Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11232
Gene name
LocationContig_99:25363..26627
Strand+
Gene length (bp)1264
Transcript length (bp)1128
Coding sequence length (bp)1128
Protein length (aa) 376

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03947 Ribosomal_L2_C Ribosomal Proteins L2, C-terminal domain 2.9E-50 201 337
PF00181 Ribosomal_L2 Ribosomal Proteins L2, RNA binding domain 1.1E-23 96 171

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32611|RML2_YEAST 54S ribosomal protein RML2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RML2 PE=1 SV=1 51 367 2.0E-104
sp|Q9Y7P4|RML2_SCHPO 54S ribosomal protein rml2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rml2 PE=3 SV=2 53 367 3.0E-103
sp|B5FG12|RL2_VIBFM 50S ribosomal protein L2 OS=Vibrio fischeri (strain MJ11) GN=rplB PE=3 SV=1 59 357 1.0E-71
sp|Q5E8B2|RL2_VIBF1 50S ribosomal protein L2 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rplB PE=3 SV=1 59 357 1.0E-71
sp|B6EPS8|RL2_ALISL 50S ribosomal protein L2 OS=Aliivibrio salmonicida (strain LFI1238) GN=rplB PE=3 SV=1 59 357 2.0E-71
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32611|RML2_YEAST 54S ribosomal protein RML2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RML2 PE=1 SV=1 51 367 2.0E-104
sp|Q9Y7P4|RML2_SCHPO 54S ribosomal protein rml2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rml2 PE=3 SV=2 53 367 3.0E-103
sp|B5FG12|RL2_VIBFM 50S ribosomal protein L2 OS=Vibrio fischeri (strain MJ11) GN=rplB PE=3 SV=1 59 357 1.0E-71
sp|Q5E8B2|RL2_VIBF1 50S ribosomal protein L2 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rplB PE=3 SV=1 59 357 1.0E-71
sp|B6EPS8|RL2_ALISL 50S ribosomal protein L2 OS=Aliivibrio salmonicida (strain LFI1238) GN=rplB PE=3 SV=1 59 357 2.0E-71
sp|B7VLF4|RL2_VIBTL 50S ribosomal protein L2 OS=Vibrio tasmaniensis (strain LGP32) GN=rplB PE=3 SV=1 59 357 3.0E-69
sp|Q7MPI5|RL2_VIBVY 50S ribosomal protein L2 OS=Vibrio vulnificus (strain YJ016) GN=rplB PE=3 SV=1 59 357 3.0E-69
sp|Q8DE42|RL2_VIBVU 50S ribosomal protein L2 OS=Vibrio vulnificus (strain CMCP6) GN=rplB PE=3 SV=1 59 357 3.0E-69
sp|B2JIG3|RL2_BURP8 50S ribosomal protein L2 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=rplB PE=3 SV=1 59 347 5.0E-69
sp|Q6LVB3|RL2_PHOPR 50S ribosomal protein L2 OS=Photobacterium profundum GN=rplB PE=3 SV=1 59 360 2.0E-68
sp|Q3IF22|RL2_PSEHT 50S ribosomal protein L2 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rplB PE=3 SV=1 55 357 4.0E-68
sp|A4ST03|RL2_AERS4 50S ribosomal protein L2 OS=Aeromonas salmonicida (strain A449) GN=rplB PE=3 SV=1 59 357 4.0E-68
sp|A0KF24|RL2_AERHH 50S ribosomal protein L2 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rplB PE=3 SV=1 59 357 6.0E-68
sp|Q9PE73|RL2_XYLFA 50S ribosomal protein L2 OS=Xylella fastidiosa (strain 9a5c) GN=rplB PE=3 SV=1 58 357 1.0E-67
sp|A7MWI6|RL2_VIBCB 50S ribosomal protein L2 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rplB PE=3 SV=1 59 357 2.0E-67
sp|C6DG71|RL2_PECCP 50S ribosomal protein L2 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rplB PE=3 SV=1 59 357 2.0E-67
sp|B2T748|RL2_BURPP 50S ribosomal protein L2 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=rplB PE=3 SV=1 59 347 2.0E-67
sp|B0V6X1|RL2_ACIBY 50S ribosomal protein L2 OS=Acinetobacter baumannii (strain AYE) GN=rplB PE=3 SV=1 55 360 2.0E-67
sp|A3M980|RL2_ACIBT 50S ribosomal protein L2 OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=rplB PE=3 SV=2 55 360 2.0E-67
sp|B0VQS1|RL2_ACIBS 50S ribosomal protein L2 OS=Acinetobacter baumannii (strain SDF) GN=rplB PE=3 SV=1 55 360 2.0E-67
sp|B7IA36|RL2_ACIB5 50S ribosomal protein L2 OS=Acinetobacter baumannii (strain AB0057) GN=rplB PE=3 SV=1 55 360 2.0E-67
sp|B7GW05|RL2_ACIB3 50S ribosomal protein L2 OS=Acinetobacter baumannii (strain AB307-0294) GN=rplB PE=3 SV=1 55 360 2.0E-67
sp|Q39KG4|RL2_BURL3 50S ribosomal protein L2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rplB PE=3 SV=1 59 347 3.0E-67
sp|Q0BJ43|RL2_BURCM 50S ribosomal protein L2 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rplB PE=3 SV=1 59 347 3.0E-67
sp|B4E5C3|RL2_BURCJ 50S ribosomal protein L2 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=rplB PE=3 SV=1 59 347 3.0E-67
sp|B1JU25|RL2_BURCC 50S ribosomal protein L2 OS=Burkholderia cenocepacia (strain MC0-3) GN=rplB PE=3 SV=1 59 347 3.0E-67
sp|Q1BRV1|RL2_BURCA 50S ribosomal protein L2 OS=Burkholderia cenocepacia (strain AU 1054) GN=rplB PE=3 SV=1 59 347 3.0E-67
sp|B1YRD3|RL2_BURA4 50S ribosomal protein L2 OS=Burkholderia ambifaria (strain MC40-6) GN=rplB PE=3 SV=1 59 347 3.0E-67
sp|Q6CZX3|RL2_PECAS 50S ribosomal protein L2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rplB PE=3 SV=1 59 357 3.0E-67
sp|Q13TH3|RL2_BURXL 50S ribosomal protein L2 OS=Burkholderia xenovorans (strain LB400) GN=rplB PE=3 SV=1 59 347 3.0E-67
sp|B0U5B0|RL2_XYLFM 50S ribosomal protein L2 OS=Xylella fastidiosa (strain M12) GN=rplB PE=3 SV=1 58 357 4.0E-67
sp|A4JAP3|RL2_BURVG 50S ribosomal protein L2 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=rplB PE=3 SV=1 59 347 4.0E-67
sp|Q87E79|RL2_XYLFT 50S ribosomal protein L2 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rplB PE=3 SV=1 58 357 4.0E-67
sp|B2I8H2|RL2_XYLF2 50S ribosomal protein L2 OS=Xylella fastidiosa (strain M23) GN=rplB PE=3 SV=1 58 357 4.0E-67
sp|A0K3M8|RL2_BURCH 50S ribosomal protein L2 OS=Burkholderia cenocepacia (strain HI2424) GN=rplB PE=3 SV=1 59 347 5.0E-67
sp|Q87T10|RL2_VIBPA 50S ribosomal protein L2 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rplB PE=3 SV=1 59 357 5.0E-67
sp|Q5QXY0|RL2_IDILO 50S ribosomal protein L2 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rplB PE=3 SV=1 59 357 5.0E-67
sp|B4F1I7|RL2_PROMH 50S ribosomal protein L2 OS=Proteus mirabilis (strain HI4320) GN=rplB PE=3 SV=1 59 357 8.0E-67
sp|A6TEW9|RL2_KLEP7 50S ribosomal protein L2 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rplB PE=3 SV=1 59 362 8.0E-67
sp|B5XN97|RL2_KLEP3 50S ribosomal protein L2 OS=Klebsiella pneumoniae (strain 342) GN=rplB PE=3 SV=1 59 362 8.0E-67
sp|Q32B34|RL2_SHIDS 50S ribosomal protein L2 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rplB PE=3 SV=1 59 357 9.0E-67
sp|Q3YWU2|RL2_SHISS 50S ribosomal protein L2 OS=Shigella sonnei (strain Ss046) GN=rplB PE=3 SV=1 59 357 1.0E-66
sp|P60429|RL2_SHIFL 50S ribosomal protein L2 OS=Shigella flexneri GN=rplB PE=3 SV=2 59 357 1.0E-66
sp|Q0SZY6|RL2_SHIF8 50S ribosomal protein L2 OS=Shigella flexneri serotype 5b (strain 8401) GN=rplB PE=3 SV=1 59 357 1.0E-66
sp|Q31VV9|RL2_SHIBS 50S ribosomal protein L2 OS=Shigella boydii serotype 4 (strain Sb227) GN=rplB PE=3 SV=1 59 357 1.0E-66
sp|B2U2T5|RL2_SHIB3 50S ribosomal protein L2 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rplB PE=3 SV=1 59 357 1.0E-66
sp|B7LRT3|RL2_ESCF3 50S ribosomal protein L2 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rplB PE=3 SV=1 59 357 1.0E-66
sp|Q1R607|RL2_ECOUT 50S ribosomal protein L2 OS=Escherichia coli (strain UTI89 / UPEC) GN=rplB PE=3 SV=1 59 357 1.0E-66
sp|B1LHD1|RL2_ECOSM 50S ribosomal protein L2 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rplB PE=3 SV=1 59 357 1.0E-66
sp|B6I231|RL2_ECOSE 50S ribosomal protein L2 OS=Escherichia coli (strain SE11) GN=rplB PE=3 SV=1 59 357 1.0E-66
sp|B7NDT8|RL2_ECOLU 50S ribosomal protein L2 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rplB PE=3 SV=1 59 357 1.0E-66
sp|P60422|RL2_ECOLI 50S ribosomal protein L2 OS=Escherichia coli (strain K12) GN=rplB PE=1 SV=2 59 357 1.0E-66
sp|B1IPY2|RL2_ECOLC 50S ribosomal protein L2 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rplB PE=3 SV=1 59 357 1.0E-66
sp|P60423|RL2_ECOL6 50S ribosomal protein L2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rplB PE=3 SV=2 59 357 1.0E-66
sp|Q0TCE4|RL2_ECOL5 50S ribosomal protein L2 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rplB PE=3 SV=1 59 357 1.0E-66
sp|A1AGK5|RL2_ECOK1 50S ribosomal protein L2 OS=Escherichia coli O1:K1 / APEC GN=rplB PE=3 SV=1 59 357 1.0E-66
sp|A8A5C2|RL2_ECOHS 50S ribosomal protein L2 OS=Escherichia coli O9:H4 (strain HS) GN=rplB PE=3 SV=1 59 357 1.0E-66
sp|B1X6G8|RL2_ECODH 50S ribosomal protein L2 OS=Escherichia coli (strain K12 / DH10B) GN=rplB PE=3 SV=1 59 357 1.0E-66
sp|C4ZUH2|RL2_ECOBW 50S ribosomal protein L2 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rplB PE=3 SV=1 59 357 1.0E-66
sp|B7M1N1|RL2_ECO8A 50S ribosomal protein L2 OS=Escherichia coli O8 (strain IAI1) GN=rplB PE=3 SV=1 59 357 1.0E-66
sp|B7N1A1|RL2_ECO81 50S ribosomal protein L2 OS=Escherichia coli O81 (strain ED1a) GN=rplB PE=3 SV=1 59 357 1.0E-66
sp|B7NLN6|RL2_ECO7I 50S ribosomal protein L2 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rplB PE=3 SV=1 59 357 1.0E-66
sp|B5YTN8|RL2_ECO5E 50S ribosomal protein L2 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rplB PE=3 SV=1 59 357 1.0E-66
sp|P60424|RL2_ECO57 50S ribosomal protein L2 OS=Escherichia coli O157:H7 GN=rplB PE=3 SV=2 59 357 1.0E-66
sp|B7L4K6|RL2_ECO55 50S ribosomal protein L2 OS=Escherichia coli (strain 55989 / EAEC) GN=rplB PE=3 SV=1 59 357 1.0E-66
sp|B7MCT2|RL2_ECO45 50S ribosomal protein L2 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rplB PE=3 SV=1 59 357 1.0E-66
sp|B7UK41|RL2_ECO27 50S ribosomal protein L2 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rplB PE=3 SV=1 59 357 1.0E-66
sp|A7ZSK6|RL2_ECO24 50S ribosomal protein L2 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rplB PE=3 SV=1 59 357 1.0E-66
sp|B3PK40|RL2_CELJU 50S ribosomal protein L2 OS=Cellvibrio japonicus (strain Ueda107) GN=rplB PE=3 SV=1 59 357 1.0E-66
sp|Q6F7R5|RL2_ACIAD 50S ribosomal protein L2 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rplB PE=3 SV=1 55 360 1.0E-66
sp|P60428|RL2_SALTY 50S ribosomal protein L2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rplB PE=3 SV=1 59 362 2.0E-66
sp|P60427|RL2_SALTI 50S ribosomal protein L2 OS=Salmonella typhi GN=rplB PE=3 SV=1 59 362 2.0E-66
sp|B4TXD9|RL2_SALSV 50S ribosomal protein L2 OS=Salmonella schwarzengrund (strain CVM19633) GN=rplB PE=3 SV=1 59 362 2.0E-66
sp|B5BGY3|RL2_SALPK 50S ribosomal protein L2 OS=Salmonella paratyphi A (strain AKU_12601) GN=rplB PE=3 SV=1 59 362 2.0E-66
sp|A9MSZ5|RL2_SALPB 50S ribosomal protein L2 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rplB PE=3 SV=1 59 362 2.0E-66
sp|Q5PIV5|RL2_SALPA 50S ribosomal protein L2 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rplB PE=3 SV=1 59 362 2.0E-66
sp|B4SUT7|RL2_SALNS 50S ribosomal protein L2 OS=Salmonella newport (strain SL254) GN=rplB PE=3 SV=1 59 362 2.0E-66
sp|B4TKL2|RL2_SALHS 50S ribosomal protein L2 OS=Salmonella heidelberg (strain SL476) GN=rplB PE=3 SV=1 59 362 2.0E-66
sp|B5RH18|RL2_SALG2 50S ribosomal protein L2 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rplB PE=3 SV=1 59 362 2.0E-66
sp|B5R288|RL2_SALEP 50S ribosomal protein L2 OS=Salmonella enteritidis PT4 (strain P125109) GN=rplB PE=3 SV=1 59 362 2.0E-66
sp|B5FJL1|RL2_SALDC 50S ribosomal protein L2 OS=Salmonella dublin (strain CT_02021853) GN=rplB PE=3 SV=1 59 362 2.0E-66
sp|Q57J35|RL2_SALCH 50S ribosomal protein L2 OS=Salmonella choleraesuis (strain SC-B67) GN=rplB PE=3 SV=1 59 362 2.0E-66
sp|A9MN51|RL2_SALAR 50S ribosomal protein L2 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rplB PE=3 SV=1 59 362 2.0E-66
sp|B5F8E9|RL2_SALA4 50S ribosomal protein L2 OS=Salmonella agona (strain SL483) GN=rplB PE=3 SV=1 59 362 2.0E-66
sp|A4WFC5|RL2_ENT38 50S ribosomal protein L2 OS=Enterobacter sp. (strain 638) GN=rplB PE=3 SV=1 59 362 2.0E-66
sp|B2VK61|RL2_ERWT9 50S ribosomal protein L2 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rplB PE=3 SV=1 59 362 3.0E-66
sp|Q1H4N4|RL2_METFK 50S ribosomal protein L2 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=rplB PE=3 SV=1 59 363 3.0E-66
sp|B1JIW4|RL2_YERPY 50S ribosomal protein L2 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rplB PE=3 SV=1 59 362 3.0E-66
sp|P60437|RL2_YERPS 50S ribosomal protein L2 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rplB PE=3 SV=1 59 362 3.0E-66
sp|A4TGZ5|RL2_YERPP 50S ribosomal protein L2 OS=Yersinia pestis (strain Pestoides F) GN=rplB PE=3 SV=1 59 362 3.0E-66
sp|Q1CCU7|RL2_YERPN 50S ribosomal protein L2 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rplB PE=3 SV=1 59 362 3.0E-66
sp|A9R8Z9|RL2_YERPG 50S ribosomal protein L2 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rplB PE=3 SV=1 59 362 3.0E-66
sp|P60436|RL2_YERPE 50S ribosomal protein L2 OS=Yersinia pestis GN=rplB PE=3 SV=1 59 362 3.0E-66
sp|B2K5M7|RL2_YERPB 50S ribosomal protein L2 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rplB PE=3 SV=1 59 362 3.0E-66
sp|Q1C2V0|RL2_YERPA 50S ribosomal protein L2 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rplB PE=3 SV=1 59 362 3.0E-66
sp|A7FNN2|RL2_YERP3 50S ribosomal protein L2 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rplB PE=3 SV=1 59 362 3.0E-66
sp|C5BGM2|RL2_EDWI9 50S ribosomal protein L2 OS=Edwardsiella ictaluri (strain 93-146) GN=rplB PE=3 SV=1 59 362 4.0E-66
sp|Q63Q14|RL2_BURPS 50S ribosomal protein L2 OS=Burkholderia pseudomallei (strain K96243) GN=rplB PE=3 SV=1 59 341 4.0E-66
sp|A3NEH6|RL2_BURP6 50S ribosomal protein L2 OS=Burkholderia pseudomallei (strain 668) GN=rplB PE=3 SV=1 59 341 4.0E-66
sp|Q3JMR6|RL2_BURP1 50S ribosomal protein L2 OS=Burkholderia pseudomallei (strain 1710b) GN=rplB PE=3 SV=1 59 341 4.0E-66
sp|A3P0B0|RL2_BURP0 50S ribosomal protein L2 OS=Burkholderia pseudomallei (strain 1106a) GN=rplB PE=3 SV=1 59 341 4.0E-66
sp|A1V8A0|RL2_BURMS 50S ribosomal protein L2 OS=Burkholderia mallei (strain SAVP1) GN=rplB PE=3 SV=1 59 341 4.0E-66
sp|Q62GK8|RL2_BURMA 50S ribosomal protein L2 OS=Burkholderia mallei (strain ATCC 23344) GN=rplB PE=3 SV=1 59 341 4.0E-66
sp|Q487Z6|RL2_COLP3 50S ribosomal protein L2 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=rplB PE=3 SV=1 59 357 4.0E-66
sp|P49239|RL2_YEREN 50S ribosomal protein L2 OS=Yersinia enterocolitica GN=rplB PE=3 SV=1 59 362 5.0E-66
sp|A1JS34|RL2_YERE8 50S ribosomal protein L2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rplB PE=3 SV=1 59 362 5.0E-66
sp|A1T0D9|RL2_PSYIN 50S ribosomal protein L2 OS=Psychromonas ingrahamii (strain 37) GN=rplB PE=3 SV=1 59 357 7.0E-66
sp|Q8XV15|RL2_RALSO 50S ribosomal protein L2 OS=Ralstonia solanacearum (strain GMI1000) GN=rplB PE=3 SV=1 59 347 7.0E-66
sp|A9ADJ6|RL2_BURM1 50S ribosomal protein L2 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=rplB PE=3 SV=1 59 341 8.0E-66
sp|Q2SU30|RL2_BURTA 50S ribosomal protein L2 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rplB PE=3 SV=1 59 341 9.0E-66
sp|Q9K1I5|RL2_NEIMB 50S ribosomal protein L2 OS=Neisseria meningitidis serogroup B (strain MC58) GN=rplB PE=3 SV=1 59 365 1.0E-65
sp|A8GYX9|RL2_SHEPA 50S ribosomal protein L2 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rplB PE=3 SV=1 59 357 1.0E-65
sp|C4L7T3|RL2_TOLAT 50S ribosomal protein L2 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rplB PE=3 SV=1 59 357 1.0E-65
sp|Q5HAS5|RL2_EHRRW 50S ribosomal protein L2 OS=Ehrlichia ruminantium (strain Welgevonden) GN=rplB PE=3 SV=1 55 356 2.0E-65
sp|Q5FFU3|RL2_EHRRG 50S ribosomal protein L2 OS=Ehrlichia ruminantium (strain Gardel) GN=rplB PE=3 SV=1 55 356 2.0E-65
sp|Q7MYF4|RL2_PHOLL 50S ribosomal protein L2 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rplB PE=3 SV=1 59 357 2.0E-65
sp|C3LRQ5|RL2_VIBCM 50S ribosomal protein L2 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rplB PE=3 SV=1 59 357 2.0E-65
sp|Q9KNY7|RL2_VIBCH 50S ribosomal protein L2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rplB PE=3 SV=1 59 357 2.0E-65
sp|A5F546|RL2_VIBC3 50S ribosomal protein L2 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rplB PE=3 SV=1 59 357 2.0E-65
sp|Q9HWD8|RL2_PSEAE 50S ribosomal protein L2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rplB PE=3 SV=1 59 357 4.0E-65
sp|Q02T77|RL2_PSEAB 50S ribosomal protein L2 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rplB PE=3 SV=1 59 357 4.0E-65
sp|B7V647|RL2_PSEA8 50S ribosomal protein L2 OS=Pseudomonas aeruginosa (strain LESB58) GN=rplB PE=3 SV=1 59 357 4.0E-65
sp|A6UZJ1|RL2_PSEA7 50S ribosomal protein L2 OS=Pseudomonas aeruginosa (strain PA7) GN=rplB PE=3 SV=1 59 357 4.0E-65
sp|B0TM09|RL2_SHEHH 50S ribosomal protein L2 OS=Shewanella halifaxensis (strain HAW-EB4) GN=rplB PE=3 SV=1 59 357 7.0E-65
sp|A5EX79|RL2_DICNV 50S ribosomal protein L2 OS=Dichelobacter nodosus (strain VCS1703A) GN=rplB PE=3 SV=1 57 362 7.0E-65
sp|Q3SLP6|RL2_THIDA 50S ribosomal protein L2 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=rplB PE=3 SV=1 59 347 7.0E-65
sp|A2S7H9|RL2_BURM9 50S ribosomal protein L2 OS=Burkholderia mallei (strain NCTC 10229) GN=rplB PE=3 SV=1 59 341 8.0E-65
sp|A3MRV7|RL2_BURM7 50S ribosomal protein L2 OS=Burkholderia mallei (strain NCTC 10247) GN=rplB PE=3 SV=1 59 341 8.0E-65
sp|Q2L2F1|RL2_BORA1 50S ribosomal protein L2 OS=Bordetella avium (strain 197N) GN=rplB PE=3 SV=1 59 362 9.0E-65
sp|Q73H89|RL2_WOLPM 50S ribosomal protein L2 OS=Wolbachia pipientis wMel GN=rplB PE=3 SV=1 55 356 9.0E-65
sp|B8GV55|RL2_THISH 50S ribosomal protein L2 OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=rplB PE=3 SV=1 59 357 9.0E-65
sp|B2UEL6|RL2_RALPJ 50S ribosomal protein L2 OS=Ralstonia pickettii (strain 12J) GN=rplB PE=3 SV=1 59 360 1.0E-64
sp|Q82X85|RL2_NITEU 50S ribosomal protein L2 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rplB PE=3 SV=1 55 360 1.0E-64
sp|C0R306|RL2_WOLWR 50S ribosomal protein L2 OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=rplB PE=3 SV=1 55 356 1.0E-64
sp|A9IIZ6|RL2_BORPD 50S ribosomal protein L2 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=rplB PE=3 SV=1 59 362 2.0E-64
sp|Q2NQM5|RL2_SODGM 50S ribosomal protein L2 OS=Sodalis glossinidius (strain morsitans) GN=rplB PE=3 SV=1 59 362 2.0E-64
sp|Q21M54|RL2_SACD2 50S ribosomal protein L2 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=rplB PE=3 SV=1 59 357 2.0E-64
sp|A3DJH5|RL2_CLOTH 50S ribosomal protein L2 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=rplB PE=3 SV=1 55 350 3.0E-64
sp|B8CND6|RL2_SHEPW 50S ribosomal protein L2 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rplB PE=3 SV=1 59 357 3.0E-64
sp|Q2S915|RL2_HAHCH 50S ribosomal protein L2 OS=Hahella chejuensis (strain KCTC 2396) GN=rplB PE=3 SV=1 59 357 4.0E-64
sp|B3R7S0|RL2_CUPTR 50S ribosomal protein L2 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=rplB PE=3 SV=1 59 360 5.0E-64
sp|A1KRH6|RL2_NEIMF 50S ribosomal protein L2 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=rplB PE=3 SV=1 59 365 5.0E-64
sp|Q9JX12|RL2_NEIMA 50S ribosomal protein L2 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rplB PE=3 SV=1 59 365 5.0E-64
sp|B0K5P6|RL2_THEPX 50S ribosomal protein L2 OS=Thermoanaerobacter sp. (strain X514) GN=rplB PE=3 SV=1 55 349 6.0E-64
sp|B0KCK3|RL2_THEP3 50S ribosomal protein L2 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rplB PE=3 SV=1 55 349 6.0E-64
sp|Q12SV6|RL2_SHEDO 50S ribosomal protein L2 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rplB PE=3 SV=1 59 357 6.0E-64
sp|Q8EK65|RL2_SHEON 50S ribosomal protein L2 OS=Shewanella oneidensis (strain MR-1) GN=rplB PE=3 SV=1 59 357 7.0E-64
sp|A3Q985|RL2_SHELP 50S ribosomal protein L2 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rplB PE=3 SV=1 59 357 1.0E-63
sp|Q7VTD0|RL2_BORPE 50S ribosomal protein L2 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=rplB PE=3 SV=1 59 362 1.0E-63
sp|Q7W2F3|RL2_BORPA 50S ribosomal protein L2 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=rplB PE=3 SV=1 59 362 1.0E-63
sp|Q7WRC2|RL2_BORBR 50S ribosomal protein L2 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=rplB PE=3 SV=1 59 362 1.0E-63
sp|A9M3W3|RL2_NEIM0 50S ribosomal protein L2 OS=Neisseria meningitidis serogroup C (strain 053442) GN=rplB PE=3 SV=1 59 365 1.0E-63
sp|B4RQY1|RL2_NEIG2 50S ribosomal protein L2 OS=Neisseria gonorrhoeae (strain NCCP11945) GN=rplB PE=3 SV=1 59 365 1.0E-63
sp|Q5F5T0|RL2_NEIG1 50S ribosomal protein L2 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=rplB PE=3 SV=1 59 365 1.0E-63
sp|Q0I0A2|RL2_SHESR 50S ribosomal protein L2 OS=Shewanella sp. (strain MR-7) GN=rplB PE=3 SV=1 59 357 1.0E-63
sp|Q0HNT4|RL2_SHESM 50S ribosomal protein L2 OS=Shewanella sp. (strain MR-4) GN=rplB PE=3 SV=1 59 357 1.0E-63
sp|A0KRM7|RL2_SHESA 50S ribosomal protein L2 OS=Shewanella sp. (strain ANA-3) GN=rplB PE=3 SV=1 59 357 1.0E-63
sp|A4G9T5|RL2_HERAR 50S ribosomal protein L2 OS=Herminiimonas arsenicoxydans GN=rplB PE=3 SV=1 59 360 1.0E-63
sp|A6W389|RL2_MARMS 50S ribosomal protein L2 OS=Marinomonas sp. (strain MWYL1) GN=rplB PE=3 SV=1 59 357 3.0E-63
sp|Q0AIJ2|RL2_NITEC 50S ribosomal protein L2 OS=Nitrosomonas eutropha (strain C91) GN=rplB PE=3 SV=1 55 360 3.0E-63
sp|A1WVB9|RL2_HALHL 50S ribosomal protein L2 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=rplB PE=3 SV=1 59 362 3.0E-63
sp|Q089Q1|RL2_SHEFN 50S ribosomal protein L2 OS=Shewanella frigidimarina (strain NCIMB 400) GN=rplB PE=3 SV=1 59 357 3.0E-63
sp|A1TYK0|RL2_MARHV 50S ribosomal protein L2 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rplB PE=3 SV=1 59 357 3.0E-63
sp|Q12GW8|RL2_POLSJ 50S ribosomal protein L2 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=rplB PE=3 SV=1 59 362 3.0E-63
sp|B1KMY0|RL2_SHEWM 50S ribosomal protein L2 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rplB PE=3 SV=1 59 357 3.0E-63
sp|A1VIQ3|RL2_POLNA 50S ribosomal protein L2 OS=Polaromonas naphthalenivorans (strain CJ2) GN=rplB PE=3 SV=1 59 362 3.0E-63
sp|A6T3K1|RL2_JANMA 50S ribosomal protein L2 OS=Janthinobacterium sp. (strain Marseille) GN=rplB PE=3 SV=1 59 360 4.0E-63
sp|Q2GH53|RL2_EHRCR 50S ribosomal protein L2 OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=rplB PE=3 SV=1 76 356 4.0E-63
sp|A8GKJ4|RL2_SERP5 50S ribosomal protein L2 OS=Serratia proteamaculans (strain 568) GN=rplB PE=3 SV=1 59 362 4.0E-63
sp|A4IZT1|RL2_FRATW 50S ribosomal protein L2 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=rplB PE=3 SV=1 53 360 5.0E-63
sp|Q5NHW5|RL2_FRATT 50S ribosomal protein L2 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=rplB PE=3 SV=1 53 360 5.0E-63
sp|A0Q4I6|RL2_FRATN 50S ribosomal protein L2 OS=Francisella tularensis subsp. novicida (strain U112) GN=rplB PE=3 SV=1 53 360 5.0E-63
sp|Q14JB7|RL2_FRAT1 50S ribosomal protein L2 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=rplB PE=3 SV=1 53 360 5.0E-63
sp|Q3A9R9|RL2_CARHZ 50S ribosomal protein L2 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rplB PE=3 SV=1 55 360 5.0E-63
sp|B2SDY2|RL2_FRATM 50S ribosomal protein L2 OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=rplB PE=3 SV=1 53 360 6.0E-63
sp|A1REB7|RL2_SHESW 50S ribosomal protein L2 OS=Shewanella sp. (strain W3-18-1) GN=rplB PE=3 SV=1 59 357 6.0E-63
sp|A4YBY0|RL2_SHEPC 50S ribosomal protein L2 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rplB PE=3 SV=1 59 357 6.0E-63
sp|Q0BNS4|RL2_FRATO 50S ribosomal protein L2 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=rplB PE=3 SV=1 53 360 6.0E-63
sp|Q2A5G7|RL2_FRATH 50S ribosomal protein L2 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=rplB PE=3 SV=1 53 360 6.0E-63
sp|A7N9S9|RL2_FRATF 50S ribosomal protein L2 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=rplB PE=3 SV=1 53 360 6.0E-63
sp|B3CN29|RL2_WOLPP 50S ribosomal protein L2 OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=rplB PE=3 SV=1 55 356 7.0E-63
sp|A9KWA5|RL2_SHEB9 50S ribosomal protein L2 OS=Shewanella baltica (strain OS195) GN=rplB PE=3 SV=1 59 357 7.0E-63
sp|A6WHT1|RL2_SHEB8 50S ribosomal protein L2 OS=Shewanella baltica (strain OS185) GN=rplB PE=3 SV=1 59 357 7.0E-63
sp|A3DA69|RL2_SHEB5 50S ribosomal protein L2 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rplB PE=3 SV=1 59 357 7.0E-63
sp|B8EBK2|RL2_SHEB2 50S ribosomal protein L2 OS=Shewanella baltica (strain OS223) GN=rplB PE=3 SV=1 59 357 7.0E-63
sp|C5CP50|RL2_VARPS 50S ribosomal protein L2 OS=Variovorax paradoxus (strain S110) GN=rplB PE=3 SV=1 59 360 8.0E-63
sp|B1Y8I4|RL2_LEPCP 50S ribosomal protein L2 OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=rplB PE=3 SV=1 59 362 9.0E-63
sp|Q15YN6|RL2_PSEA6 50S ribosomal protein L2 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rplB PE=3 SV=1 48 357 9.0E-63
sp|Q4FUF3|RL2_PSYA2 50S ribosomal protein L2 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rplB PE=3 SV=1 59 347 1.0E-62
sp|C5BQ64|RL2_TERTT 50S ribosomal protein L2 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=rplB PE=3 SV=1 59 357 1.0E-62
sp|Q1QDI3|RL2_PSYCK 50S ribosomal protein L2 OS=Psychrobacter cryohalolentis (strain K5) GN=rplB PE=3 SV=1 59 351 1.0E-62
sp|B9MKH8|RL2_CALBD 50S ribosomal protein L2 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=rplB PE=3 SV=1 57 360 1.0E-62
sp|A0ALW5|RL2_LISW6 50S ribosomal protein L2 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rplB PE=3 SV=1 55 362 1.0E-62
sp|B4S094|RL2_ALTMD 50S ribosomal protein L2 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=rplB1 PE=3 SV=1 48 357 1.0E-62
sp|B0U0Y6|RL2_FRAP2 50S ribosomal protein L2 OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=rplB PE=3 SV=1 53 360 1.0E-62
sp|Q1AU32|RL2_RUBXD 50S ribosomal protein L2 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=rplB PE=3 SV=1 56 368 2.0E-62
sp|P60426|RL2_LISMO 50S ribosomal protein L2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rplB PE=3 SV=1 55 362 3.0E-62
sp|Q71WE9|RL2_LISMF 50S ribosomal protein L2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rplB PE=3 SV=1 55 362 3.0E-62
sp|C1KZH7|RL2_LISMC 50S ribosomal protein L2 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=rplB PE=3 SV=1 55 362 3.0E-62
sp|P60425|RL2_LISIN 50S ribosomal protein L2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rplB PE=3 SV=1 55 362 3.0E-62
sp|A8F988|RL2_BACP2 50S ribosomal protein L2 OS=Bacillus pumilus (strain SAFR-032) GN=rplB PE=3 SV=1 55 363 6.0E-62
sp|A5WCJ3|RL2_PSYWF 50S ribosomal protein L2 OS=Psychrobacter sp. (strain PRwf-1) GN=rplB PE=3 SV=1 59 347 6.0E-62
sp|Q3YRL2|RL2_EHRCJ 50S ribosomal protein L2 OS=Ehrlichia canis (strain Jake) GN=rplB PE=3 SV=1 76 356 8.0E-62
sp|A1S221|RL2_SHEAM 50S ribosomal protein L2 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rplB PE=3 SV=1 59 357 2.0E-61
sp|A5N4Q0|RL2_CLOK5 50S ribosomal protein L2 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=rplB PE=3 SV=1 55 357 2.0E-61
sp|B9DYB2|RL2_CLOK1 50S ribosomal protein L2 OS=Clostridium kluyveri (strain NBRC 12016) GN=rplB PE=3 SV=1 55 357 2.0E-61
sp|B8E1D6|RL2_DICTD 50S ribosomal protein L2 OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=rplB PE=3 SV=1 55 357 2.0E-61
sp|Q0ABH2|RL2_ALKEH 50S ribosomal protein L2 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=rplB PE=3 SV=1 59 362 2.0E-61
sp|A4VHN3|RL2_PSEU5 50S ribosomal protein L2 OS=Pseudomonas stutzeri (strain A1501) GN=rplB PE=3 SV=1 59 347 2.0E-61
sp|B0BST4|RL2_ACTPJ 50S ribosomal protein L2 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rplB PE=3 SV=1 59 357 2.0E-61
sp|B3GZ14|RL2_ACTP7 50S ribosomal protein L2 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rplB PE=3 SV=1 59 357 2.0E-61
sp|A3N361|RL2_ACTP2 50S ribosomal protein L2 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rplB PE=3 SV=1 59 357 2.0E-61
sp|A5D5J3|RL2_PELTS 50S ribosomal protein L2 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=rplB PE=3 SV=1 55 362 2.0E-61
sp|Q1R0H2|RL2_CHRSD 50S ribosomal protein L2 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rplB PE=3 SV=1 59 357 2.0E-61
sp|A8G1E5|RL2_SHESH 50S ribosomal protein L2 OS=Shewanella sediminis (strain HAW-EB3) GN=rplB PE=3 SV=1 59 357 3.0E-61
sp|B5YDU6|RL2_DICT6 50S ribosomal protein L2 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=rplB PE=3 SV=1 55 357 3.0E-61
sp|C0QQM6|RL2_PERMH 50S ribosomal protein L2 OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=rplB PE=3 SV=1 55 348 3.0E-61
sp|Q0K622|RL2_CUPNH 50S ribosomal protein L2 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rplB PE=3 SV=1 59 360 3.0E-61
sp|Q21RW1|RL2_RHOFT 50S ribosomal protein L2 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=rplB PE=3 SV=1 59 362 3.0E-61
sp|Q0VSK0|RL2_ALCBS 50S ribosomal protein L2 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rplB PE=3 SV=1 59 360 4.0E-61
sp|Q5GSU7|RL2_WOLTR 50S ribosomal protein L2 OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=rplB PE=3 SV=1 55 340 4.0E-61
sp|C1DKL6|RL2_AZOVD 50S ribosomal protein L2 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=rplB PE=3 SV=1 59 357 4.0E-61
sp|A5CXK7|RL2_VESOH 50S ribosomal protein L2 OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=rplB PE=3 SV=1 59 365 5.0E-61
sp|A4XLS7|RL2_CALS8 50S ribosomal protein L2 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rplB PE=3 SV=1 57 360 5.0E-61
sp|Q2W2J4|RL2_MAGSA 50S ribosomal protein L2 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rplB PE=3 SV=1 55 357 5.0E-61
sp|Q65QV8|RL2_MANSM 50S ribosomal protein L2 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rplB PE=3 SV=1 59 357 5.0E-61
sp|Q9CL35|RL2_PASMU 50S ribosomal protein L2 OS=Pasteurella multocida (strain Pm70) GN=rplB PE=3 SV=1 59 357 5.0E-61
sp|Q057A7|RL2_BUCCC 50S ribosomal protein L2 OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=rplB PE=3 SV=1 59 360 6.0E-61
sp|Q46WE7|RL2_CUPPJ 50S ribosomal protein L2 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=rplB PE=3 SV=1 59 360 6.0E-61
sp|Q7VKD5|RL2_HAEDU 50S ribosomal protein L2 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rplB PE=3 SV=1 59 357 7.0E-61
sp|B2FQ48|RL2_STRMK 50S ribosomal protein L2 OS=Stenotrophomonas maltophilia (strain K279a) GN=rplB PE=3 SV=1 55 360 7.0E-61
sp|B4SKW6|RL2_STRM5 50S ribosomal protein L2 OS=Stenotrophomonas maltophilia (strain R551-3) GN=rplB PE=3 SV=1 55 360 7.0E-61
sp|Q493K5|RL2_BLOPB 50S ribosomal protein L2 OS=Blochmannia pennsylvanicus (strain BPEN) GN=rplB PE=3 SV=1 60 360 8.0E-61
sp|B0UX16|RL2_HISS2 50S ribosomal protein L2 OS=Histophilus somni (strain 2336) GN=rplB PE=3 SV=1 59 357 8.0E-61
sp|P44343|RL2_HAEIN 50S ribosomal protein L2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rplB PE=3 SV=2 59 357 1.0E-60
sp|A5UHT3|RL2_HAEIG 50S ribosomal protein L2 OS=Haemophilus influenzae (strain PittGG) GN=rplB PE=3 SV=1 59 357 1.0E-60
sp|A5UDU4|RL2_HAEIE 50S ribosomal protein L2 OS=Haemophilus influenzae (strain PittEE) GN=rplB PE=3 SV=1 59 357 1.0E-60
sp|Q4QMB9|RL2_HAEI8 50S ribosomal protein L2 OS=Haemophilus influenzae (strain 86-028NP) GN=rplB PE=3 SV=1 59 357 1.0E-60
sp|Q0I160|RL2_HAES1 50S ribosomal protein L2 OS=Haemophilus somnus (strain 129Pt) GN=rplB PE=3 SV=1 59 357 1.0E-60
sp|B8D846|RL2_BUCAT 50S ribosomal protein L2 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=rplB PE=3 SV=1 59 360 1.0E-60
sp|P57588|RL2_BUCAI 50S ribosomal protein L2 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rplB PE=3 SV=1 59 360 1.0E-60
sp|B8D9U4|RL2_BUCA5 50S ribosomal protein L2 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=rplB PE=3 SV=1 59 360 1.0E-60
sp|Q8R7V7|RL2_CALS4 50S ribosomal protein L2 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rplB PE=3 SV=1 55 349 2.0E-60
sp|Q605B5|RL2_METCA 50S ribosomal protein L2 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rplB PE=3 SV=2 59 347 2.0E-60
sp|B0TC59|RL2_HELMI 50S ribosomal protein L2 OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=rplB PE=3 SV=1 55 362 2.0E-60
sp|Q1LI40|RL2_CUPMC 50S ribosomal protein L2 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=rplB PE=3 SV=1 59 360 2.0E-60
sp|Q7VQE5|RL2_BLOFL 50S ribosomal protein L2 OS=Blochmannia floridanus GN=rplB PE=3 SV=1 60 362 2.0E-60
sp|Q3J8R7|RL2_NITOC 50S ribosomal protein L2 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=rplB PE=3 SV=1 59 357 2.0E-60
sp|C1DAS0|RL2_LARHH 50S ribosomal protein L2 OS=Laribacter hongkongensis (strain HLHK9) GN=rplB PE=3 SV=1 59 347 3.0E-60
sp|B8G1W9|RL2_DESHD 50S ribosomal protein L2 OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=rplB PE=3 SV=1 55 360 4.0E-60
sp|A6VLJ1|RL2_ACTSZ 50S ribosomal protein L2 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rplB PE=3 SV=1 59 357 5.0E-60
sp|Q5L3Z4|RL2_GEOKA 50S ribosomal protein L2 OS=Geobacillus kaustophilus (strain HTA426) GN=rplB PE=3 SV=1 55 351 5.0E-60
sp|P42919|RL2_BACSU 50S ribosomal protein L2 OS=Bacillus subtilis (strain 168) GN=rplB PE=1 SV=3 55 363 5.0E-60
sp|B2V7L0|RL2_SULSY 50S ribosomal protein L2 OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=rplB PE=3 SV=1 55 348 5.0E-60
sp|A8EZL3|RL2_RICCK 50S ribosomal protein L2 OS=Rickettsia canadensis (strain McKiel) GN=rplB PE=3 SV=1 55 360 5.0E-60
sp|P04257|RL2_GEOSE 50S ribosomal protein L2 OS=Geobacillus stearothermophilus GN=rplB PE=1 SV=2 55 351 1.0E-59
sp|Q5WZK9|RL2_LEGPL 50S ribosomal protein L2 OS=Legionella pneumophila (strain Lens) GN=rplB PE=3 SV=1 59 362 1.0E-59
sp|A1TJ10|RL2_ACIAC 50S ribosomal protein L2 OS=Acidovorax citrulli (strain AAC00-1) GN=rplB PE=3 SV=1 59 362 2.0E-59
sp|A2SLF4|RL2_METPP 50S ribosomal protein L2 OS=Methylibium petroleiphilum (strain PM1) GN=rplB PE=3 SV=1 59 362 2.0E-59
sp|Q47JA0|RL2_DECAR 50S ribosomal protein L2 OS=Dechloromonas aromatica (strain RCB) GN=rplB PE=3 SV=1 59 360 2.0E-59
sp|Q2RFQ0|RL2_MOOTA 50S ribosomal protein L2 OS=Moorella thermoacetica (strain ATCC 39073) GN=rplB PE=3 SV=1 55 360 2.0E-59
sp|Q250M9|RL2_DESHY 50S ribosomal protein L2 OS=Desulfitobacterium hafniense (strain Y51) GN=rplB PE=3 SV=1 55 360 3.0E-59
sp|Q31IX9|RL2_THICR 50S ribosomal protein L2 OS=Thiomicrospira crunogena (strain XCL-2) GN=rplB PE=3 SV=1 55 357 3.0E-59
sp|A4IJJ2|RL2_GEOTN 50S ribosomal protein L2 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rplB PE=3 SV=1 55 351 3.0E-59
sp|B8D0C7|RL2_HALOH 50S ribosomal protein L2 OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=rplB PE=3 SV=1 55 360 3.0E-59
sp|C5D3S0|RL2_GEOSW 50S ribosomal protein L2 OS=Geobacillus sp. (strain WCH70) GN=rplB PE=3 SV=1 55 351 3.0E-59
sp|A4SUW4|RL2_POLSQ 50S ribosomal protein L2 OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=rplB PE=3 SV=1 55 360 4.0E-59
sp|A1KB24|RL2_AZOSB 50S ribosomal protein L2 OS=Azoarcus sp. (strain BH72) GN=rplB PE=3 SV=1 59 360 4.0E-59
sp|A7Z0P1|RL2_BACMF 50S ribosomal protein L2 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rplB PE=3 SV=1 55 363 4.0E-59
sp|Q7NQF5|RL2_CHRVO 50S ribosomal protein L2 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=rplB PE=3 SV=1 59 365 4.0E-59
sp|Q18CG3|RL2_PEPD6 50S ribosomal protein L2 OS=Peptoclostridium difficile (strain 630) GN=rplB PE=3 SV=1 55 360 4.0E-59
sp|Q65PA4|RL2_BACLD 50S ribosomal protein L2 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rplB PE=3 SV=1 55 363 5.0E-59
sp|A9BPS1|RL2_DELAS 50S ribosomal protein L2 OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=rplB PE=3 SV=1 59 362 5.0E-59
sp|A8GPE7|RL2_RICAH 50S ribosomal protein L2 OS=Rickettsia akari (strain Hartford) GN=rplB PE=3 SV=1 55 360 5.0E-59
sp|Q890P1|RL2_CLOTE 50S ribosomal protein L2 OS=Clostridium tetani (strain Massachusetts / E88) GN=rplB PE=3 SV=2 55 348 6.0E-59
sp|Q1RHM4|RL2_RICBR 50S ribosomal protein L2 OS=Rickettsia bellii (strain RML369-C) GN=rplB PE=3 SV=1 55 360 8.0E-59
sp|A8GVB7|RL2_RICB8 50S ribosomal protein L2 OS=Rickettsia bellii (strain OSU 85-389) GN=rplB PE=3 SV=1 55 360 8.0E-59
sp|P55835|RL2_AGGAC 50S ribosomal protein L2 OS=Aggregatibacter actinomycetemcomitans GN=rplB PE=3 SV=2 59 357 8.0E-59
sp|B1XSQ4|RL2_POLNS 50S ribosomal protein L2 OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=rplB PE=3 SV=1 55 360 8.0E-59
sp|A7GK23|RL2_BACCN 50S ribosomal protein L2 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rplB PE=3 SV=1 55 350 9.0E-59
sp|C0ZII3|RL2_BREBN 50S ribosomal protein L2 OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=rplB PE=3 SV=1 55 357 9.0E-59
sp|B8F758|RL2_HAEPS 50S ribosomal protein L2 OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=rplB PE=3 SV=1 59 357 9.0E-59
sp|C4K7B5|RL2_HAMD5 50S ribosomal protein L2 OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=rplB PE=3 SV=1 59 362 1.0E-58
sp|A8GT66|RL2_RICRS 50S ribosomal protein L2 OS=Rickettsia rickettsii (strain Sheila Smith) GN=rplB PE=3 SV=1 55 360 1.0E-58
sp|B0BUQ7|RL2_RICRO 50S ribosomal protein L2 OS=Rickettsia rickettsii (strain Iowa) GN=rplB PE=3 SV=1 55 360 1.0E-58
sp|Q92GW9|RL2_RICCN 50S ribosomal protein L2 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=rplB PE=3 SV=1 55 360 1.0E-58
sp|C3PPA4|RL2_RICAE 50S ribosomal protein L2 OS=Rickettsia africae (strain ESF-5) GN=rplB PE=3 SV=1 55 360 1.0E-58
sp|Q9ZCQ8|RL2_RICPR 50S ribosomal protein L2 OS=Rickettsia prowazekii (strain Madrid E) GN=rplB PE=3 SV=1 55 360 1.0E-58
sp|Q6HPQ5|RL2_BACHK 50S ribosomal protein L2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rplB PE=3 SV=1 55 350 1.0E-58
sp|Q63H87|RL2_BACCZ 50S ribosomal protein L2 OS=Bacillus cereus (strain ZK / E33L) GN=rplB PE=3 SV=1 55 350 1.0E-58
sp|B7HQU7|RL2_BACC7 50S ribosomal protein L2 OS=Bacillus cereus (strain AH187) GN=rplB PE=3 SV=1 55 350 1.0E-58
sp|C1ET42|RL2_BACC3 50S ribosomal protein L2 OS=Bacillus cereus (strain 03BB102) GN=rplB PE=3 SV=1 55 350 1.0E-58
sp|Q73F93|RL2_BACC1 50S ribosomal protein L2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rplB PE=3 SV=1 55 350 1.0E-58
sp|B7JKC2|RL2_BACC0 50S ribosomal protein L2 OS=Bacillus cereus (strain AH820) GN=rplB PE=3 SV=1 55 350 1.0E-58
sp|Q81VS7|RL2_BACAN 50S ribosomal protein L2 OS=Bacillus anthracis GN=rplB PE=3 SV=1 55 350 1.0E-58
sp|A0R8I3|RL2_BACAH 50S ribosomal protein L2 OS=Bacillus thuringiensis (strain Al Hakam) GN=rplB PE=3 SV=1 55 350 1.0E-58
sp|C3LJ85|RL2_BACAC 50S ribosomal protein L2 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=rplB PE=3 SV=1 55 350 1.0E-58
sp|C3P9Q8|RL2_BACAA 50S ribosomal protein L2 OS=Bacillus anthracis (strain A0248) GN=rplB PE=3 SV=1 55 350 1.0E-58
sp|Q4UMS6|RL2_RICFE 50S ribosomal protein L2 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=rplB PE=3 SV=1 55 360 1.0E-58
sp|Q68W81|RL2_RICTY 50S ribosomal protein L2 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=rplB PE=3 SV=1 55 360 1.0E-58
sp|Q5ZYP0|RL2_LEGPH 50S ribosomal protein L2 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rplB PE=3 SV=1 59 362 2.0E-58
sp|A5IHR1|RL2_LEGPC 50S ribosomal protein L2 OS=Legionella pneumophila (strain Corby) GN=rplB PE=3 SV=1 59 362 2.0E-58
sp|Q5X856|RL2_LEGPA 50S ribosomal protein L2 OS=Legionella pneumophila (strain Paris) GN=rplB PE=3 SV=1 59 362 2.0E-58
sp|B2IK65|RL2_BEII9 50S ribosomal protein L2 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=rplB PE=3 SV=1 55 366 2.0E-58
sp|B5ELY2|RL2_ACIF5 50S ribosomal protein L2 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=rplB PE=3 SV=1 59 362 2.0E-58
sp|B7J470|RL2_ACIF2 50S ribosomal protein L2 OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=rplB PE=3 SV=1 59 362 2.0E-58
sp|Q39Y03|RL2_GEOMG 50S ribosomal protein L2 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=rplB PE=3 SV=1 55 362 2.0E-58
sp|B8ELG0|RL2_METSB 50S ribosomal protein L2 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=rplB PE=3 SV=1 55 366 2.0E-58
sp|C5CGR1|RL2_KOSOT 50S ribosomal protein L2 OS=Kosmotoga olearia (strain TBF 19.5.1) GN=rplB PE=3 SV=1 55 360 2.0E-58
sp|Q2YAZ4|RL2_NITMU 50S ribosomal protein L2 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rplB PE=3 SV=1 59 365 2.0E-58
sp|C4K2H6|RL2_RICPU 50S ribosomal protein L2 OS=Rickettsia peacockii (strain Rustic) GN=rplB PE=3 SV=1 55 360 3.0E-58
sp|A0PXU9|RL2_CLONN 50S ribosomal protein L2 OS=Clostridium novyi (strain NT) GN=rplB PE=3 SV=1 55 348 3.0E-58
sp|Q81J39|RL2_BACCR 50S ribosomal protein L2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rplB PE=3 SV=1 55 350 4.0E-58
sp|B7HJ51|RL2_BACC4 50S ribosomal protein L2 OS=Bacillus cereus (strain B4264) GN=rplB PE=3 SV=1 55 350 4.0E-58
sp|B7IT22|RL2_BACC2 50S ribosomal protein L2 OS=Bacillus cereus (strain G9842) GN=rplB PE=3 SV=1 55 350 4.0E-58
sp|A4XZ87|RL2_PSEMY 50S ribosomal protein L2 OS=Pseudomonas mendocina (strain ymp) GN=rplB PE=3 SV=1 59 347 5.0E-58
sp|A8F2E4|RL2_RICM5 50S ribosomal protein L2 OS=Rickettsia massiliae (strain Mtu5) GN=rplB PE=3 SV=1 55 360 5.0E-58
sp|Q4K536|RL2_PSEF5 50S ribosomal protein L2 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rplB PE=3 SV=1 59 357 6.0E-58
sp|A1WHC8|RL2_VEREI 50S ribosomal protein L2 OS=Verminephrobacter eiseniae (strain EF01-2) GN=rplB PE=3 SV=1 59 362 6.0E-58
sp|Q4ZMP7|RL2_PSEU2 50S ribosomal protein L2 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rplB PE=3 SV=1 59 357 7.0E-58
sp|Q48D39|RL2_PSE14 50S ribosomal protein L2 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rplB PE=3 SV=1 59 357 7.0E-58
sp|B0RZU3|RL2_FINM2 50S ribosomal protein L2 OS=Finegoldia magna (strain ATCC 29328) GN=rplB PE=3 SV=1 55 357 8.0E-58
sp|Q889W8|RL2_PSESM 50S ribosomal protein L2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rplB PE=3 SV=1 59 357 9.0E-58
sp|B0KK70|RL2_PSEPG 50S ribosomal protein L2 OS=Pseudomonas putida (strain GB-1) GN=rplB PE=3 SV=1 59 347 9.0E-58
sp|Q3K5Z1|RL2_PSEPF 50S ribosomal protein L2 OS=Pseudomonas fluorescens (strain Pf0-1) GN=rplB PE=3 SV=1 59 357 9.0E-58
sp|C3K2X3|RL2_PSEFS 50S ribosomal protein L2 OS=Pseudomonas fluorescens (strain SBW25) GN=rplB PE=3 SV=1 59 357 1.0E-57
sp|Q8K953|RL2_BUCAP 50S ribosomal protein L2 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rplB PE=3 SV=1 59 360 1.0E-57
sp|B1YGV3|RL2_EXIS2 50S ribosomal protein L2 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=rplB PE=3 SV=1 55 357 1.0E-57
sp|B9IZJ7|RL2_BACCQ 50S ribosomal protein L2 OS=Bacillus cereus (strain Q1) GN=rplB PE=3 SV=1 55 350 1.0E-57
sp|A9VP80|RL2_BACWK 50S ribosomal protein L2 OS=Bacillus weihenstephanensis (strain KBAB4) GN=rplB PE=3 SV=1 55 350 1.0E-57
sp|Q1IFW3|RL2_PSEE4 50S ribosomal protein L2 OS=Pseudomonas entomophila (strain L48) GN=rplB PE=3 SV=1 59 347 1.0E-57
sp|B9L6N0|RL2_NAUPA 50S ribosomal protein L2 OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=rplB PE=3 SV=1 55 362 2.0E-57
sp|A9W4Q4|RL2_METEP 50S ribosomal protein L2 OS=Methylobacterium extorquens (strain PA1) GN=rplB PE=3 SV=1 55 360 2.0E-57
sp|B7L0R4|RL2_METC4 50S ribosomal protein L2 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rplB PE=3 SV=1 55 360 2.0E-57
sp|B1JDW1|RL2_PSEPW 50S ribosomal protein L2 OS=Pseudomonas putida (strain W619) GN=rplB PE=3 SV=1 59 347 2.0E-57
sp|Q88QN2|RL2_PSEPK 50S ribosomal protein L2 OS=Pseudomonas putida (strain KT2440) GN=rplB PE=3 SV=1 59 347 2.0E-57
sp|A5VXQ0|RL2_PSEP1 50S ribosomal protein L2 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rplB PE=3 SV=1 59 347 2.0E-57
sp|Q5WLQ9|RL2_BACSK 50S ribosomal protein L2 OS=Bacillus clausii (strain KSM-K16) GN=rplB PE=3 SV=1 55 357 2.0E-57
sp|Q0AUI3|RL2_SYNWW 50S ribosomal protein L2 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=rplB PE=3 SV=1 55 360 2.0E-57
sp|Q1ISB9|RL2_KORVE 50S ribosomal protein L2 OS=Koribacter versatilis (strain Ellin345) GN=rplB PE=3 SV=1 55 360 3.0E-57
sp|B8IS88|RL2_METNO 50S ribosomal protein L2 OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=rplB PE=3 SV=1 55 360 3.0E-57
sp|Q5GWT7|RL2_XANOR 50S ribosomal protein L2 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rplB PE=3 SV=1 55 360 3.0E-57
sp|Q2NZY8|RL2_XANOM 50S ribosomal protein L2 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=rplB PE=3 SV=1 55 360 3.0E-57
sp|Q3A6P4|RL2_PELCD 50S ribosomal protein L2 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=rplB PE=3 SV=1 55 357 3.0E-57
sp|Q3BWY0|RL2_XANC5 50S ribosomal protein L2 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rplB PE=3 SV=1 55 360 4.0E-57
sp|Q8PNS1|RL2_XANAC 50S ribosomal protein L2 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rplB PE=3 SV=1 55 360 4.0E-57
sp|A1AVK3|RL2_RUTMC 50S ribosomal protein L2 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=rplB PE=3 SV=1 59 365 5.0E-57
sp|P60401|RL2_GEOSL 50S ribosomal protein L2 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=rplB PE=3 SV=1 55 362 5.0E-57
sp|A1B030|RL2_PARDP 50S ribosomal protein L2 OS=Paracoccus denitrificans (strain Pd 1222) GN=rplB PE=3 SV=1 55 370 6.0E-57
sp|Q9Z9L1|RL2_BACHD 50S ribosomal protein L2 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rplB PE=3 SV=1 55 357 6.0E-57
sp|A4J114|RL2_DESRM 50S ribosomal protein L2 OS=Desulfotomaculum reducens (strain MI-1) GN=rplB PE=3 SV=1 55 370 6.0E-57
sp|C3KVP8|RL2_CLOB6 50S ribosomal protein L2 OS=Clostridium botulinum (strain 657 / Type Ba4) GN=rplB PE=3 SV=1 55 360 7.0E-57
sp|A8LM57|RL2_DINSH 50S ribosomal protein L2 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rplB PE=3 SV=1 55 370 8.0E-57
sp|Q0SQE7|RL2_CLOPS 50S ribosomal protein L2 OS=Clostridium perfringens (strain SM101 / Type A) GN=rplB PE=3 SV=1 55 369 8.0E-57
sp|Q8XHS6|RL2_CLOPE 50S ribosomal protein L2 OS=Clostridium perfringens (strain 13 / Type A) GN=rplB PE=3 SV=1 55 369 8.0E-57
sp|Q0TMP9|RL2_CLOP1 50S ribosomal protein L2 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=rplB PE=3 SV=1 55 369 8.0E-57
sp|B9E9J4|RL2_MACCJ 50S ribosomal protein L2 OS=Macrococcus caseolyticus (strain JCSC5402) GN=rplB PE=3 SV=1 55 351 8.0E-57
sp|Q89A71|RL2_BUCBP 50S ribosomal protein L2 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rplB PE=3 SV=1 59 360 9.0E-57
sp|B3E7T8|RL2_GEOLS 50S ribosomal protein L2 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=rplB PE=3 SV=1 55 362 1.0E-56
sp|Q8ETX9|RL2_OCEIH 50S ribosomal protein L2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rplB PE=3 SV=1 55 362 1.0E-56
sp|A6TWH9|RL2_ALKMQ 50S ribosomal protein L2 OS=Alkaliphilus metalliredigens (strain QYMF) GN=rplB PE=3 SV=1 55 362 1.0E-56
sp|B6IRQ9|RL2_RHOCS 50S ribosomal protein L2 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rplB PE=3 SV=1 55 357 1.0E-56
sp|B1KSM2|RL2_CLOBM 50S ribosomal protein L2 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=rplB PE=3 SV=1 55 360 1.0E-56
sp|A7GJ71|RL2_CLOBL 50S ribosomal protein L2 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=rplB PE=3 SV=1 55 360 1.0E-56
sp|C1FMU8|RL2_CLOBJ 50S ribosomal protein L2 OS=Clostridium botulinum (strain Kyoto / Type A2) GN=rplB PE=3 SV=1 55 360 1.0E-56
sp|A5I7K3|RL2_CLOBH 50S ribosomal protein L2 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=rplB PE=3 SV=1 55 360 1.0E-56
sp|A7FZ66|RL2_CLOB1 50S ribosomal protein L2 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=rplB PE=3 SV=1 55 360 1.0E-56
sp|B9M6U2|RL2_GEODF 50S ribosomal protein L2 OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=rplB PE=3 SV=1 55 362 1.0E-56
sp|Q0BUP7|RL2_GRABC 50S ribosomal protein L2 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rplB PE=3 SV=2 55 366 1.0E-56
sp|Q73PM9|RL2_TREDE 50S ribosomal protein L2 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=rplB PE=3 SV=1 55 360 2.0E-56
sp|A1ALU4|RL2_PELPD 50S ribosomal protein L2 OS=Pelobacter propionicus (strain DSM 2379) GN=rplB PE=3 SV=1 55 362 2.0E-56
sp|Q2GL56|RL2_ANAPZ 50S ribosomal protein L2 OS=Anaplasma phagocytophilum (strain HZ) GN=rplB PE=3 SV=1 55 356 2.0E-56
sp|A7HWR4|RL2_PARL1 50S ribosomal protein L2 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rplB PE=3 SV=1 55 360 2.0E-56
sp|B0UHW6|RL2_METS4 50S ribosomal protein L2 OS=Methylobacterium sp. (strain 4-46) GN=rplB PE=3 SV=1 55 360 2.0E-56
sp|Q6AP68|RL2_DESPS 50S ribosomal protein L2 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=rplB PE=3 SV=1 55 360 2.0E-56
sp|B6JET6|RL2_OLICO 50S ribosomal protein L2 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=rplB PE=3 SV=1 55 360 2.0E-56
sp|A7NR60|RL2_ROSCS 50S ribosomal protein L2 OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=rplB PE=3 SV=1 55 352 3.0E-56
sp|Q8D209|RL2_WIGBR 50S ribosomal protein L2 OS=Wigglesworthia glossinidia brevipalpis GN=rplB PE=3 SV=1 60 360 3.0E-56
sp|B2TIH8|RL2_CLOBB 50S ribosomal protein L2 OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=rplB PE=3 SV=1 55 360 3.0E-56
sp|B2UYB3|RL2_CLOBA 50S ribosomal protein L2 OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=rplB PE=3 SV=1 55 360 3.0E-56
sp|A8MLE3|RL2_ALKOO 50S ribosomal protein L2 OS=Alkaliphilus oremlandii (strain OhILAs) GN=rplB PE=3 SV=1 55 347 3.0E-56
sp|A1W2R0|RL2_ACISJ 50S ribosomal protein L2 OS=Acidovorax sp. (strain JS42) GN=rplB PE=3 SV=1 59 362 4.0E-56
sp|B9MB76|RL2_ACIET 50S ribosomal protein L2 OS=Acidovorax ebreus (strain TPSY) GN=rplB PE=3 SV=1 59 362 4.0E-56
sp|B7J246|RL2_BORBZ 50S ribosomal protein L2 OS=Borrelia burgdorferi (strain ZS7) GN=rplB PE=3 SV=1 55 349 4.0E-56
sp|P94270|RL2_BORBU 50S ribosomal protein L2 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=rplB PE=3 SV=2 55 349 4.0E-56
sp|P60433|RL2_STAAW 50S ribosomal protein L2 OS=Staphylococcus aureus (strain MW2) GN=rplB PE=3 SV=1 55 348 5.0E-56
sp|Q6G774|RL2_STAAS 50S ribosomal protein L2 OS=Staphylococcus aureus (strain MSSA476) GN=rplB PE=3 SV=1 55 348 5.0E-56
sp|Q6GEI6|RL2_STAAR 50S ribosomal protein L2 OS=Staphylococcus aureus (strain MRSA252) GN=rplB PE=3 SV=1 55 348 5.0E-56
sp|P60432|RL2_STAAN 50S ribosomal protein L2 OS=Staphylococcus aureus (strain N315) GN=rplB PE=1 SV=1 55 348 5.0E-56
sp|P60431|RL2_STAAM 50S ribosomal protein L2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rplB PE=3 SV=1 55 348 5.0E-56
sp|A6QJ89|RL2_STAAE 50S ribosomal protein L2 OS=Staphylococcus aureus (strain Newman) GN=rplB PE=3 SV=1 55 348 5.0E-56
sp|Q5HDW1|RL2_STAAC 50S ribosomal protein L2 OS=Staphylococcus aureus (strain COL) GN=rplB PE=3 SV=1 55 348 5.0E-56
sp|Q2YYP9|RL2_STAAB 50S ribosomal protein L2 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rplB PE=3 SV=1 55 348 5.0E-56
sp|A5IV31|RL2_STAA9 50S ribosomal protein L2 OS=Staphylococcus aureus (strain JH9) GN=rplB PE=3 SV=1 55 348 5.0E-56
sp|P60430|RL2_STAA8 50S ribosomal protein L2 OS=Staphylococcus aureus (strain NCTC 8325) GN=rplB PE=1 SV=1 55 348 5.0E-56
sp|Q2FEP2|RL2_STAA3 50S ribosomal protein L2 OS=Staphylococcus aureus (strain USA300) GN=rplB PE=3 SV=1 55 348 5.0E-56
sp|A6U3X2|RL2_STAA2 50S ribosomal protein L2 OS=Staphylococcus aureus (strain JH1) GN=rplB PE=3 SV=1 55 348 5.0E-56
sp|A7X5G0|RL2_STAA1 50S ribosomal protein L2 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=rplB PE=3 SV=1 55 348 5.0E-56
sp|B9KL94|RL2_RHOSK 50S ribosomal protein L2 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=rplB PE=3 SV=1 55 370 5.0E-56
sp|Q3J5R9|RL2_RHOS4 50S ribosomal protein L2 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rplB PE=3 SV=1 55 370 5.0E-56
sp|A3PGL4|RL2_RHOS1 50S ribosomal protein L2 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rplB PE=3 SV=1 55 370 5.0E-56
sp|Q5P329|RL2_AROAE 50S ribosomal protein L2 OS=Aromatoleum aromaticum (strain EbN1) GN=rplB PE=3 SV=1 59 360 5.0E-56
sp|Q07KM1|RL2_RHOP5 50S ribosomal protein L2 OS=Rhodopseudomonas palustris (strain BisA53) GN=rplB PE=3 SV=1 55 360 5.0E-56
sp|A7H108|RL2_CAMC5 50S ribosomal protein L2 OS=Campylobacter curvus (strain 525.92) GN=rplB PE=3 SV=1 55 360 5.0E-56
sp|Q1LTD5|RL2_BAUCH 50S ribosomal protein L2 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rplB PE=3 SV=1 59 336 6.0E-56
sp|A7ZG09|RL2_CAMC1 50S ribosomal protein L2 OS=Campylobacter concisus (strain 13826) GN=rplB PE=3 SV=1 55 360 6.0E-56
sp|Q661D9|RL2_BORBP 50S ribosomal protein L2 OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=rplB PE=3 SV=1 55 349 6.0E-56
sp|A5FZW2|RL2_ACICJ 50S ribosomal protein L2 OS=Acidiphilium cryptum (strain JF-5) GN=rplB PE=3 SV=1 55 347 8.0E-56
sp|A8IAR8|RL2_AZOC5 50S ribosomal protein L2 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rplB PE=3 SV=1 55 360 1.0E-55
sp|A4WVK5|RL2_RHOS5 50S ribosomal protein L2 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=rplB PE=3 SV=1 55 370 1.0E-55
sp|A5GAW8|RL2_GEOUR 50S ribosomal protein L2 OS=Geobacter uraniireducens (strain Rf4) GN=rplB PE=3 SV=1 55 362 1.0E-55
sp|B1ZLK7|RL2_METPB 50S ribosomal protein L2 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rplB PE=3 SV=1 55 360 1.0E-55
sp|A5USI6|RL2_ROSS1 50S ribosomal protein L2 OS=Roseiflexus sp. (strain RS-1) GN=rplB PE=3 SV=1 55 352 1.0E-55
sp|Q89J87|RL2_BRADU 50S ribosomal protein L2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rplB PE=3 SV=1 55 360 1.0E-55
sp|Q0SN26|RL2_BORAP 50S ribosomal protein L2 OS=Borrelia afzelii (strain PKo) GN=rplB PE=3 SV=1 55 349 1.0E-55
sp|Q1MPR0|RL2_LAWIP 50S ribosomal protein L2 OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=rplB PE=3 SV=1 55 360 2.0E-55
sp|Q3SSW3|RL2_NITWN 50S ribosomal protein L2 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rplB PE=3 SV=1 55 360 2.0E-55
sp|Q83ES1|RL2_COXBU 50S ribosomal protein L2 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rplB PE=3 SV=1 59 360 2.0E-55
sp|A9NAM7|RL2_COXBR 50S ribosomal protein L2 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=rplB PE=3 SV=1 59 360 2.0E-55
sp|A9KD28|RL2_COXBN 50S ribosomal protein L2 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=rplB PE=3 SV=1 59 360 2.0E-55
sp|B6J260|RL2_COXB2 50S ribosomal protein L2 OS=Coxiella burnetii (strain CbuG_Q212) GN=rplB PE=3 SV=1 59 360 2.0E-55
sp|Q4L8B1|RL2_STAHJ 50S ribosomal protein L2 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rplB PE=3 SV=1 55 348 2.0E-55
sp|A6LPR4|RL2_CLOB8 50S ribosomal protein L2 OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=rplB PE=3 SV=1 55 360 2.0E-55
sp|Q0ANQ3|RL2_MARMM 50S ribosomal protein L2 OS=Maricaulis maris (strain MCS10) GN=rplB PE=3 SV=1 55 368 2.0E-55
sp|Q2RQW3|RL2_RHORT 50S ribosomal protein L2 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rplB PE=3 SV=1 55 347 2.0E-55
sp|Q1WS93|RL2_LACS1 50S ribosomal protein L2 OS=Lactobacillus salivarius (strain UCC118) GN=rplB PE=3 SV=1 55 360 2.0E-55
sp|A1VEB3|RL2_DESVV 50S ribosomal protein L2 OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=rplB PE=3 SV=1 55 360 3.0E-55
sp|Q72CH7|RL2_DESVH 50S ribosomal protein L2 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=rplB PE=3 SV=1 55 360 3.0E-55
sp|Q16AE8|RL2_ROSDO 50S ribosomal protein L2 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rplB PE=3 SV=1 55 370 3.0E-55
sp|B8FET2|RL2_DESAA 50S ribosomal protein L2 OS=Desulfatibacillum alkenivorans (strain AK-01) GN=rplB PE=3 SV=1 55 360 3.0E-55
sp|B8G6S2|RL2_CHLAD 50S ribosomal protein L2 OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=rplB PE=3 SV=1 55 352 3.0E-55
sp|B9LJD5|RL2_CHLSY 50S ribosomal protein L2 OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=rplB PE=3 SV=1 55 357 4.0E-55
sp|A9WH69|RL2_CHLAA 50S ribosomal protein L2 OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=rplB PE=3 SV=1 55 357 4.0E-55
sp|Q1QN27|RL2_NITHX 50S ribosomal protein L2 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rplB PE=3 SV=1 55 360 5.0E-55
sp|A9BHA2|RL2_PETMO 50S ribosomal protein L2 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=rplB PE=3 SV=1 55 357 5.0E-55
sp|Q9XD33|RL2_LEPIN 50S ribosomal protein L2 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=rplB PE=3 SV=2 55 370 5.0E-55
sp|Q72NG4|RL2_LEPIC 50S ribosomal protein L2 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=rplB PE=3 SV=1 55 370 5.0E-55
sp|B9DM16|RL2_STACT 50S ribosomal protein L2 OS=Staphylococcus carnosus (strain TM300) GN=rplB PE=3 SV=1 55 362 6.0E-55
sp|A9B415|RL2_HERA2 50S ribosomal protein L2 OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=rplB PE=3 SV=1 55 360 7.0E-55
sp|Q5FM87|RL2_LACAC 50S ribosomal protein L2 OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=rplB PE=3 SV=1 55 347 7.0E-55
sp|Q2IXQ7|RL2_RHOP2 50S ribosomal protein L2 OS=Rhodopseudomonas palustris (strain HaA2) GN=rplB PE=3 SV=1 55 360 7.0E-55
sp|Q2GED6|RL2_NEOSM 50S ribosomal protein L2 OS=Neorickettsia sennetsu (strain Miyayama) GN=rplB PE=3 SV=1 75 347 7.0E-55
sp|A0RM14|RL2_CAMFF 50S ribosomal protein L2 OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=rplB PE=3 SV=1 55 360 8.0E-55
sp|C1F639|RL2_ACIC5 50S ribosomal protein L2 OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=rplB PE=3 SV=1 55 360 8.0E-55
sp|Q211F1|RL2_RHOPB 50S ribosomal protein L2 OS=Rhodopseudomonas palustris (strain BisB18) GN=rplB PE=3 SV=1 55 360 9.0E-55
sp|Q28UV7|RL2_JANSC 50S ribosomal protein L2 OS=Jannaschia sp. (strain CCS1) GN=rplB PE=3 SV=1 55 370 1.0E-54
sp|A4VSF7|RL2_STRSY 50S ribosomal protein L2 OS=Streptococcus suis (strain 05ZYH33) GN=rplB PE=3 SV=1 55 349 1.0E-54
sp|A4VYP6|RL2_STRS2 50S ribosomal protein L2 OS=Streptococcus suis (strain 98HAH33) GN=rplB PE=3 SV=1 55 349 1.0E-54
sp|Q5LW59|RL2_RUEPO 50S ribosomal protein L2 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rplB PE=3 SV=1 55 370 2.0E-54
sp|B1IGF1|RL2_CLOBK 50S ribosomal protein L2 OS=Clostridium botulinum (strain Okra / Type B1) GN=rplB PE=3 SV=1 55 360 2.0E-54
sp|B6J5D5|RL2_COXB1 50S ribosomal protein L2 OS=Coxiella burnetii (strain CbuK_Q154) GN=rplB PE=3 SV=1 59 360 2.0E-54
sp|Q49ZG5|RL2_STAS1 50S ribosomal protein L2 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rplB PE=3 SV=1 55 348 2.0E-54
sp|Q055E1|RL2_LEPBL 50S ribosomal protein L2 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=rplB1 PE=3 SV=1 55 370 2.0E-54
sp|Q04PU1|RL2_LEPBJ 50S ribosomal protein L2 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=rplB PE=3 SV=1 55 370 2.0E-54
sp|Q8PC46|RL2_XANCP 50S ribosomal protein L2 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rplB PE=3 SV=1 55 360 2.0E-54
sp|B0RU79|RL2_XANCB 50S ribosomal protein L2 OS=Xanthomonas campestris pv. campestris (strain B100) GN=rplB PE=3 SV=1 55 360 2.0E-54
sp|Q4URE2|RL2_XANC8 50S ribosomal protein L2 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rplB PE=3 SV=1 55 360 2.0E-54
sp|C4KZP3|RL2_EXISA 50S ribosomal protein L2 OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=rplB PE=3 SV=1 55 350 2.0E-54
sp|Q97EI1|RL2_CLOAB 50S ribosomal protein L2 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=rplB PE=3 SV=1 55 348 2.0E-54
sp|A9NED6|RL2_ACHLI 50S ribosomal protein L2 OS=Acholeplasma laidlawii (strain PG-8A) GN=rplB PE=3 SV=1 55 360 3.0E-54
sp|B4UBA2|RL2_ANASK 50S ribosomal protein L2 OS=Anaeromyxobacter sp. (strain K) GN=rplB PE=3 SV=1 55 360 3.0E-54
sp|B8J863|RL2_ANAD2 50S ribosomal protein L2 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=rplB PE=3 SV=1 55 360 3.0E-54
sp|C4XLX6|RL2_DESMR 50S ribosomal protein L2 OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=rplB PE=3 SV=1 55 360 3.0E-54
sp|Q2IJ88|RL2_ANADE 50S ribosomal protein L2 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=rplB PE=3 SV=1 55 360 3.0E-54
sp|B1I1J1|RL2_DESAP 50S ribosomal protein L2 OS=Desulforudis audaxviator (strain MP104C) GN=rplB PE=3 SV=1 56 360 4.0E-54
sp|C1CP91|RL2_STRZT 50S ribosomal protein L2 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rplB PE=3 SV=1 55 349 4.0E-54
sp|C1CIA0|RL2_STRZP 50S ribosomal protein L2 OS=Streptococcus pneumoniae (strain P1031) GN=rplB PE=3 SV=1 55 349 4.0E-54
sp|C1CC09|RL2_STRZJ 50S ribosomal protein L2 OS=Streptococcus pneumoniae (strain JJA) GN=rplB PE=3 SV=1 55 349 4.0E-54
sp|Q8CWV5|RL2_STRR6 50S ribosomal protein L2 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rplB PE=3 SV=1 55 349 4.0E-54
sp|B2IS43|RL2_STRPS 50S ribosomal protein L2 OS=Streptococcus pneumoniae (strain CGSP14) GN=rplB PE=3 SV=1 55 349 4.0E-54
sp|Q97SV2|RL2_STRPN 50S ribosomal protein L2 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rplB PE=3 SV=1 55 349 4.0E-54
sp|B8ZKG0|RL2_STRPJ 50S ribosomal protein L2 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rplB PE=3 SV=1 55 349 4.0E-54
sp|B1I8K1|RL2_STRPI 50S ribosomal protein L2 OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rplB PE=3 SV=1 55 349 4.0E-54
sp|C1CAL5|RL2_STRP7 50S ribosomal protein L2 OS=Streptococcus pneumoniae (strain 70585) GN=rplB PE=3 SV=1 55 349 4.0E-54
sp|B5E6F8|RL2_STRP4 50S ribosomal protein L2 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rplB PE=3 SV=1 55 349 4.0E-54
sp|Q04MN3|RL2_STRP2 50S ribosomal protein L2 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rplB PE=3 SV=1 55 349 4.0E-54
sp|B8I7Y2|RL2_CLOCE 50S ribosomal protein L2 OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=rplB PE=3 SV=1 55 340 4.0E-54
sp|B5EFQ3|RL2_GEOBB 50S ribosomal protein L2 OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=rplB PE=3 SV=1 55 362 5.0E-54
sp|A8AZM2|RL2_STRGC 50S ribosomal protein L2 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rplB PE=3 SV=1 55 349 5.0E-54
sp|A7IFY4|RL2_XANP2 50S ribosomal protein L2 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=rplB PE=3 SV=1 55 360 5.0E-54
sp|B2A4E2|RL2_NATTJ 50S ribosomal protein L2 OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=rplB PE=3 SV=2 55 360 5.0E-54
sp|P60405|RL2_THET8 50S ribosomal protein L2 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rplB PE=1 SV=3 55 360 6.0E-54
sp|Q72I07|RL2_THET2 50S ribosomal protein L2 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rplB PE=1 SV=1 55 360 6.0E-54
sp|A3CK66|RL2_STRSV 50S ribosomal protein L2 OS=Streptococcus sanguinis (strain SK36) GN=rplB PE=3 SV=1 55 349 7.0E-54
sp|C6E4Q4|RL2_GEOSM 50S ribosomal protein L2 OS=Geobacter sp. (strain M21) GN=rplB PE=3 SV=1 55 362 8.0E-54
sp|B1LWS9|RL2_METRJ 50S ribosomal protein L2 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rplB PE=3 SV=1 55 360 9.0E-54
sp|Q8CRG3|RL2_STAES 50S ribosomal protein L2 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rplB PE=3 SV=1 55 348 1.0E-53
sp|Q5HM02|RL2_STAEQ 50S ribosomal protein L2 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rplB PE=3 SV=1 55 348 1.0E-53
sp|B1VAE5|RL2_PHYAS 50S ribosomal protein L2 OS=Phytoplasma australiense GN=rplB PE=3 SV=1 55 357 1.0E-53
sp|Q74L86|RL2_LACJO 50S ribosomal protein L2 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rplB PE=3 SV=1 58 347 1.0E-53
sp|B5Y985|RL2_COPPD 50S ribosomal protein L2 OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=rplB PE=3 SV=1 55 360 1.0E-53
sp|Q1D772|RL2_MYXXD 50S ribosomal protein L2 OS=Myxococcus xanthus (strain DK 1622) GN=rplB PE=3 SV=1 55 360 2.0E-53
sp|Q30TW1|RL2_SULDN 50S ribosomal protein L2 OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=rplB PE=3 SV=1 55 363 2.0E-53
sp|B3WAL4|RL2_LACCB 50S ribosomal protein L2 OS=Lactobacillus casei (strain BL23) GN=rplB PE=3 SV=1 58 360 2.0E-53
sp|Q034Y6|RL2_LACC3 50S ribosomal protein L2 OS=Lactobacillus casei (strain ATCC 334) GN=rplB PE=3 SV=1 58 360 2.0E-53
sp|A8YXK8|RL2_LACH4 50S ribosomal protein L2 OS=Lactobacillus helveticus (strain DPC 4571) GN=rplB PE=3 SV=1 55 347 2.0E-53
sp|A9H3Q5|RL2_GLUDA 50S ribosomal protein L2 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=rplB PE=3 SV=1 55 347 2.0E-53
sp|A4YSJ5|RL2_BRASO 50S ribosomal protein L2 OS=Bradyrhizobium sp. (strain ORS278) GN=rplB PE=3 SV=1 55 360 2.0E-53
sp|C6C188|RL2_DESAD 50S ribosomal protein L2 OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=rplB PE=3 SV=1 56 360 2.0E-53
sp|Q0BYB7|RL2_HYPNA 50S ribosomal protein L2 OS=Hyphomonas neptunium (strain ATCC 15444) GN=rplB PE=3 SV=1 55 357 3.0E-53
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0008152 metabolic process No
GO:1990904 ribonucleoprotein complex No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0043604 amide biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0044267 cellular protein metabolic process No
GO:0006518 peptide metabolic process No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0043226 organelle No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0019538 protein metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0032991 protein-containing complex No
GO:0044424 intracellular part No
GO:0005198 structural molecule activity No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0009058 biosynthetic process No
GO:0043229 intracellular organelle No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0043228 non-membrane-bounded organelle No
GO:0043043 peptide biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11232
MLLPPRLALCVARRSIPLLAAKPALRGYASRTPVLGSGNVGASDDVDPRLKAVRMRTYKPRTPGLRHLKRPINDH
LWKGRPYLPLTFPKKGHGKGGRNVHGRVTVRHRGGGAKRRIRTVDFERRRPGPHLVERIEYDPGRSAHIALVTEK
ATGRKTYIIAAEGIRAGDVVHSYRAGIPQDLLDSMGGVVDPGILAARTAFPGNCLPMHMIPVGTEVFCVGSSARR
GAVFCRSAGTSAMVVNKNEQMKADGTKEMMGKYVEVRLQSGEVRRVSKDACATIGVASNQYHQYRQLGKAGRSRW
LNIRPTVRGVAMNKVDHPHGGGRGKSKGNRNPVSPWGKPTKSGYKTRRKHNPHRYVVTPRPRNHGKRRNRTASKT
*
Coding >Hirsu2|11232
ATGCTCCTTCCTCCGAGGCTGGCGCTTTGCGTCGCCCGTAGGAGTATCCCGCTCCTGGCTGCCAAACCCGCCCTC
CGCGGCTACGCCTCCCGCACGCCCGTCTTGGGATCCGGCAATGTCGGTGCCTCTGACGATGTGGACCCGCGGTTG
AAGGCCGTTCGAATGAGAACCTACAAGCCGCGGACTCCTGGCTTGCGGCATCTGAAGCGGCCCATCAACGACCAC
CTCTGGAAGGGACGACCATATCTTCCCCTGACATTTCCCAAGAAGGGCCACGGCAAGGGCGGGCGGAACGTACAC
GGGCGCGTCACGGTGAGACACCGCGGAGGTGGCGCGAAGCGGAGGATACGCACCGTTGATTTCGAGCGACGGAGG
CCGGGTCCCCATCTGGTCGAGCGCATCGAATACGACCCGGGACGCAGCGCCCACATCGCCCTCGTGACGGAAAAG
GCCACGGGCCGCAAGACGTACATTATCGCTGCTGAGGGCATCAGGGCAGGCGACGTGGTGCACAGCTATCGAGCA
GGCATCCCGCAGGATCTCCTCGACAGCATGGGCGGCGTCGTCGACCCCGGTATCCTGGCGGCCAGGACGGCCTTC
CCAGGCAACTGCCTGCCGATGCACATGATCCCCGTCGGGACCGAGGTGTTCTGCGTCGGCTCCTCGGCCAGGCGC
GGAGCCGTCTTCTGCCGAAGCGCCGGCACCTCGGCCATGGTGGTGAACAAGAACGAGCAGATGAAGGCGGACGGA
ACCAAGGAGATGATGGGCAAGTACGTCGAAGTGCGGCTGCAGAGCGGCGAGGTTCGACGGGTCAGCAAGGACGCG
TGTGCGACAATTGGCGTTGCGAGCAACCAATACCATCAATATCGCCAGCTCGGCAAGGCCGGCCGGAGCCGTTGG
CTCAACATCCGGCCGACGGTCCGCGGTGTGGCCATGAACAAAGTCGATCATCCTCATGGCGGTGGCCGAGGAAAA
TCCAAGGGCAACCGCAACCCCGTCTCCCCATGGGGGAAACCTACCAAGAGCGGCTACAAGACACGGCGGAAACAC
AACCCGCACAGGTATGTCGTGACGCCGCGGCCTCGCAACCACGGCAAGCGGAGAAATCGGACTGCCAGTAAGACG
TGA
Transcript >Hirsu2|11232
ATGCTCCTTCCTCCGAGGCTGGCGCTTTGCGTCGCCCGTAGGAGTATCCCGCTCCTGGCTGCCAAACCCGCCCTC
CGCGGCTACGCCTCCCGCACGCCCGTCTTGGGATCCGGCAATGTCGGTGCCTCTGACGATGTGGACCCGCGGTTG
AAGGCCGTTCGAATGAGAACCTACAAGCCGCGGACTCCTGGCTTGCGGCATCTGAAGCGGCCCATCAACGACCAC
CTCTGGAAGGGACGACCATATCTTCCCCTGACATTTCCCAAGAAGGGCCACGGCAAGGGCGGGCGGAACGTACAC
GGGCGCGTCACGGTGAGACACCGCGGAGGTGGCGCGAAGCGGAGGATACGCACCGTTGATTTCGAGCGACGGAGG
CCGGGTCCCCATCTGGTCGAGCGCATCGAATACGACCCGGGACGCAGCGCCCACATCGCCCTCGTGACGGAAAAG
GCCACGGGCCGCAAGACGTACATTATCGCTGCTGAGGGCATCAGGGCAGGCGACGTGGTGCACAGCTATCGAGCA
GGCATCCCGCAGGATCTCCTCGACAGCATGGGCGGCGTCGTCGACCCCGGTATCCTGGCGGCCAGGACGGCCTTC
CCAGGCAACTGCCTGCCGATGCACATGATCCCCGTCGGGACCGAGGTGTTCTGCGTCGGCTCCTCGGCCAGGCGC
GGAGCCGTCTTCTGCCGAAGCGCCGGCACCTCGGCCATGGTGGTGAACAAGAACGAGCAGATGAAGGCGGACGGA
ACCAAGGAGATGATGGGCAAGTACGTCGAAGTGCGGCTGCAGAGCGGCGAGGTTCGACGGGTCAGCAAGGACGCG
TGTGCGACAATTGGCGTTGCGAGCAACCAATACCATCAATATCGCCAGCTCGGCAAGGCCGGCCGGAGCCGTTGG
CTCAACATCCGGCCGACGGTCCGCGGTGTGGCCATGAACAAAGTCGATCATCCTCATGGCGGTGGCCGAGGAAAA
TCCAAGGGCAACCGCAACCCCGTCTCCCCATGGGGGAAACCTACCAAGAGCGGCTACAAGACACGGCGGAAACAC
AACCCGCACAGGTATGTCGTGACGCCGCGGCCTCGCAACCACGGCAAGCGGAGAAATCGGACTGCCAGTAAGACG
TGA
Gene >Hirsu2|11232
ATGCTCCTTCCTCCGAGGCTGGCGCTTTGCGTCGCCCGTAGGAGTATCCCGCTCCTGGCTGCCAAACCCGCCCTC
CGCGGCTACGCCTCCCGCACGCCCGTCTTGGGATCCGGCAATGTCGGTGCCTCTGACGATGTGGACCCGCGGTTG
AAGGCCGTTCGAATGAGAACCTACAAGCCGCGGACTCCTGGCTTGCGGCATCTGAAGCGGCCCATCAACGACCAC
CTCTGGAAGGGACGACCATATCTTCCCCTGACATTTCCCAAGAAGGGCCACGGCAAGGGCGGGCGGAACGTACAC
GGGCGCGTCACGGTGAGACACCGCGGAGGTGGCGCGAAGCGGAGGATACGCACCGTTGATTTCGAGCGACGGAGG
CCGGGTCCCCATCTGGTCGAGCGCATCGAATACGACCCGGGACGCAGCGCCCACATCGCCCTCGTGACGGAAAAG
GCCACGGGCCGCAAGACGTACATTATCGCTGCTGAGGGCATCAGGGCAGGCGACGTGGTGCACAGCTATCGAGCA
GGCATCCCGCAGGATCTCCTCGACAGCATGGGCGGCGTCGTCGACCCCGGTATCCTGGCGGCCAGGACGGCCTTC
CCAGGCAACTGCCTGCCGATGCACATGATCCCCGTCGGGACCGAGGTGTTCTGCGTCGGCTCCTCGGCCAGGCGC
GGAGCCGTCTTCTGCCGAAGCGCCGGCACCTCGGCCATGGTGGTGAACAAGAACGAGCAGATGAAGGCGGACGGA
ACCAAGGAGATGATGGGCAAGTACGTCGAAGTGCGGCTGCAGAGCGGCGAGGTTCGACGGGTCAGCAAGGACGCG
TGTGCGACAATTGGCGTTGCGAGCAACCAATACCATCAATATCGCCAGCTCGGCAAGGCCGGCCGGAGCCGTTGG
CTCAACATCCGGCCGACGGTCCGCGGTGTGGCCATGAACAAAGGTAAGATGGACGCCTTGCCCGACGGAGGCTGC
AGCCACTAACAATGCTTTCTCCTACCTCCCCCGCAGTCGATCATCCTCATGGCGGTGGCCGAGGAAAATCCAAGG
GCAACCGCAACCCCGTCTCCCCATGGGGGAAACCTGTGAGTTCCCGGTGGCGCACCCGGCCACGGCGTTTGCGCC
CGGCTGTTTTTGCTGACGGCCTGAACAGACCAAGAGCGGCTACAAGACACGGCGGAAACACAACCCGCACAGGTA
TGTCGTGACGCCGCGGCCTCGCAACCACGGCAAGCGGAGAAATCGGACTGCCAGTAAGACGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail