Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11228
Gene name
LocationContig_99:15303..16328
Strand-
Gene length (bp)1025
Transcript length (bp)660
Coding sequence length (bp)660
Protein length (aa) 220

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03637 Mob1_phocein Mob1/phocein family 6.4E-71 38 203

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P601|MOB1_NEUCR Probable maintenance of ploidy protein mob1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mob1-1 PE=3 SV=2 1 219 6.0E-153
sp|O94360|MOB1_SCHPO Maintenance of ploidy protein mob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mob1 PE=1 SV=1 10 216 6.0E-82
sp|Q54XJ0|MOB1A_DICDI MOB kinase activator-like 1 homolog A OS=Dictyostelium discoideum GN=mobA PE=3 SV=1 12 218 4.0E-75
sp|Q54CR8|MOB1B_DICDI MOB kinase activator-like 1 homolog B OS=Dictyostelium discoideum GN=mobB PE=3 SV=1 8 218 2.0E-73
sp|Q3T1J9|MOB1A_RAT MOB kinase activator 1A OS=Rattus norvegicus GN=Mob1a PE=2 SV=3 5 219 2.0E-73
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P601|MOB1_NEUCR Probable maintenance of ploidy protein mob1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mob1-1 PE=3 SV=2 1 219 6.0E-153
sp|O94360|MOB1_SCHPO Maintenance of ploidy protein mob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mob1 PE=1 SV=1 10 216 6.0E-82
sp|Q54XJ0|MOB1A_DICDI MOB kinase activator-like 1 homolog A OS=Dictyostelium discoideum GN=mobA PE=3 SV=1 12 218 4.0E-75
sp|Q54CR8|MOB1B_DICDI MOB kinase activator-like 1 homolog B OS=Dictyostelium discoideum GN=mobB PE=3 SV=1 8 218 2.0E-73
sp|Q3T1J9|MOB1A_RAT MOB kinase activator 1A OS=Rattus norvegicus GN=Mob1a PE=2 SV=3 5 219 2.0E-73
sp|Q5RAE0|MOB1A_PONAB MOB kinase activator 1A OS=Pongo abelii GN=MOB1A PE=2 SV=3 5 219 2.0E-73
sp|Q921Y0|MOB1A_MOUSE MOB kinase activator 1A OS=Mus musculus GN=Mob1a PE=2 SV=3 5 219 2.0E-73
sp|Q9H8S9|MOB1A_HUMAN MOB kinase activator 1A OS=Homo sapiens GN=MOB1A PE=1 SV=4 5 219 2.0E-73
sp|Q8BPB0|MOB1B_MOUSE MOB kinase activator 1B OS=Mus musculus GN=Mob1b PE=1 SV=3 12 219 1.0E-72
sp|Q7L9L4|MOB1B_HUMAN MOB kinase activator 1B OS=Homo sapiens GN=MOB1B PE=1 SV=3 12 219 1.0E-72
sp|Q9FHI1|MOB1A_ARATH MOB kinase activator-like 1A OS=Arabidopsis thaliana GN=MOB1A PE=2 SV=1 12 216 2.0E-71
sp|Q95RA8|MOB1_DROME MOB kinase activator-like 1 OS=Drosophila melanogaster GN=mats PE=1 SV=1 12 219 1.0E-70
sp|Q949G5|MOB1A_MEDSF MOB kinase activator-like 1A OS=Medicago sativa subsp. falcata GN=MOB1-A PE=2 SV=2 1 217 1.0E-68
sp|Q2WBN3|MOB1B_MEDSF MOB kinase activator-like 1B OS=Medicago sativa subsp. falcata GN=MOB1-B PE=2 SV=1 1 217 1.0E-68
sp|Q8GYX0|MOB1B_ARATH MOB kinase activator-like 1B OS=Arabidopsis thaliana GN=MOB1B PE=2 SV=1 12 216 2.0E-68
sp|P40484|MOB1_YEAST DBF2 kinase activator protein MOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MOB1 PE=1 SV=2 17 212 4.0E-64
sp|Q54BM4|MOB1C_DICDI MOB kinase activator-like 1 homolog C OS=Dictyostelium discoideum GN=mobC PE=3 SV=1 17 215 1.0E-61
sp|Q8VE04|MOB3B_MOUSE MOB kinase activator 3B OS=Mus musculus GN=Mob3b PE=2 SV=1 17 215 8.0E-61
sp|Q9VL13|MOB3_DROME MOB kinase activator-like 3 OS=Drosophila melanogaster GN=Mob3 PE=2 SV=1 17 217 1.0E-60
sp|Q29RK9|MOB3B_BOVIN MOB kinase activator 3B OS=Bos taurus GN=MOB3B PE=2 SV=1 17 215 2.0E-60
sp|Q86TA1|MOB3B_HUMAN MOB kinase activator 3B OS=Homo sapiens GN=MOB3B PE=1 SV=2 17 215 2.0E-60
sp|Q96BX8|MOB3A_HUMAN MOB kinase activator 3A OS=Homo sapiens GN=MOB3A PE=1 SV=1 4 215 3.0E-60
sp|Q8BSU7|MOB3A_MOUSE MOB kinase activator 3A OS=Mus musculus GN=Mob3a PE=1 SV=1 4 215 9.0E-60
sp|Q5R5Z0|MOB3A_PONAB MOB kinase activator 3A OS=Pongo abelii GN=MOB3A PE=2 SV=1 4 215 1.0E-59
sp|Q58D63|MOB3A_BOVIN MOB kinase activator 3A OS=Bos taurus GN=MOB3A PE=2 SV=2 4 215 3.0E-59
sp|Q5EAA4|MOB3C_BOVIN MOB kinase activator 3C OS=Bos taurus GN=MOB3C PE=2 SV=1 17 215 1.0E-58
sp|Q8BJG4|MOB3C_MOUSE MOB kinase activator 3C OS=Mus musculus GN=Mob3c PE=2 SV=1 17 215 4.0E-58
sp|Q70IA8|MOB3C_HUMAN MOB kinase activator 3C OS=Homo sapiens GN=MOB3C PE=1 SV=1 17 215 8.0E-58
sp|F4K495|MOB2A_ARATH MOB kinase activator-like 2A OS=Arabidopsis thaliana GN=MOB2A PE=2 SV=1 39 216 6.0E-52
sp|O74558|MOB2_SCHPO Maintenance of ploidy protein mob2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mob2 PE=1 SV=1 27 212 9.0E-44
sp|Q54QV0|MOB2_DICDI MOB kinase activator-like 2 OS=Dictyostelium discoideum GN=mob2 PE=3 SV=1 2 203 6.0E-39
sp|P43563|MOB2_YEAST CBK1 kinase activator protein MOB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MOB2 PE=1 SV=2 2 215 3.0E-38
sp|Q5ABC6|MOB2_CANAL CBK1 kinase activator protein MOB2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MOB2 PE=1 SV=1 29 215 3.0E-35
sp|Q2LZ59|MOB2_DROPS MOB kinase activator-like 2 OS=Drosophila pseudoobscura pseudoobscura GN=Mob1 PE=3 SV=2 14 188 7.0E-32
sp|Q8IQG1|MOB2_DROME MOB kinase activator-like 2 OS=Drosophila melanogaster GN=Mob2 PE=1 SV=3 14 188 8.0E-32
sp|Q70IA6|MOB2_HUMAN MOB kinase activator 2 OS=Homo sapiens GN=MOB2 PE=1 SV=1 9 198 1.0E-31
sp|Q8VI63|MOB2_MOUSE MOB kinase activator 2 OS=Mus musculus GN=Mob2 PE=1 SV=1 44 218 1.0E-30
sp|F4K494|MOB2B_ARATH Putative MOB kinase activator-like 2B OS=Arabidopsis thaliana GN=MOB2B PE=5 SV=1 90 217 2.0E-27
sp|Q7K0E3|MOB4_DROME MOB kinase activator-like 4 OS=Drosophila melanogaster GN=Mob4 PE=2 SV=1 27 209 6.0E-14
sp|Q9QYW3|PHOCN_RAT MOB-like protein phocein OS=Rattus norvegicus GN=Mob4 PE=1 SV=1 27 191 8.0E-14
sp|Q5RDB1|PHOCN_PONAB MOB-like protein phocein OS=Pongo abelii GN=MOB4 PE=2 SV=2 27 191 8.0E-14
sp|Q6PEB6|PHOCN_MOUSE MOB-like protein phocein OS=Mus musculus GN=Mob4 PE=1 SV=1 27 191 8.0E-14
sp|Q9Y3A3|PHOCN_HUMAN MOB-like protein phocein OS=Homo sapiens GN=MOB4 PE=1 SV=1 27 191 8.0E-14
sp|Q5F495|PHOCN_CHICK MOB-like protein phocein OS=Gallus gallus GN=MOB4 PE=2 SV=1 27 191 8.0E-14
sp|P34349|YK83_CAEEL Uncharacterized protein C30A5.3 OS=Caenorhabditis elegans GN=C30A5.3 PE=4 SV=2 15 190 2.0E-12
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Lysosome/Vacuole 0.5522 0.4145 0.1712 0.2799 0.136 0.0183 0.1826 0.5834 0.4982 0.0733

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4884
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3520
Ophiocordyceps australis map64 (Brazil) OphauB2|6536
Ophiocordyceps camponoti-rufipedis Ophun1|4077
Ophiocordyceps kimflemingae Ophio5|4819
Ophiocordyceps subramaniannii Hirsu2|11228 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11228
MAQFLTTVSNQRTKNQFRPRAGKGGTTSFQLRQYAEVTLGGGSLRKVVKLPEGEDENEWLAVNMVDFYNQINLLY
GAITEFCSPQSCPEMKATDEFEYLWQDSENYKRPTKMPAPAYIEQLMAWVQSNIDNESVLPSKIGVPFPKSFPAL
VRQIFKRMYRVYAHIYCHHYPVIRELGLEPHLNTSFKQYVLFIDEHGLASGRDYWGPLGDLVDSMLRSD*
Coding >Hirsu2|11228
ATGGCCCAGTTCTTAACCACGGTCAGCAACCAGCGGACCAAGAACCAGTTCCGCCCCCGCGCCGGCAAGGGCGGC
ACCACCAGCTTCCAGCTGCGCCAGTATGCCGAGGTGACCCTGGGCGGCGGCAGCTTGCGCAAGGTGGTCAAGCTG
CCCGAGGGCGAGGACGAGAACGAGTGGCTGGCCGTCAACATGGTCGACTTTTACAACCAGATCAACCTCCTCTAC
GGAGCCATCACCGAGTTCTGCTCGCCGCAGTCCTGTCCCGAGATGAAGGCGACCGACGAGTTCGAGTACCTCTGG
CAGGATAGCGAAAACTACAAGCGGCCGACCAAGATGCCCGCCCCGGCCTACATCGAGCAGCTGATGGCCTGGGTT
CAGTCCAACATCGACAACGAATCCGTCCTGCCGAGCAAGATTGGCGTCCCTTTTCCCAAGTCGTTCCCGGCCCTG
GTGCGGCAGATCTTCAAGCGCATGTATCGCGTCTACGCCCACATCTACTGCCACCACTACCCCGTCATCCGCGAG
CTCGGCCTCGAGCCCCACCTCAACACCAGCTTCAAGCAGTACGTCCTCTTCATCGACGAGCACGGCCTGGCCAGC
GGGCGCGACTACTGGGGTCCCCTGGGCGATCTCGTCGACAGCATGCTGAGGAGCGACTGA
Transcript >Hirsu2|11228
ATGGCCCAGTTCTTAACCACGGTCAGCAACCAGCGGACCAAGAACCAGTTCCGCCCCCGCGCCGGCAAGGGCGGC
ACCACCAGCTTCCAGCTGCGCCAGTATGCCGAGGTGACCCTGGGCGGCGGCAGCTTGCGCAAGGTGGTCAAGCTG
CCCGAGGGCGAGGACGAGAACGAGTGGCTGGCCGTCAACATGGTCGACTTTTACAACCAGATCAACCTCCTCTAC
GGAGCCATCACCGAGTTCTGCTCGCCGCAGTCCTGTCCCGAGATGAAGGCGACCGACGAGTTCGAGTACCTCTGG
CAGGATAGCGAAAACTACAAGCGGCCGACCAAGATGCCCGCCCCGGCCTACATCGAGCAGCTGATGGCCTGGGTT
CAGTCCAACATCGACAACGAATCCGTCCTGCCGAGCAAGATTGGCGTCCCTTTTCCCAAGTCGTTCCCGGCCCTG
GTGCGGCAGATCTTCAAGCGCATGTATCGCGTCTACGCCCACATCTACTGCCACCACTACCCCGTCATCCGCGAG
CTCGGCCTCGAGCCCCACCTCAACACCAGCTTCAAGCAGTACGTCCTCTTCATCGACGAGCACGGCCTGGCCAGC
GGGCGCGACTACTGGGGTCCCCTGGGCGATCTCGTCGACAGCATGCTGAGGAGCGACTGA
Gene >Hirsu2|11228
ATGGCCCAGTTCTTAACCACGGTGTCAGTTTTTCCTCGATGCCCTGCCCTGCCCCTTGAAAACCGAAACACGATG
GCGACGGCTTCCTTCCGATACCTGAGCCCGAGATCGTTCGCGACCATGTCCCGACTCGACAACACCATCATCCCC
GTTCACGAGGACCCTCCTCCGCCCGAAGCTGACAAGAAGACGCAACTGGCGAGCAGCAGCAACCAGCGGACCAAG
AACCAGTTCCGCCCCCGCGCCGGCAAGGGCGGCACCACCAGCTTCCAGCTGCGCCAGTATGCCGAGGTGACCCTG
GGCGGCGGCAGCTTGCGCAAGGTGGTCAAGCTGCCCGAGGGCGAGGACGAGAACGAGTGGCTGGCCGTCAACAGT
GAGTCGCGTCCGTCCCGTCGCCCAGTCTGCAAGTTTGCTGAAAGCCTGTGGGAAGTGGTCGACTTTTACAACCAG
ATCAACCTCCTCTACGGAGCCATCACCGAGTTCTGCTCGCCGCAGTCCTGTCCCGAGATGAAGGCGACCGACGAG
TGCGGCCCCCTCCCATCCCCCGGCAACCCTGGGCGACCCGCCCGGCTGACGGCTGCGCAGGTTCGAGTACCTCTG
GCAGGATAGCGAAAACTACAAGCGGCCGACCAAGATGCCCGCCCCGGCCTACATCGAGCAGCTGATGGCCTGGGT
TCAGTCCAACATCGACAACGAATCCGTCCTGCCGAGCAAGATTGGTGAGCAACGCCGCCGGCTTGGATGATGCTT
GCGAAGCCGGGCTGACGAGTGACACACACCCAGGCGTCCCTTTTCCCAAGTCGTTCCCGGCCCTGGTGCGGCAGA
TCTTCAAGCGCATGTATCGCGTCTACGCCCACATCTACTGCCACCACTACCCCGTCATCCGCGAGCTCGGCCTCG
AGCCCCACCTCAACACCAGCTTCAAGCAGTACGTCCTCTTCATCGACGAGCACGGCCTGGCCAGCGGGCGCGACT
ACTGGGGTCCCCTGGGCGATCTCGTCGACAGCATGCTGAGGAGCGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail