Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11233
Gene name
LocationContig_99:29536..31009
Strand+
Gene length (bp)1473
Transcript length (bp)1392
Coding sequence length (bp)1392
Protein length (aa) 464

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01569 PAP2 PAP2 superfamily 2.0E-22 116 348

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q05521|DPP1_YEAST Diacylglycerol pyrophosphate phosphatase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPP1 PE=1 SV=1 11 223 3.0E-18
sp|Q9ZU49|LPP1_ARATH Lipid phosphate phosphatase 1 OS=Arabidopsis thaliana GN=LPP1 PE=2 SV=2 16 215 5.0E-17
sp|Q9UUA6|DPP1_SCHPO Probable diacylglycerol pyrophosphate phosphatase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dpp1 PE=3 SV=1 43 218 5.0E-17
sp|Q8LFD1|LPP3_ARATH Putative lipid phosphate phosphatase 3, chloroplastic OS=Arabidopsis thaliana GN=LPP3 PE=2 SV=1 15 215 2.0E-16
sp|Q86AF0|Y7151_DICDI PA-phosphatase related-family protein DDB_G0271516 OS=Dictyostelium discoideum GN=DDB_G0271516 PE=3 SV=1 21 216 1.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q05521|DPP1_YEAST Diacylglycerol pyrophosphate phosphatase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPP1 PE=1 SV=1 11 223 3.0E-18
sp|Q9ZU49|LPP1_ARATH Lipid phosphate phosphatase 1 OS=Arabidopsis thaliana GN=LPP1 PE=2 SV=2 16 215 5.0E-17
sp|Q9UUA6|DPP1_SCHPO Probable diacylglycerol pyrophosphate phosphatase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dpp1 PE=3 SV=1 43 218 5.0E-17
sp|Q8LFD1|LPP3_ARATH Putative lipid phosphate phosphatase 3, chloroplastic OS=Arabidopsis thaliana GN=LPP3 PE=2 SV=1 15 215 2.0E-16
sp|Q86AF0|Y7151_DICDI PA-phosphatase related-family protein DDB_G0271516 OS=Dictyostelium discoideum GN=DDB_G0271516 PE=3 SV=1 21 216 1.0E-14
sp|Q8MXL9|Y5547_DICDI PA-phosphatase related-family protein DDB_G0275547 OS=Dictyostelium discoideum GN=DDB_G0275547 PE=3 SV=2 21 218 3.0E-13
sp|Q0WNG6|LPP4_ARATH Probable lipid phosphate phosphatase 4 OS=Arabidopsis thaliana GN=LPP4 PE=2 SV=1 5 218 1.0E-11
sp|Q9XI60|LPP2_ARATH Lipid phosphate phosphatase 2 OS=Arabidopsis thaliana GN=LPP2 PE=2 SV=1 41 218 1.0E-09
sp|Q04396|LPP1_YEAST Lipid phosphate phosphatase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LPP1 PE=1 SV=1 48 208 1.0E-07
sp|Q3UMZ3|PLPP5_MOUSE Phospholipid phosphatase 5 OS=Mus musculus GN=Plpp5 PE=2 SV=1 25 221 2.0E-07
sp|Q8NEB5|PLPP5_HUMAN Phospholipid phosphatase 5 OS=Homo sapiens GN=PLPP5 PE=1 SV=2 129 221 5.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 20 39 19
2 68 90 22
3 110 132 22
4 297 319 22
5 324 346 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11233
MAHSGSSSQSLHSPLRLTASYAFDWIVLIIVVVIAGFLGRIEPNKRPFALDDPNISFPFTVDQTVPTWLLVVLCG
LAPAIIIFLVSILLVPGATVPKNTPQSLIWKRKMWELHVGWLGLLLAVGSAFFFISGIKNMCGKPRPDLLNRCQP
DLANRDMYLVGGFKDEAVSGRLYSGKICKQQDKYKLDDGFRSYPSGHAAASAAGLIYLSLYLASKFAVTLPFVVP
NANRHADASMHAAFPSRVKDNTDSAAYEVASLRNDFGYGDGSMAKPGTVAQRSAQHNVKIQSLRRQAAAPPIYLL
AITLAPFCLSIFISASRWFDFRHHGFDILFGFLIGTICAIYSFRYYHMPIREGAGWAWGPRSGDRAFWAGVGRLG
YAGQRSDFDANVNRADLGESGDVDLNLAPPPNQPMSSGGSVNYRAAAYGPSTQQPGPFQDVEMERMEHHRAMAQP
VGHPGHPSTSRAF*
Coding >Hirsu2|11233
ATGGCCCACTCCGGGTCGTCGTCGCAGAGCCTCCACTCGCCACTGCGTCTTACTGCTTCCTACGCCTTTGACTGG
ATCGTCCTCATCATCGTCGTCGTCATCGCTGGCTTTCTCGGTCGCATCGAGCCCAACAAGCGGCCCTTTGCGCTC
GACGATCCCAACATCTCGTTTCCCTTCACCGTCGACCAAACAGTCCCGACATGGCTGCTCGTCGTTCTCTGCGGC
CTCGCGCCTGCCATCATCATCTTTCTCGTCTCCATCCTCCTGGTGCCCGGGGCCACCGTTCCTAAGAACACGCCC
CAGTCGCTCATCTGGAAGCGCAAGATGTGGGAGCTCCACGTCGGCTGGCTTGGCCTCCTCCTTGCCGTCGGATCC
GCCTTCTTCTTCATCAGCGGCATCAAGAACATGTGTGGCAAGCCGCGCCCCGACCTGCTGAATCGCTGCCAGCCC
GACCTCGCCAACCGCGACATGTACCTGGTCGGCGGTTTCAAGGACGAGGCCGTCTCCGGCCGACTCTACTCGGGC
AAGATCTGCAAGCAACAGGACAAGTACAAGCTCGACGACGGCTTCCGCAGCTATCCCAGCGGCCACGCCGCCGCC
TCGGCCGCCGGGCTCATCTATCTGTCCCTCTACCTCGCCAGCAAGTTCGCCGTCACGCTCCCCTTCGTCGTGCCC
AATGCGAACAGGCATGCCGATGCCTCGATGCACGCCGCCTTCCCGTCGCGCGTCAAGGACAACACCGACTCGGCC
GCGTACGAGGTCGCGAGCCTGCGCAACGACTTCGGCTACGGCGATGGGTCCATGGCCAAGCCCGGCACCGTCGCC
CAGCGCAGTGCGCAGCACAACGTCAAGATCCAGTCGCTGCGCCGCCAAGCCGCCGCGCCGCCCATCTATCTCCTC
GCCATCACCCTCGCGCCCTTTTGCCTGTCCATCTTCATCTCGGCGTCCCGCTGGTTCGACTTCCGCCACCACGGC
TTCGACATCCTATTCGGCTTCCTGATCGGCACCATCTGCGCCATCTACAGTTTCCGCTACTACCACATGCCCATC
CGCGAGGGCGCCGGCTGGGCCTGGGGTCCCCGCAGCGGCGACCGCGCCTTCTGGGCCGGCGTTGGTCGCCTGGGC
TATGCCGGCCAGCGGTCCGACTTCGACGCCAACGTGAACCGGGCCGACCTCGGCGAGTCGGGCGACGTGGACCTG
AACCTCGCGCCGCCGCCCAACCAGCCTATGAGCTCGGGTGGCAGCGTCAATTACCGCGCCGCCGCATACGGGCCC
AGCACCCAGCAGCCCGGTCCGTTCCAGGACGTCGAAATGGAGAGGATGGAGCACCATCGTGCCATGGCCCAGCCA
GTGGGCCATCCAGGACATCCGTCGACGAGCCGTGCCTTTTAA
Transcript >Hirsu2|11233
ATGGCCCACTCCGGGTCGTCGTCGCAGAGCCTCCACTCGCCACTGCGTCTTACTGCTTCCTACGCCTTTGACTGG
ATCGTCCTCATCATCGTCGTCGTCATCGCTGGCTTTCTCGGTCGCATCGAGCCCAACAAGCGGCCCTTTGCGCTC
GACGATCCCAACATCTCGTTTCCCTTCACCGTCGACCAAACAGTCCCGACATGGCTGCTCGTCGTTCTCTGCGGC
CTCGCGCCTGCCATCATCATCTTTCTCGTCTCCATCCTCCTGGTGCCCGGGGCCACCGTTCCTAAGAACACGCCC
CAGTCGCTCATCTGGAAGCGCAAGATGTGGGAGCTCCACGTCGGCTGGCTTGGCCTCCTCCTTGCCGTCGGATCC
GCCTTCTTCTTCATCAGCGGCATCAAGAACATGTGTGGCAAGCCGCGCCCCGACCTGCTGAATCGCTGCCAGCCC
GACCTCGCCAACCGCGACATGTACCTGGTCGGCGGTTTCAAGGACGAGGCCGTCTCCGGCCGACTCTACTCGGGC
AAGATCTGCAAGCAACAGGACAAGTACAAGCTCGACGACGGCTTCCGCAGCTATCCCAGCGGCCACGCCGCCGCC
TCGGCCGCCGGGCTCATCTATCTGTCCCTCTACCTCGCCAGCAAGTTCGCCGTCACGCTCCCCTTCGTCGTGCCC
AATGCGAACAGGCATGCCGATGCCTCGATGCACGCCGCCTTCCCGTCGCGCGTCAAGGACAACACCGACTCGGCC
GCGTACGAGGTCGCGAGCCTGCGCAACGACTTCGGCTACGGCGATGGGTCCATGGCCAAGCCCGGCACCGTCGCC
CAGCGCAGTGCGCAGCACAACGTCAAGATCCAGTCGCTGCGCCGCCAAGCCGCCGCGCCGCCCATCTATCTCCTC
GCCATCACCCTCGCGCCCTTTTGCCTGTCCATCTTCATCTCGGCGTCCCGCTGGTTCGACTTCCGCCACCACGGC
TTCGACATCCTATTCGGCTTCCTGATCGGCACCATCTGCGCCATCTACAGTTTCCGCTACTACCACATGCCCATC
CGCGAGGGCGCCGGCTGGGCCTGGGGTCCCCGCAGCGGCGACCGCGCCTTCTGGGCCGGCGTTGGTCGCCTGGGC
TATGCCGGCCAGCGGTCCGACTTCGACGCCAACGTGAACCGGGCCGACCTCGGCGAGTCGGGCGACGTGGACCTG
AACCTCGCGCCGCCGCCCAACCAGCCTATGAGCTCGGGTGGCAGCGTCAATTACCGCGCCGCCGCATACGGGCCC
AGCACCCAGCAGCCCGGTCCGTTCCAGGACGTCGAAATGGAGAGGATGGAGCACCATCGTGCCATGGCCCAGCCA
GTGGGCCATCCAGGACATCCGTCGACGAGCCGTGCCTTTTAA
Gene >Hirsu2|11233
ATGGCCCACTCCGGGTCGTCGTCGCAGAGCCTCCACTCGCCACTGCGTCTTACTGCTTCCTACGCCTTTGACTGG
ATCGTCCTCATCATCGTCGTCGTCATCGCTGGCTTTCTCGGTCGCATCGAGCCCAACAAGCGGCCCTTTGCGCTC
GACGATCCCAACATCTCGTCAGTCCACGACGTCCCGACCAGACAGACATGGGCCGACACGCCCTTGCCGCGCACG
CATTGCTGACTCGTTCGTCCCAGGTTTCCCTTCACCGTCGACCAAACAGTCCCGACATGGCTGCTCGTCGTTCTC
TGCGGCCTCGCGCCTGCCATCATCATCTTTCTCGTCTCCATCCTCCTGGTGCCCGGGGCCACCGTTCCTAAGAAC
ACGCCCCAGTCGCTCATCTGGAAGCGCAAGATGTGGGAGCTCCACGTCGGCTGGCTTGGCCTCCTCCTTGCCGTC
GGATCCGCCTTCTTCTTCATCAGCGGCATCAAGAACATGTGTGGCAAGCCGCGCCCCGACCTGCTGAATCGCTGC
CAGCCCGACCTCGCCAACCGCGACATGTACCTGGTCGGCGGTTTCAAGGACGAGGCCGTCTCCGGCCGACTCTAC
TCGGGCAAGATCTGCAAGCAACAGGACAAGTACAAGCTCGACGACGGCTTCCGCAGCTATCCCAGCGGCCACGCC
GCCGCCTCGGCCGCCGGGCTCATCTATCTGTCCCTCTACCTCGCCAGCAAGTTCGCCGTCACGCTCCCCTTCGTC
GTGCCCAATGCGAACAGGCATGCCGATGCCTCGATGCACGCCGCCTTCCCGTCGCGCGTCAAGGACAACACCGAC
TCGGCCGCGTACGAGGTCGCGAGCCTGCGCAACGACTTCGGCTACGGCGATGGGTCCATGGCCAAGCCCGGCACC
GTCGCCCAGCGCAGTGCGCAGCACAACGTCAAGATCCAGTCGCTGCGCCGCCAAGCCGCCGCGCCGCCCATCTAT
CTCCTCGCCATCACCCTCGCGCCCTTTTGCCTGTCCATCTTCATCTCGGCGTCCCGCTGGTTCGACTTCCGCCAC
CACGGCTTCGACATCCTATTCGGCTTCCTGATCGGCACCATCTGCGCCATCTACAGTTTCCGCTACTACCACATG
CCCATCCGCGAGGGCGCCGGCTGGGCCTGGGGTCCCCGCAGCGGCGACCGCGCCTTCTGGGCCGGCGTTGGTCGC
CTGGGCTATGCCGGCCAGCGGTCCGACTTCGACGCCAACGTGAACCGGGCCGACCTCGGCGAGTCGGGCGACGTG
GACCTGAACCTCGCGCCGCCGCCCAACCAGCCTATGAGCTCGGGTGGCAGCGTCAATTACCGCGCCGCCGCATAC
GGGCCCAGCACCCAGCAGCCCGGTCCGTTCCAGGACGTCGAAATGGAGAGGATGGAGCACCATCGTGCCATGGCC
CAGCCAGTGGGCCATCCAGGACATCCGTCGACGAGCCGTGCCTTTTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail