN9|CDK5_GLOMM Cyclin-dependent kinase 5 homolog OS=Glossina morsitans morsitans GN=Cdk5 PE=2 SV=1 950 1248 1.0E-20
sp|Q00646|CDK1_EMENI Cyclin-dependent kinase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nimX PE=2 SV=1 951 1246 1.0E-20
sp|Q90327|MK08A_CYPCA Mitogen-activated protein kinase 8A OS=Cyprinus carpio GN=mapk8a PE=2 SV=1 935 1260 1.0E-20
sp|Q38775|CDC2D_ANTMA Cell division control protein 2 homolog D OS=Antirrhinum majus GN=CDC2D PE=2 SV=1 954 1246 1.0E-20
sp|Q6DJM7|CDK14_XENLA Cyclin-dependent kinase 14 OS=Xenopus laevis GN=cdk14 PE=2 SV=1 951 1248 2.0E-20
sp|Q9VPC0|KP58_DROME Serine/threonine-protein kinase PITSLRE OS=Drosophila melanogaster GN=Pitslre PE=1 SV=1 939 1337 2.0E-20
sp|O60285|NUAK1_HUMAN NUAK family SNF1-like kinase 1 OS=Homo sapiens GN=NUAK1 PE=1 SV=1 946 1153 2.0E-20
sp|P50873|MRK1_YEAST Serine/threonine-protein kinase MRK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRK1 PE=1 SV=2 955 1251 2.0E-20
sp|Q96Q40|CDK15_HUMAN Cyclin-dependent kinase 15 OS=Homo sapiens GN=CDK15 PE=1 SV=2 951 1170 2.0E-20
sp|A4IIW7|CDK14_XENTR Cyclin-dependent kinase 14 OS=Xenopus tropicalis GN=cdk14 PE=2 SV=1 951 1172 3.0E-20
sp|Q9LQQ9|MPK13_ARATH Mitogen-activated protein kinase 13 OS=Arabidopsis thaliana GN=MPK13 PE=1 SV=1 954 1248 3.0E-20
sp|P52389|CDC2_VIGUN Cell division control protein 2 homolog OS=Vigna unguiculata GN=CDC2 PE=2 SV=1 950 1172 3.0E-20
sp|Q92398|SPM1_SCHPO Mitogen-activated protein kinase spm1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spm1 PE=1 SV=1 951 1254 3.0E-20
sp|Q5R7G9|NUAK2_PONAB NUAK family SNF1-like kinase 2 OS=Pongo abelii GN=NUAK2 PE=2 SV=1 946 1157 3.0E-20
sp|Q9H093|NUAK2_HUMAN NUAK family SNF1-like kinase 2 OS=Homo sapiens GN=NUAK2 PE=1 SV=1 946 1157 3.0E-20
sp|Q641K5|NUAK1_MOUSE NUAK family SNF1-like kinase 1 OS=Mus musculus GN=Nuak1 PE=1 SV=1 946 1153 4.0E-20
sp|P51953|CDK7_CARAU Cyclin-dependent kinase 7 OS=Carassius auratus GN=cdk7 PE=2 SV=1 951 1265 4.0E-20
sp|P49187|MK10_RAT Mitogen-activated protein kinase 10 OS=Rattus norvegicus GN=Mapk10 PE=1 SV=2 908 1279 6.0E-20
sp|Q5J4W4|MPK2_ORYSJ Mitogen-activated protein kinase 2 OS=Oryza sativa subsp. japonica GN=MPK2 PE=2 SV=1 954 1248 7.0E-20
sp|Q84M93|MPK17_ARATH Mitogen-activated protein kinase 17 OS=Arabidopsis thaliana GN=MPK17 PE=2 SV=1 948 1249 8.0E-20
sp|P62345|CDPK4_PLABA Calcium-dependent protein kinase 4 OS=Plasmodium berghei (strain Anka) GN=CPK4 PE=1 SV=2 950 1160 9.0E-20
sp|Q7RJG2|CDPK4_PLAYO Calcium-dependent protein kinase 4 OS=Plasmodium yoelii yoelii GN=CPK4 PE=3 SV=3 950 1160 9.0E-20
sp|Q8IBS5|CDPK4_PLAF7 Calcium-dependent protein kinase 4 OS=Plasmodium falciparum (isolate 3D7) GN=CPK4 PE=1 SV=3 950 1160 1.0E-19
sp|A8C984|MYLK3_DANRE Myosin light chain kinase 3 OS=Danio rerio GN=mylk3 PE=2 SV=1 954 1164 1.0E-19
sp|Q8L4P8|CKB11_ORYSJ Cyclin-dependent kinase B1-1 OS=Oryza sativa subsp. japonica GN=CDKB1-1 PE=2 SV=1 950 1246 1.0E-19
sp|P54119|CDK1_AJECA Cyclin-dependent kinase 1 OS=Ajellomyces capsulatus GN=CDC2 PE=3 SV=1 951 1259 1.0E-19
sp|Q61831|MK10_MOUSE Mitogen-activated protein kinase 10 OS=Mus musculus GN=Mapk10 PE=1 SV=2 908 1279 1.0E-19
sp|O43077|MDE3_SCHPO Sporulation protein kinase mde3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mde3 PE=3 SV=1 950 1170 1.0E-19
sp|Q11179|YPC2_CAEEL Putative serine/threonine-protein kinase C05D10.2 OS=Caenorhabditis elegans GN=C05D10.2 PE=3 SV=2 946 1247 1.0E-19
sp|Q4P9T2|SSN3_USTMA Serine/threonine-protein kinase SSN3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SSN3 PE=3 SV=2 990 1257 1.0E-19
sp|Q9U9Y8|NLK_CAEEL Serine/threonine kinase NLK OS=Caenorhabditis elegans GN=lit-1 PE=1 SV=1 957 1247 1.0E-19
sp|P97377|CDK2_MOUSE Cyclin-dependent kinase 2 OS=Mus musculus GN=Cdk2 PE=1 SV=2 951 1259 2.0E-19
sp|Q4I5U9|BUR1_GIBZE Serine/threonine-protein kinase BUR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=BUR1 PE=3 SV=2 951 1265 2.0E-19
sp|Q5AAG6|MKC1_CANAL Mitogen-activated protein kinase MKC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MKC1 PE=1 SV=1 950 1253 2.0E-19
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0044238 primary metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0044267 cellular protein metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0016301 kinase activity No
GO:0044260 cellular macromolecule metabolic process No
GO:0008144 drug binding No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0003824 catalytic activity No
GO:0016310 phosphorylation No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006464 cellular protein modification process No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0043170 macromolecule metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0019538 protein metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11239
MLTAPASNHHHPLPVTRNGQVGQPAPTTAPYDFLPSVSFDDLHASIESASSDFKLTQFPSAAGEGAVLESKGMPD
RKLPPQRQLPAAHANGQPRPGNPPVANRTGRSGSILRRPSMSGRHPSNSSIVSSSSGTLDAPSGPPPARSRRQSH
YPPISNAHVAPKPPRKSIGPGIVGDADGGKRSSQGRRPSLLGDRGPGPDSARRSVDSFSAPAHDAPRHHAANSRA
VKAKSVQPPMRPSQASAFAASSLTPEQNRLSTLAPRSPRVSGRSLPQPSGGKRASMMPGAHHPSHATGLGARTIS
PTDTRRMKRLSTMPHSQSLNAISSVPPPPPLLSMDIRANSKSPSMIPRRTSATPSSSRTTPDASNRKSYSSGLSV
GSAASFNTMRTSSASLQPRLPQSSSASRLPAPKHTPAHNPLPADDDEDVPPVPAIPKAYESPKDSPAETYFLDKR
KTSLPAVDSLGGYGNAAGNIPISAYPEPTKAQQQYRADARKSSMPPPASTEEANASQAKRQLQPLRLPPLNIGPL
NLPPGGKAAAAQDLAGSGRDLSPPPSRQLPKTPTTPMTASKSSFFSKTKYDETIELPCLRSRSSIHQAYRVTPTP
PDADSSSSSIALSETNLKSSLSPFLSSSLPKGGLEHGLLKRSKTGGDYHTLTGNEFDAMHQRKAAGLRSSGTGKT
TPKSPSPPDPVSEELRTPSSMNSLRRKLSLSWRRGNSKAGIASSGDNAVEMPTAQLHANPDTMPPPRLPAAASSN
SLANPKRLDTSPTMHAGGAFLESRRRKNSAASQTAHFTHDRVKSDNWVIKKENKTDSVTLPVSHSMGLSHKMLKP
KPSLCAFSSGAYSAVELDKDDLAAEEEMRKMGSRRKETEIAARALDALRKRATPKERVSPHEAIRIALLNIYERG
EIIDFDDIYFCGTQNAHKVVGDVQSDAPNFGYDDERGDYTIVPGDHLAYRYEIIDVLGKGSFGQVVRCIDHKLGV
LVAVKIIRNKKRFHQQALVEVNILQRLREWDPKNRHSMVSFTQHFYFRGHLCISTELLDMNLYEFIKAHAFRGFS
LRIIRRFTKQILSSLILLKQRKVIHCDLKPENILLRHPLHSEIKVIDFGSSCFENEKVYTYIQSRFYRSPEVILG
MTYGMPIDMWSVGCILAELYTGVPIFPGENEQEQLACIMEVFGPPEKHLIEKSTRRKLFFDSVGKPRLTVSSKGR
RRRPSSKTLQQVLKCDDEVFVDFLARCLRWDPERRLKPEEAVRHEFISGQKAPAPAARLPTRDPSPVKRNNTVST
PRPLPDPPGATGKGIMAGRTGVSPHKQPPGAARRVSGATAATAASTNRRTSGGSGSISGGFSGLPRAAGRTASGK
HDLAAAGASAAMTRRA*
Coding >Hirsu2|11239
ATGCTCACCGCGCCTGCTTCCAATCACCACCACCCTCTTCCCGTTACTCGAAATGGCCAAGTGGGCCAGCCCGCA
CCGACCACCGCGCCCTACGACTTCCTGCCCTCGGTCAGCTTCGATGACCTCCACGCCAGCATCGAGTCCGCCTCG
TCCGACTTCAAGCTGACCCAGTTCCCCTCCGCCGCCGGCGAGGGCGCCGTCCTCGAATCCAAGGGCATGCCCGAC
CGCAAGCTGCCGCCCCAGAGGCAGCTCCCTGCCGCCCACGCCAACGGCCAGCCGCGCCCCGGCAACCCCCCCGTC
GCCAACAGAACTGGCCGCTCCGGCTCCATCCTGCGAAGGCCCAGCATGTCGGGCAGGCACCCGAGCAACTCGTCC
ATCGTCTCCTCCTCCTCCGGCACCCTCGATGCCCCGTCGGGCCCCCCGCCCGCGCGCAGCCGCCGTCAGAGCCAC
TACCCCCCCATCTCCAATGCCCACGTCGCCCCCAAGCCCCCCCGCAAGTCCATCGGCCCCGGCATCGTGGGCGAC
GCCGATGGCGGGAAACGGAGCTCGCAGGGGCGACGTCCCAGCTTGCTGGGCGATCGCGGCCCCGGCCCCGACTCG
GCTCGGAGATCTGTCGATAGCTTTTCCGCTCCCGCACACGACGCACCGCGCCACCACGCGGCAAACTCGAGGGCC
GTCAAGGCCAAATCTGTGCAACCGCCCATGCGCCCGAGCCAAGCAAGCGCCTTTGCTGCTTCCAGCCTGACCCCC
GAGCAGAATCGCCTGTCGACGCTGGCTCCGCGCTCGCCACGTGTCTCCGGCAGAAGTTTGCCCCAGCCGTCGGGC
GGGAAACGGGCATCCATGATGCCCGGCGCCCACCATCCCTCCCACGCGACGGGCCTGGGCGCCCGTACCATAAGT
CCCACCGACACGAGAAGGATGAAGCGTCTGTCGACGATGCCGCACTCGCAAAGCCTCAACGCCATTTCCAGCGTG
CCGCCGCCCCCGCCACTACTGTCCATGGACATCCGCGCCAACTCCAAGTCGCCCTCCATGATCCCTCGCAGGACG
TCCGCCACGCCCTCCTCGTCCCGGACGACGCCCGACGCCAGCAACCGCAAGTCGTACAGTTCGGGCCTGTCCGTC
GGCTCGGCCGCGAGCTTCAACACCATGCGGACCTCGTCGGCATCGCTGCAGCCTAGGCTGCCCCAGTCGTCGTCT
GCCTCCCGCCTTCCCGCGCCCAAGCACACGCCTGCGCACAATCCGCTCCCCGCCGACGACGACGAGGACGTCCCT
CCGGTCCCGGCCATACCCAAGGCCTACGAGTCTCCCAAGGACTCTCCGGCCGAGACATACTTTTTGGACAAGAGA
AAGACGAGCTTGCCTGCCGTCGACTCCCTGGGCGGATACGGAAACGCGGCAGGAAACATCCCCATATCCGCTTAC
CCCGAGCCCACAAAGGCACAGCAGCAGTACAGGGCCGACGCCCGCAAAAGCTCGATGCCGCCGCCCGCGAGCACG
GAGGAGGCCAACGCCTCGCAGGCCAAGAGGCAGCTCCAGCCGCTGAGGCTGCCACCCCTGAACATCGGGCCTCTC
AACCTTCCGCCTGGTGGCAAGGCCGCCGCCGCGCAGGACCTGGCCGGCTCGGGGCGTGACTTGAGCCCGCCGCCC
TCGAGGCAGCTGCCCAAGACGCCCACGACCCCGATGACCGCTTCCAAGAGCTCCTTCTTCTCCAAGACCAAGTAC
GACGAAACGATCGAACTACCATGCCTCCGGAGCAGAAGCTCTATTCATCAGGCCTATCGGGTGACGCCCACGCCG
CCCGACGCCGATTCCTCGAGCTCTTCCATTGCTCTTTCGGAAACTAATCTCAAGTCAAGCCTGTCGCCCTTCCTG
TCGTCCTCCCTGCCCAAAGGAGGCTTGGAACACGGCCTTCTGAAGAGGTCGAAGACGGGCGGAGACTACCACACC
CTCACCGGCAACGAATTCGACGCCATGCATCAGCGCAAGGCGGCCGGCCTGAGAAGCTCGGGCACCGGCAAGACG
ACGCCGAAATCCCCGTCGCCTCCGGACCCCGTTTCCGAGGAGCTTCGGACCCCGTCGTCCATGAACTCGCTGAGA
CGAAAACTCAGCCTGTCGTGGCGGCGAGGCAACTCAAAGGCCGGCATTGCCTCCTCCGGGGACAATGCCGTCGAG
ATGCCCACGGCTCAGCTGCACGCGAATCCGGACACGATGCCGCCGCCACGGCTTCCCGCAGCCGCCTCGAGTAAC
AGCCTGGCGAACCCGAAGCGCTTGGATACCAGCCCCACGATGCACGCCGGCGGCGCCTTCTTGGAGTCCAGAAGA
CGGAAGAACTCTGCGGCGAGCCAGACGGCTCATTTCACCCACGACAGAGTCAAGAGCGACAACTGGGTCATCAAG
AAGGAGAACAAGACCGACTCGGTCACGCTGCCCGTCTCCCATAGCATGGGGCTGTCGCACAAGATGCTCAAGCCC
AAGCCCTCGCTGTGTGCCTTTTCCTCCGGTGCATATTCGGCCGTGGAGCTGGACAAGGATGACCTGGCCGCAGAA
GAGGAAATGCGCAAGATGGGCTCCCGGCGCAAGGAGACGGAGATCGCGGCGAGGGCGCTCGACGCGCTGAGGAAG
CGGGCGACGCCCAAGGAGCGCGTCAGCCCCCACGAAGCCATCCGCATCGCCCTCTTGAACATCTACGAGCGGGGA
GAAATCATCGACTTCGACGACATTTACTTTTGCGGGACGCAGAACGCCCACAAGGTGGTGGGCGACGTGCAGTCG
GACGCACCCAACTTCGGCTACGATGACGAGCGCGGAGACTACACCATCGTACCCGGCGACCACCTCGCGTACCGA
TACGAGATCATCGACGTGCTGGGAAAGGGAAGCTTCGGGCAGGTGGTGCGGTGTATCGACCACAAGCTGGGCGTC
CTGGTGGCGGTCAAGATCATCAGGAACAAGAAGAGGTTCCACCAGCAGGCCCTTGTCGAGGTCAATATTCTGCAG
AGGCTTCGCGAATGGGATCCCAAGAACCGTCACAGCATGGTCAGCTTCACCCAGCACTTTTACTTCCGAGGGCAT
TTGTGCATCTCAACCGAGCTGCTCGACATGAACCTGTACGAGTTCATCAAGGCCCACGCCTTCCGCGGCTTCTCC
CTGCGGATAATCCGGCGCTTCACCAAGCAGATTCTCAGCTCGCTCATCCTGTTGAAGCAGCGCAAGGTCATCCAC
TGCGACCTAAAACCCGAGAACATCCTGCTTCGGCACCCGCTCCACTCGGAGATCAAGGTGATTGACTTCGGCTCC
AGCTGCTTCGAAAACGAGAAGGTGTACACGTACATCCAGTCCCGCTTCTACCGCTCGCCCGAGGTGATTCTGGGC
ATGACATACGGAATGCCAATCGACATGTGGAGCGTCGGTTGCATCCTGGCCGAGCTGTACACGGGCGTCCCCATC
TTCCCGGGTGAGAACGAGCAAGAGCAGCTCGCGTGCATCATGGAGGTGTTTGGGCCGCCGGAGAAGCACCTGATC
GAGAAGAGCACGCGCAGGAAGCTTTTCTTCGACTCGGTCGGCAAACCGCGACTGACCGTCTCGTCCAAGGGCCGG
CGGCGCCGTCCGTCGTCTAAGACGCTGCAGCAGGTGCTCAAGTGCGACGACGAGGTCTTTGTCGACTTCCTGGCG
CGCTGCCTGCGCTGGGACCCAGAGCGACGACTGAAGCCCGAGGAGGCGGTGCGCCATGAGTTCATTAGCGGGCAG
AAGGCGCCGGCGCCGGCGGCGCGGCTGCCGACGCGCGACCCGTCGCCGGTCAAGCGCAACAACACCGTGTCGACG
CCTCGGCCGTTACCGGATCCGCCCGGGGCCACGGGCAAGGGAATCATGGCCGGGCGCACGGGCGTGAGCCCCCAC
AAGCAGCCTCCCGGGGCGGCCAGGCGGGTCTCGGGGGCGACGGCGGCGACGGCGGCCAGCACCAACAGGAGGACG
AGCGGCGGCAGCGGATCCATCAGCGGCGGGTTCAGTGGCCTTCCCCGCGCGGCCGGCAGGACGGCGAGCGGGAAG
CACGATCTCGCGGCGGCGGGAGCGTCGGCGGCAATGACTCGCAGGGCATAG
Transcript >Hirsu2|11239
ATGCTCACCGCGCCTGCTTCCAATCACCACCACCCTCTTCCCGTTACTCGAAATGGCCAAGTGGGCCAGCCCGCA
CCGACCACCGCGCCCTACGACTTCCTGCCCTCGGTCAGCTTCGATGACCTCCACGCCAGCATCGAGTCCGCCTCG
TCCGACTTCAAGCTGACCCAGTTCCCCTCCGCCGCCGGCGAGGGCGCCGTCCTCGAATCCAAGGGCATGCCCGAC
CGCAAGCTGCCGCCCCAGAGGCAGCTCCCTGCCGCCCACGCCAACGGCCAGCCGCGCCCCGGCAACCCCCCCGTC
GCCAACAGAACTGGCCGCTCCGGCTCCATCCTGCGAAGGCCCAGCATGTCGGGCAGGCACCCGAGCAACTCGTCC
ATCGTCTCCTCCTCCTCCGGCACCCTCGATGCCCCGTCGGGCCCCCCGCCCGCGCGCAGCCGCCGTCAGAGCCAC
TACCCCCCCATCTCCAATGCCCACGTCGCCCCCAAGCCCCCCCGCAAGTCCATCGGCCCCGGCATCGTGGGCGAC
GCCGATGGCGGGAAACGGAGCTCGCAGGGGCGACGTCCCAGCTTGCTGGGCGATCGCGGCCCCGGCCCCGACTCG
GCTCGGAGATCTGTCGATAGCTTTTCCGCTCCCGCACACGACGCACCGCGCCACCACGCGGCAAACTCGAGGGCC
GTCAAGGCCAAATCTGTGCAACCGCCCATGCGCCCGAGCCAAGCAAGCGCCTTTGCTGCTTCCAGCCTGACCCCC
GAGCAGAATCGCCTGTCGACGCTGGCTCCGCGCTCGCCACGTGTCTCCGGCAGAAGTTTGCCCCAGCCGTCGGGC
GGGAAACGGGCATCCATGATGCCCGGCGCCCACCATCCCTCCCACGCGACGGGCCTGGGCGCCCGTACCATAAGT
CCCACCGACACGAGAAGGATGAAGCGTCTGTCGACGATGCCGCACTCGCAAAGCCTCAACGCCATTTCCAGCGTG
CCGCCGCCCCCGCCACTACTGTCCATGGACATCCGCGCCAACTCCAAGTCGCCCTCCATGATCCCTCGCAGGACG
TCCGCCACGCCCTCCTCGTCCCGGACGACGCCCGACGCCAGCAACCGCAAGTCGTACAGTTCGGGCCTGTCCGTC
GGCTCGGCCGCGAGCTTCAACACCATGCGGACCTCGTCGGCATCGCTGCAGCCTAGGCTGCCCCAGTCGTCGTCT
GCCTCCCGCCTTCCCGCGCCCAAGCACACGCCTGCGCACAATCCGCTCCCCGCCGACGACGACGAGGACGTCCCT
CCGGTCCCGGCCATACCCAAGGCCTACGAGTCTCCCAAGGACTCTCCGGCCGAGACATACTTTTTGGACAAGAGA
AAGACGAGCTTGCCTGCCGTCGACTCCCTGGGCGGATACGGAAACGCGGCAGGAAACATCCCCATATCCGCTTAC
CCCGAGCCCACAAAGGCACAGCAGCAGTACAGGGCCGACGCCCGCAAAAGCTCGATGCCGCCGCCCGCGAGCACG
GAGGAGGCCAACGCCTCGCAGGCCAAGAGGCAGCTCCAGCCGCTGAGGCTGCCACCCCTGAACATCGGGCCTCTC
AACCTTCCGCCTGGTGGCAAGGCCGCCGCCGCGCAGGACCTGGCCGGCTCGGGGCGTGACTTGAGCCCGCCGCCC
TCGAGGCAGCTGCCCAAGACGCCCACGACCCCGATGACCGCTTCCAAGAGCTCCTTCTTCTCCAAGACCAAGTAC
GACGAAACGATCGAACTACCATGCCTCCGGAGCAGAAGCTCTATTCATCAGGCCTATCGGGTGACGCCCACGCCG
CCCGACGCCGATTCCTCGAGCTCTTCCATTGCTCTTTCGGAAACTAATCTCAAGTCAAGCCTGTCGCCCTTCCTG
TCGTCCTCCCTGCCCAAAGGAGGCTTGGAACACGGCCTTCTGAAGAGGTCGAAGACGGGCGGAGACTACCACACC
CTCACCGGCAACGAATTCGACGCCATGCATCAGCGCAAGGCGGCCGGCCTGAGAAGCTCGGGCACCGGCAAGACG
ACGCCGAAATCCCCGTCGCCTCCGGACCCCGTTTCCGAGGAGCTTCGGACCCCGTCGTCCATGAACTCGCTGAGA
CGAAAACTCAGCCTGTCGTGGCGGCGAGGCAACTCAAAGGCCGGCATTGCCTCCTCCGGGGACAATGCCGTCGAG
ATGCCCACGGCTCAGCTGCACGCGAATCCGGACACGATGCCGCCGCCACGGCTTCCCGCAGCCGCCTCGAGTAAC
AGCCTGGCGAACCCGAAGCGCTTGGATACCAGCCCCACGATGCACGCCGGCGGCGCCTTCTTGGAGTCCAGAAGA
CGGAAGAACTCTGCGGCGAGCCAGACGGCTCATTTCACCCACGACAGAGTCAAGAGCGACAACTGGGTCATCAAG
AAGGAGAACAAGACCGACTCGGTCACGCTGCCCGTCTCCCATAGCATGGGGCTGTCGCACAAGATGCTCAAGCCC
AAGCCCTCGCTGTGTGCCTTTTCCTCCGGTGCATATTCGGCCGTGGAGCTGGACAAGGATGACCTGGCCGCAGAA
GAGGAAATGCGCAAGATGGGCTCCCGGCGCAAGGAGACGGAGATCGCGGCGAGGGCGCTCGACGCGCTGAGGAAG
CGGGCGACGCCCAAGGAGCGCGTCAGCCCCCACGAAGCCATCCGCATCGCCCTCTTGAACATCTACGAGCGGGGA
GAAATCATCGACTTCGACGACATTTACTTTTGCGGGACGCAGAACGCCCACAAGGTGGTGGGCGACGTGCAGTCG
GACGCACCCAACTTCGGCTACGATGACGAGCGCGGAGACTACACCATCGTACCCGGCGACCACCTCGCGTACCGA
TACGAGATCATCGACGTGCTGGGAAAGGGAAGCTTCGGGCAGGTGGTGCGGTGTATCGACCACAAGCTGGGCGTC
CTGGTGGCGGTCAAGATCATCAGGAACAAGAAGAGGTTCCACCAGCAGGCCCTTGTCGAGGTCAATATTCTGCAG
AGGCTTCGCGAATGGGATCCCAAGAACCGTCACAGCATGGTCAGCTTCACCCAGCACTTTTACTTCCGAGGGCAT
TTGTGCATCTCAACCGAGCTGCTCGACATGAACCTGTACGAGTTCATCAAGGCCCACGCCTTCCGCGGCTTCTCC
CTGCGGATAATCCGGCGCTTCACCAAGCAGATTCTCAGCTCGCTCATCCTGTTGAAGCAGCGCAAGGTCATCCAC
TGCGACCTAAAACCCGAGAACATCCTGCTTCGGCACCCGCTCCACTCGGAGATCAAGGTGATTGACTTCGGCTCC
AGCTGCTTCGAAAACGAGAAGGTGTACACGTACATCCAGTCCCGCTTCTACCGCTCGCCCGAGGTGATTCTGGGC
ATGACATACGGAATGCCAATCGACATGTGGAGCGTCGGTTGCATCCTGGCCGAGCTGTACACGGGCGTCCCCATC
TTCCCGGGTGAGAACGAGCAAGAGCAGCTCGCGTGCATCATGGAGGTGTTTGGGCCGCCGGAGAAGCACCTGATC
GAGAAGAGCACGCGCAGGAAGCTTTTCTTCGACTCGGTCGGCAAACCGCGACTGACCGTCTCGTCCAAGGGCCGG
CGGCGCCGTCCGTCGTCTAAGACGCTGCAGCAGGTGCTCAAGTGCGACGACGAGGTCTTTGTCGACTTCCTGGCG
CGCTGCCTGCGCTGGGACCCAGAGCGACGACTGAAGCCCGAGGAGGCGGTGCGCCATGAGTTCATTAGCGGGCAG
AAGGCGCCGGCGCCGGCGGCGCGGCTGCCGACGCGCGACCCGTCGCCGGTCAAGCGCAACAACACCGTGTCGACG
CCTCGGCCGTTACCGGATCCGCCCGGGGCCACGGGCAAGGGAATCATGGCCGGGCGCACGGGCGTGAGCCCCCAC
AAGCAGCCTCCCGGGGCGGCCAGGCGGGTCTCGGGGGCGACGGCGGCGACGGCGGCCAGCACCAACAGGAGGACG
AGCGGCGGCAGCGGATCCATCAGCGGCGGGTTCAGTGGCCTTCCCCGCGCGGCCGGCAGGACGGCGAGCGGGAAG
CACGATCTCGCGGCGGCGGGAGCGTCGGCGGCAATGACTCGCAGGGCATAG
Gene >Hirsu2|11239
ATGCTCACCGCGCCTGCTTCCAATCACCACCACCCTCTTCCCGTTACTCGAAATGGCCAAGTGGGCCAGCCCGCA
CCGACCACCGCGCCCTACGACTTCCTGCCCTCGGTCAGCTTCGATGACCTCCACGCCAGCATCGAGTCCGCCTCG
TCCGACTTCAAGCTGACCCAGTTCCCCTCCGCCGCCGGCGAGGGCGCCGTCCTCGAATCCAAGGGCATGCCCGAC
CGCAAGCTGCCGCCCCAGAGGCAGCTCCCTGCCGCCCACGCCAACGGCCAGCCGCGCCCCGGCAACCCCCCCGTC
GCCAACAGAACTGGCCGCTCCGGCTCCATCCTGCGAAGGCCCAGCATGTCGGGCAGGCACCCGAGCAACTCGTCC
ATCGTCTCCTCCTCCTCCGGCACCCTCGATGCCCCGTCGGGCCCCCCGCCCGCGCGCAGCCGCCGTCAGAGCCAC
TACCCCCCCATCTCCAATGCCCACGTCGCCCCCAAGCCCCCCCGCAAGTCCATCGGCCCCGGCATCGTGGGCGAC
GCCGATGGCGGGAAACGGAGCTCGCAGGGGCGACGTCCCAGCTTGCTGGGCGATCGCGGCCCCGGCCCCGACTCG
GCTCGGAGATCTGTCGATAGCTTTTCCGCTCCCGCACACGACGCACCGCGCCACCACGCGGCAAACTCGAGGGCC
GTCAAGGCCAAATCTGTGCAACCGCCCATGCGCCCGAGCCAAGCAAGCGCCTTTGCTGCTTCCAGCCTGACCCCC
GAGCAGAATCGCCTGTCGACGCTGGCTCCGCGCTCGCCACGTGTCTCCGGCAGAAGTTTGCCCCAGCCGTCGGGC
GGGAAACGGGCATCCATGATGCCCGGCGCCCACCATCCCTCCCACGCGACGGGCCTGGGCGCCCGTACCATAAGT
CCCACCGACACGAGAAGGATGAAGCGTCTGTCGACGATGCCGCACTCGCAAAGCCTCAACGCCATTTCCAGCGTG
CCGCCGCCCCCGCCACTACTGTCCATGGACATCCGCGCCAACTCCAAGTCGCCCTCCATGATCCCTCGCAGGACG
TCCGCCACGCCCTCCTCGTCCCGGACGACGCCCGACGCCAGCAACCGCAAGTCGTACAGTTCGGGCCTGTCCGTC
GGCTCGGCCGCGAGCTTCAACACCATGCGGACCTCGTCGGCATCGCTGCAGCCTAGGCTGCCCCAGTCGTCGTCT
GCCTCCCGCCTTCCCGCGCCCAAGCACACGCCTGCGCACAATCCGCTCCCCGCCGACGACGACGAGGACGTCCCT
CCGGTCCCGGCCATACCCAAGGCCTACGAGTCTCCCAAGGACTCTCCGGCCGAGACATACTTTTTGGACAAGAGA
AAGACGAGCTTGCCTGCCGTCGACTCCCTGGGCGGATACGGAAACGCGGCAGGAAACATCCCCATATCCGCTTAC
CCCGAGCCCACAAAGGCACAGCAGCAGTACAGGGCCGACGCCCGCAAAAGCTCGATGCCGCCGCCCGCGAGCACG
GAGGAGGCCAACGCCTCGCAGGCCAAGAGGCAGCTCCAGCCGCTGAGGCTGCCACCCCTGAACATCGGGCCTCTC
AACCTTCCGCCTGGTGGCAAGGCCGCCGCCGCGCAGGACCTGGCCGGCTCGGGGCGTGACTTGAGCCCGCCGCCC
TCGAGGCAGCTGCCCAAGACGCCCACGACCCCGATGACCGCTTCCAAGAGCTCCTTCTTCTCCAAGACCAAGTAC
GACGAAACGATCGAACTACCATGCCTCCGGAGCAGAAGCTCTATTCATCAGGCCTATCGGGTGACGCCCACGCCG
CCCGACGCCGATTCCTCGAGCTCTTCCATTGCTCTTTCGGAAACTAATCTCAAGTCAAGCCTGTCGCCCTTCCTG
TCGTCCTCCCTGCCCAAAGGAGGCTTGGAACACGGCCTTCTGAAGAGGTCGAAGACGGGCGGAGACTACCACACC
CTCACCGGCAACGAATTCGACGCCATGCATCAGCGCAAGGCGGCCGGCCTGAGAAGCTCGGGCACCGGCAAGACG
ACGCCGAAATCCCCGTCGCCTCCGGACCCCGTTTCCGAGGAGCTTCGGACCCCGTCGTCCATGAACTCGCTGAGA
CGAAAACTCAGCCTGTCGTGGCGGCGAGGCAACTCAAAGGCCGGCATTGCCTCCTCCGGGGACAATGCCGTCGAG
ATGCCCACGGCTCAGCTGCACGCGAATCCGGACACGATGCCGCCGCCACGGCTTCCCGCAGCCGCCTCGAGTAAC
AGCCTGGCGAACCCGAAGCGCTTGGATACCAGCCCCACGATGCACGCCGGCGGCGCCTTCTTGGAGTCCAGAAGA
CGGAAGAACTCTGCGGCGAGCCAGACGGCTCATTTCACCCACGACAGAGTCAAGAGCGACAACTGGGTCATCAAG
AAGGAGAACAAGACCGACTCGGTCACGCTGCCCGTCTCCCATAGCATGGGGCTGTCGCACAAGATGCTCAAGCCC
AAGCCCTCGCTGTGTGCCTTTTCCTCCGGTGCATATTCGGCCGTGGAGCTGGACAAGGATGACCTGGCCGCAGAA
GAGGAAATGCGCAAGATGGGCTCCCGGCGCAAGGAGACGGAGATCGCGGCGAGGGCGCTCGACGCGCTGAGGAAG
CGGGCGACGCCCAAGGAGCGCGTCAGCCCCCACGAAGCCATCCGCATCGCCCTCTTGAACATCTACGAGCGGGGA
GAAATCATCGACTTCGACGACATTTACTTTTGCGGGACGCAGAACGCCCACAAGGTGGTGGGCGACGTGCAGTCG
GACGCACCCAACTTCGGCTACGATGACGAGCGCGGAGACTACACCATCGTACCCGGCGACCACCTCGCGTACCGA
TACGAGATCATCGACGTGCTGGGAAAGGGAAGCTTCGGGCAGGTGGTGCGGTGTATCGACCACAAGCTGGGCGTC
CTGGTGGCGGTCAAGATCATCAGGAACAAGAAGAGGTTCCACCAGCAGGCCCTTGTCGAGGTCAATATTCTGCAG
AGGCTTCGCGAATGGGTAAGTTGTCCCGGCCCGAGGCGCCGGCGCCGTCCCGTGTCTGACGTCGTGCCTCGCAGG
ATCCCAAGAACCGTCACAGCATGGTCAGCTTCACCCAGCACTTTTACTTCCGAGGGCATTTGTGCATCTCAACCG
AGCTGCTCGACATGAACCTGTACGAGTTCATCAAGGCCCACGCCTTCCGCGGCTTCTCCCTGCGGATAATCCGGC
GCTTCACCAAGCAGATTCTCAGCTCGCTCATCCTGTTGAAGCAGCGCAAGGTCATCCACTGCGACCTAAAACCCG
AGAACATCCTGCTTCGGCACCCGCTCCACTCGGAGATCAAGGTGATTGACTTCGGCTCCAGCTGCTTCGAAAACG
AGAAGGTGTACACGTACATCCAGTCCCGCTTCTACCGCTCGCCCGAGGTGATTCTGGGCATGACATACGGAATGC
CAATCGACATGTGGAGCGTCGGTTGCATCCTGGCCGAGCTGTACACGGGCGTCCCCATCTTCCCGGGTGAGAACG
AGCAAGAGCAGCTCGCGTGCATCATGGAGGTGTTTGGGCCGCCGGAGAAGCACCTGATCGAGAAGAGCACGCGCA
GGAAGCTTTTCTTCGACTCGGTCGGCAAACCGCGACTGACCGTCTCGTCCAAGGGCCGGCGGCGCCGTCCGTCGT
CTAAGACGCTGCAGCAGGTGCTCAAGTGCGACGACGAGGTCTTTGTCGACTTCCTGGCGCGCTGCCTGCGCTGGG
ACCCAGAGCGACGACTGAAGCCCGAGGAGGCGGTGCGCCATGAGTTCATTAGCGGGCAGAAGGCGCCGGCGCCGG
CGGCGCGGCTGCCGACGCGCGACCCGTCGCCGGTCAAGCGCAACAACACCGTGTCGACGCCTCGGCCGTTACCGG
ATCCGCCCGGGGCCACGGGCAAGGGAATCATGGCCGGGCGCACGGGCGTGAGCCCCCACAAGCAGCCTCCCGGGG
CGGCCAGGCGGGTCTCGGGGGCGACGGCGGCGACGGCGGCCAGCACCAACAGGAGGACGAGCGGCGGCAGCGGAT
CCATCAGCGGCGGGTTCAGTGGCCTTCCCCGCGCGGCCGGCAGGACGGCGAGCGGGAAGCACGATCTCGCGGCGG
CGGGAGCGTCGGCGGCAATGACTCGCAGGGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail