Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11224
Gene name
LocationContig_99:49..753
Strand-
Gene length (bp)704
Transcript length (bp)354
Coding sequence length (bp)354
Protein length (aa) 118

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00213 OSCP ATP synthase delta (OSCP) subunit 1.8E-08 48 103

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P602|ATPO_NEUCR ATP synthase subunit 5, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=atp-5 PE=3 SV=2 1 100 5.0E-21
sp|Q75EZ3|ATPO_ASHGO ATP synthase subunit 5, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATP5 PE=3 SV=1 22 99 1.0E-14
sp|O74190|ATPO_KLULA ATP synthase subunit 5, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATP5 PE=3 SV=2 24 99 4.0E-14
sp|Q6FSD5|ATPO_CANGA ATP synthase subunit 5, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATP5 PE=3 SV=1 24 105 1.0E-13
sp|O74479|ATPO_SCHPO ATP synthase subunit 5, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atp5 PE=3 SV=2 25 109 6.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P602|ATPO_NEUCR ATP synthase subunit 5, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=atp-5 PE=3 SV=2 1 100 5.0E-21
sp|Q75EZ3|ATPO_ASHGO ATP synthase subunit 5, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATP5 PE=3 SV=1 22 99 1.0E-14
sp|O74190|ATPO_KLULA ATP synthase subunit 5, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATP5 PE=3 SV=2 24 99 4.0E-14
sp|Q6FSD5|ATPO_CANGA ATP synthase subunit 5, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATP5 PE=3 SV=1 24 105 1.0E-13
sp|O74479|ATPO_SCHPO ATP synthase subunit 5, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atp5 PE=3 SV=2 25 109 6.0E-13
sp|P09457|ATPO_YEAST ATP synthase subunit 5, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP5 PE=1 SV=1 40 102 9.0E-11
sp|Q24439|ATPO_DROME ATP synthase subunit O, mitochondrial OS=Drosophila melanogaster GN=ATPsynO PE=2 SV=2 24 102 3.0E-10
sp|Q9DB20|ATPO_MOUSE ATP synthase subunit O, mitochondrial OS=Mus musculus GN=Atp5o PE=1 SV=1 39 107 5.0E-07
sp|Q06647|ATPO_RAT ATP synthase subunit O, mitochondrial OS=Rattus norvegicus GN=Atp5o PE=1 SV=1 39 108 7.0E-07
sp|P13621|ATPO_BOVIN ATP synthase subunit O, mitochondrial OS=Bos taurus GN=ATP5O PE=1 SV=2 39 107 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0015986 ATP synthesis coupled proton transport Yes
GO:0046933 proton-transporting ATP synthase activity, rotational mechanism Yes
GO:0044237 cellular metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0003824 catalytic activity No
GO:0051234 establishment of localization No
GO:0009150 purine ribonucleotide metabolic process No
GO:0044281 small molecule metabolic process No
GO:0009987 cellular process No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:0009145 purine nucleoside triphosphate biosynthetic process No
GO:0009144 purine nucleoside triphosphate metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0009199 ribonucleoside triphosphate metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0055085 transmembrane transport No
GO:0015078 proton transmembrane transporter activity No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0017111 nucleoside-triphosphatase activity No
GO:0006725 cellular aromatic compound metabolic process No
GO:0042625 ATPase coupled ion transmembrane transporter activity No
GO:0034220 ion transmembrane transport No
GO:0046390 ribose phosphate biosynthetic process No
GO:0016462 pyrophosphatase activity No
GO:0098662 inorganic cation transmembrane transport No
GO:0019829 cation-transporting ATPase activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0017144 drug metabolic process No
GO:0044238 primary metabolic process No
GO:0015405 P-P-bond-hydrolysis-driven transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0009205 purine ribonucleoside triphosphate metabolic process No
GO:0042623 ATPase activity, coupled No
GO:0006796 phosphate-containing compound metabolic process No
GO:0009142 nucleoside triphosphate biosynthetic process No
GO:0009201 ribonucleoside triphosphate biosynthetic process No
GO:0006812 cation transport No
GO:0042626 ATPase activity, coupled to transmembrane movement of substances No
GO:1901576 organic substance biosynthetic process No
GO:0015672 monovalent inorganic cation transport No
GO:0009058 biosynthetic process No
GO:0072521 purine-containing compound metabolic process No
GO:0006164 purine nucleotide biosynthetic process No
GO:0015985 energy coupled proton transport, down electrochemical gradient No
GO:0016787 hydrolase activity No
GO:0009260 ribonucleotide biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0009141 nucleoside triphosphate metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0022853 active ion transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0006753 nucleoside phosphate metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0016887 ATPase activity No
GO:0046034 ATP metabolic process No
GO:0009206 purine ribonucleoside triphosphate biosynthetic process No
GO:0043492 ATPase activity, coupled to movement of substances No
GO:0009259 ribonucleotide metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006754 ATP biosynthetic process No
GO:0098660 inorganic ion transmembrane transport No
GO:0044769 ATPase activity, coupled to transmembrane movement of ions, rotational mechanism No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0051179 localization No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0019693 ribose phosphate metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0015075 ion transmembrane transporter activity No
GO:0006163 purine nucleotide metabolic process No
GO:0008152 metabolic process No
GO:0009117 nucleotide metabolic process No
GO:0006810 transport No
GO:0072522 purine-containing compound biosynthetic process No
GO:0090407 organophosphate biosynthetic process No
GO:0006811 ion transport No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1902600 proton transmembrane transport No
GO:0008324 cation transmembrane transporter activity No
GO:0015077 monovalent inorganic cation transmembrane transporter activity No
GO:0022804 active transmembrane transporter activity No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0098655 cation transmembrane transport No
GO:0009152 purine ribonucleotide biosynthetic process No
GO:0009165 nucleotide biosynthetic process No
GO:0015399 primary active transmembrane transporter activity No
GO:0018130 heterocycle biosynthetic process No
GO:0022890 inorganic cation transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11224
MLSRQAFRSVRAAAPGLRAAVVPARTFAAAAPAAGNEGQPPVSVFGLDGTYASALYTAASKSSTLDPTARAMASL
GNVFDKDAKLTHVLSTPTLTAKDKASAASSPTSCPPPAARCK*
Coding >Hirsu2|11224
ATGCTCTCCCGACAAGCCTTCCGCTCCGTCCGGGCCGCCGCCCCGGGCCTTCGAGCGGCGGTGGTGCCTGCGCGC
ACCTTTGCCGCGGCCGCCCCCGCCGCCGGCAATGAGGGCCAGCCGCCCGTCTCCGTCTTCGGCCTCGACGGCACC
TATGCCAGCGCCCTGTACACGGCCGCCTCCAAGTCGTCGACGCTCGACCCCACGGCCCGCGCCATGGCCAGCCTC
GGCAACGTCTTCGACAAGGACGCGAAGCTGACGCACGTCCTGTCGACGCCGACGCTGACGGCCAAGGACAAGGCG
TCTGCAGCAAGTTCGCCCACCTCATGTCCGCCGCCCGCGGCGAGGTGCAAATGA
Transcript >Hirsu2|11224
ATGCTCTCCCGACAAGCCTTCCGCTCCGTCCGGGCCGCCGCCCCGGGCCTTCGAGCGGCGGTGGTGCCTGCGCGC
ACCTTTGCCGCGGCCGCCCCCGCCGCCGGCAATGAGGGCCAGCCGCCCGTCTCCGTCTTCGGCCTCGACGGCACC
TATGCCAGCGCCCTGTACACGGCCGCCTCCAAGTCGTCGACGCTCGACCCCACGGCCCGCGCCATGGCCAGCCTC
GGCAACGTCTTCGACAAGGACGCGAAGCTGACGCACGTCCTGTCGACGCCGACGCTGACGGCCAAGGACAAGGCG
TCTGCAGCAAGTTCGCCCACCTCATGTCCGCCGCCCGCGGCGAGGTGCAAATGA
Gene >Hirsu2|11224
ATGCTCTCCCGACAAGCCTTCCGCTCCGTCCGGGCCGCCGCCCCGGGCCTTCGAGCGGCGGTGGTGCCTGCGCGC
ACCTTTGCCGCGGCCGCCCCCGCCGCCGGCAATGAGGGCCAGCCGCCCGTCTCCGTCTTCGGCCTCGACGGCACC
TATGCCAGCGCCCTGGTACGCACCCCTCGATTGCACCCGGGGAGAGGAGGAGGAGGAGGAGAGTGGAGCATGTGA
TTCTCCTGGACTCGACTGCGGGGACAAAGAGCGAACCCCGACTCGATCGTCTCCCGTTGGAGAGAGGGAAAAGCA
GGAAACTACACCAAACAATGCAGCCGCCGTGTCTCGAGTCGGGGTGATGAAAGGAAACAAAGAGAAACGCGGAAG
GGGTCTTGCTAATGCAGAAGCCTGCTCCATCCAGTACACGGCCGCCTCCAAGTCGTCGACGCTCGACCCCACGGC
CCGCGCCATGGCCAGCCTCGGCAACGTCTTCGACAAGGACGCGAAGCTGACGCACGTCCTGTCGACGCCGACGCT
GACGGCCAAGGACAAGTCGGCCATCGTCGCCGAGCTGGCCAAGCAGGCCGGCGGCGGCGGCGAGACGGTCAAGAA
CTTCCTCGACACGCTCGCCGAGAACAACCGGCTCGGCCTCCTCCAGGGCGTCTGCAGCAAGTTCGCCCACCTCAT
GTCCGCCGCCCGCGGCGAGGTGCAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail