Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11220
Gene name
LocationContig_989:5362..7488
Strand-
Gene length (bp)2126
Transcript length (bp)2004
Coding sequence length (bp)2004
Protein length (aa) 668

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07558 Shugoshin_N Shugoshin N-terminal coiled-coil region 6.1E-14 17 61
PF07557 Shugoshin_C Shugoshin C terminus 1.4E-10 457 480

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q872U8|SGO1_NEUCR Shugoshin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=sgo-1 PE=3 SV=1 1 667 1.0E-85
sp|Q5BDI1|SGO1_EMENI Shugoshin OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sgo1 PE=3 SV=1 1 170 4.0E-24

GO

GO Term Description Terminal node
GO:0045132 meiotic chromosome segregation Yes
GO:0005634 nucleus Yes
GO:0000775 chromosome, centromeric region Yes
GO:0043231 intracellular membrane-bounded organelle No
GO:0110165 cellular anatomical entity No
GO:0007059 chromosome segregation No
GO:0022414 reproductive process No
GO:0008150 biological_process No
GO:0043229 intracellular organelle No
GO:0005575 cellular_component No
GO:0043227 membrane-bounded organelle No
GO:0043226 organelle No
GO:0098813 nuclear chromosome segregation No
GO:0009987 cellular process No
GO:0022402 cell cycle process No
GO:1903046 meiotic cell cycle process No
GO:0098687 chromosomal region No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3627 0.8708 0.0493 0.0759 0.0662 0.0064 0.0211 0.0085 0.0277 0.002

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1530
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|248
Ophiocordyceps australis map64 (Brazil) OphauB2|2424
Ophiocordyceps camponoti-floridani Ophcf2|01552
Ophiocordyceps camponoti-rufipedis Ophun1|2871
Ophiocordyceps kimflemingae Ophio5|1469
Ophiocordyceps subramaniannii Hirsu2|11220 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11220
MARLNELPVSSDSLETLRRKMLRQNRDLAKSNNVRALRIRELENECACMLSENLELRGRILELEKQVDDSEARRI
ADHALAIKAKLESQLTEWGTMIAGLGLEPPLKRHSPRIRKSTSSRQRMSFAAGRPSPSQRRLRDVARDIEDLGHI
SENKSYPRRSMNPQQILALRSEADEADSPELGPPPMSKFIDDDDDPVKVDSPTRHPPLEPQETSPKATIEPPVSF
PSPQVDKVAESPRAPSPEIQTQLPIARPQLDPQPEVPTQSMTAQPVKTGFKRKLAAREEAENTPFQRLMNENQAP
RAVAERPSIRDKADGRTLKELAVARKEGREKKEVDWKARAPLAAKSTNVEMRSPKKSFKPKGAEAGPASTKIELT
TKPKGPIGRPRSKAKSNPPAKAEAEPGPEAALQPTTDLAPPVPPGEPPVLLSPSSPERPGGEPSPRGDTPPPADI
SSRGETTRPSRRNRAAVSYAEPNLRDKMRRPSKGMTDAVAGEGRYSRRSSSQVDTPVSESCPPKHEPEDEGDAWK
ATAAEAREADDPPPSPLAGKDSPPARELPDTIVTERRRRPSSTTNAKKAERTASEGTTGAAQGRAADSDEAKPDP
NESGSVDIYEFTSSSPQADREEAGEANKTNNRRQTMASRRVSAAVDNDKPSTGARERSSSRRRSMMV*
Coding >Hirsu2|11220
ATGGCCCGGCTCAACGAGCTCCCCGTGTCCTCGGACAGCCTAGAAACGCTTCGTAGGAAAATGCTCCGCCAGAAT
AGAGACCTCGCGAAATCCAACAACGTCCGGGCCCTGCGCATCAGGGAACTAGAAAACGAGTGCGCCTGCATGCTG
TCCGAAAACCTCGAGCTCCGCGGCCGAATCCTGGAGCTCGAAAAGCAGGTCGACGACAGCGAGGCCCGGAGGATA
GCGGACCATGCCTTGGCCATCAAGGCGAAGCTGGAGTCGCAGCTTACGGAATGGGGCACCATGATCGCCGGCCTC
GGCCTCGAGCCGCCCTTGAAGAGGCACTCGCCGCGCATCCGGAAGTCGACGTCGTCGAGACAGCGGATGAGCTTT
GCCGCCGGCCGCCCGAGCCCCTCGCAGAGGCGGCTGCGGGACGTCGCCAGGGACATCGAAGACCTGGGGCACATC
TCGGAGAACAAGTCGTACCCCCGCAGATCCATGAACCCGCAACAGATCCTGGCGCTGCGGTCAGAGGCTGACGAG
GCCGACTCACCAGAGCTGGGACCTCCGCCCATGTCCAAGTTTATCGATGACGACGACGACCCCGTCAAGGTCGAC
TCCCCGACTAGACACCCGCCTCTGGAGCCGCAAGAAACGAGCCCGAAAGCCACCATCGAGCCGCCCGTTTCGTTC
CCCTCGCCGCAAGTCGACAAGGTCGCCGAGTCCCCCCGGGCCCCCTCACCCGAGATCCAGACGCAGCTCCCCATT
GCCAGACCACAGCTCGACCCGCAACCCGAAGTGCCGACCCAGTCGATGACGGCCCAGCCGGTCAAGACCGGCTTC
AAACGCAAACTGGCCGCACGCGAAGAGGCAGAAAACACTCCATTTCAACGACTGATGAACGAAAACCAAGCTCCG
CGGGCGGTGGCGGAAAGGCCGTCGATCCGGGACAAGGCGGATGGGAGGACGTTGAAGGAGCTTGCCGTTGCGAGA
AAGGAAGGCAGGGAAAAGAAAGAGGTGGATTGGAAGGCTCGAGCGCCTCTCGCCGCCAAAAGCACAAACGTCGAG
ATGCGCTCGCCCAAAAAGAGCTTCAAGCCAAAGGGGGCCGAGGCGGGACCGGCATCGACCAAGATAGAGCTGACG
ACGAAGCCCAAGGGCCCCATCGGACGGCCCAGGTCCAAGGCGAAGAGCAACCCGCCCGCCAAAGCCGAGGCGGAG
CCGGGGCCGGAGGCGGCTCTGCAACCGACGACGGACCTGGCACCACCAGTCCCCCCCGGAGAGCCGCCGGTCTTG
CTCTCGCCGAGTTCGCCGGAACGGCCGGGCGGCGAGCCGAGTCCTCGAGGCGACACGCCGCCGCCCGCCGACATC
TCCTCCCGCGGCGAGACGACGCGGCCCAGCCGACGCAACAGAGCGGCCGTCAGCTACGCCGAGCCGAACCTGAGA
GACAAGATGCGGCGGCCGTCCAAGGGGATGACCGACGCCGTGGCCGGCGAGGGCAGGTACTCTCGGCGGTCCAGC
AGCCAGGTCGACACGCCCGTTTCCGAGTCCTGTCCGCCGAAGCACGAGCCCGAAGACGAGGGGGATGCGTGGAAA
GCAACGGCTGCCGAGGCGCGGGAGGCCGACGACCCGCCTCCCAGCCCCTTGGCCGGCAAGGATTCCCCGCCCGCG
CGGGAACTGCCCGACACGATCGTGACGGAGCGGCGACGGCGGCCGTCGTCCACGACGAACGCCAAGAAGGCCGAA
AGAACGGCCAGCGAGGGCACTACGGGGGCGGCGCAGGGGAGAGCAGCGGATTCCGACGAGGCCAAGCCGGATCCG
AACGAGTCGGGCAGTGTCGACATCTACGAGTTCACGAGCTCCTCGCCCCAGGCCGACAGGGAAGAGGCGGGCGAG
GCAAACAAGACCAACAACCGCCGCCAGACCATGGCTTCGCGGCGGGTCTCGGCTGCCGTCGACAACGACAAGCCT
TCTACCGGGGCGAGAGAGCGCAGCTCGAGCAGGCGACGGAGCATGATGGTGTGA
Transcript >Hirsu2|11220
ATGGCCCGGCTCAACGAGCTCCCCGTGTCCTCGGACAGCCTAGAAACGCTTCGTAGGAAAATGCTCCGCCAGAAT
AGAGACCTCGCGAAATCCAACAACGTCCGGGCCCTGCGCATCAGGGAACTAGAAAACGAGTGCGCCTGCATGCTG
TCCGAAAACCTCGAGCTCCGCGGCCGAATCCTGGAGCTCGAAAAGCAGGTCGACGACAGCGAGGCCCGGAGGATA
GCGGACCATGCCTTGGCCATCAAGGCGAAGCTGGAGTCGCAGCTTACGGAATGGGGCACCATGATCGCCGGCCTC
GGCCTCGAGCCGCCCTTGAAGAGGCACTCGCCGCGCATCCGGAAGTCGACGTCGTCGAGACAGCGGATGAGCTTT
GCCGCCGGCCGCCCGAGCCCCTCGCAGAGGCGGCTGCGGGACGTCGCCAGGGACATCGAAGACCTGGGGCACATC
TCGGAGAACAAGTCGTACCCCCGCAGATCCATGAACCCGCAACAGATCCTGGCGCTGCGGTCAGAGGCTGACGAG
GCCGACTCACCAGAGCTGGGACCTCCGCCCATGTCCAAGTTTATCGATGACGACGACGACCCCGTCAAGGTCGAC
TCCCCGACTAGACACCCGCCTCTGGAGCCGCAAGAAACGAGCCCGAAAGCCACCATCGAGCCGCCCGTTTCGTTC
CCCTCGCCGCAAGTCGACAAGGTCGCCGAGTCCCCCCGGGCCCCCTCACCCGAGATCCAGACGCAGCTCCCCATT
GCCAGACCACAGCTCGACCCGCAACCCGAAGTGCCGACCCAGTCGATGACGGCCCAGCCGGTCAAGACCGGCTTC
AAACGCAAACTGGCCGCACGCGAAGAGGCAGAAAACACTCCATTTCAACGACTGATGAACGAAAACCAAGCTCCG
CGGGCGGTGGCGGAAAGGCCGTCGATCCGGGACAAGGCGGATGGGAGGACGTTGAAGGAGCTTGCCGTTGCGAGA
AAGGAAGGCAGGGAAAAGAAAGAGGTGGATTGGAAGGCTCGAGCGCCTCTCGCCGCCAAAAGCACAAACGTCGAG
ATGCGCTCGCCCAAAAAGAGCTTCAAGCCAAAGGGGGCCGAGGCGGGACCGGCATCGACCAAGATAGAGCTGACG
ACGAAGCCCAAGGGCCCCATCGGACGGCCCAGGTCCAAGGCGAAGAGCAACCCGCCCGCCAAAGCCGAGGCGGAG
CCGGGGCCGGAGGCGGCTCTGCAACCGACGACGGACCTGGCACCACCAGTCCCCCCCGGAGAGCCGCCGGTCTTG
CTCTCGCCGAGTTCGCCGGAACGGCCGGGCGGCGAGCCGAGTCCTCGAGGCGACACGCCGCCGCCCGCCGACATC
TCCTCCCGCGGCGAGACGACGCGGCCCAGCCGACGCAACAGAGCGGCCGTCAGCTACGCCGAGCCGAACCTGAGA
GACAAGATGCGGCGGCCGTCCAAGGGGATGACCGACGCCGTGGCCGGCGAGGGCAGGTACTCTCGGCGGTCCAGC
AGCCAGGTCGACACGCCCGTTTCCGAGTCCTGTCCGCCGAAGCACGAGCCCGAAGACGAGGGGGATGCGTGGAAA
GCAACGGCTGCCGAGGCGCGGGAGGCCGACGACCCGCCTCCCAGCCCCTTGGCCGGCAAGGATTCCCCGCCCGCG
CGGGAACTGCCCGACACGATCGTGACGGAGCGGCGACGGCGGCCGTCGTCCACGACGAACGCCAAGAAGGCCGAA
AGAACGGCCAGCGAGGGCACTACGGGGGCGGCGCAGGGGAGAGCAGCGGATTCCGACGAGGCCAAGCCGGATCCG
AACGAGTCGGGCAGTGTCGACATCTACGAGTTCACGAGCTCCTCGCCCCAGGCCGACAGGGAAGAGGCGGGCGAG
GCAAACAAGACCAACAACCGCCGCCAGACCATGGCTTCGCGGCGGGTCTCGGCTGCCGTCGACAACGACAAGCCT
TCTACCGGGGCGAGAGAGCGCAGCTCGAGCAGGCGACGGAGCATGATGGTGTGA
Gene >Hirsu2|11220
ATGGCCCGGCTCAACGAGCTCCCCGTGTCCTCGGACAGCCTAGAAACGCGTGCGTCCGTCTGGGCCCCCCCGCGG
ATGACGGACTGCGCGCCGCTGACTCTGCTGCCCAGTTCGTAGGAAAATGCTCCGCCAGAATAGAGACCTCGCGAA
ATCCAACAACGTCCGGGCCCTGCGCATCAGGGAACTAGAAAACGAGTGCGCCTGCATGCTGTCCGAAAACCTCGA
GCTCCGCGGCCGAATCCTGGAGCTCGAAAAGCAGGTCGACGACAGCGAGGCCCGGAGGATAGCGGACCATGCCTT
GGCCATCAAGGCGAAGCTGGAGTCGCAGCTTACGGAATGGGGCACCATGATCGCCGGCCTCGGCCTCGAGCCGCC
CTTGAAGAGGCACTCGCCGCGCATCCGGAAGTCGACGTCGTCGAGACAGCGGATGAGCTTTGCCGCCGGCCGCCC
GAGCCCCTCGCAGAGGCGGCTGCGGGACGTCGCCAGGGACATCGAAGACCTGGGGCACATCTCGGAGAACAAGTC
GTACCCCCGCAGATCCATGAAGTAGGCCCTCGTCACCACCCCGTCACCGCGGCGGGCGCTGCTGACGACGCCCTC
TATCTAGCCCGCAACAGATCCTGGCGCTGCGGTCAGAGGCTGACGAGGCCGACTCACCAGAGCTGGGACCTCCGC
CCATGTCCAAGTTTATCGATGACGACGACGACCCCGTCAAGGTCGACTCCCCGACTAGACACCCGCCTCTGGAGC
CGCAAGAAACGAGCCCGAAAGCCACCATCGAGCCGCCCGTTTCGTTCCCCTCGCCGCAAGTCGACAAGGTCGCCG
AGTCCCCCCGGGCCCCCTCACCCGAGATCCAGACGCAGCTCCCCATTGCCAGACCACAGCTCGACCCGCAACCCG
AAGTGCCGACCCAGTCGATGACGGCCCAGCCGGTCAAGACCGGCTTCAAACGCAAACTGGCCGCACGCGAAGAGG
CAGAAAACACTCCATTTCAACGACTGATGAACGAAAACCAAGCTCCGCGGGCGGTGGCGGAAAGGCCGTCGATCC
GGGACAAGGCGGATGGGAGGACGTTGAAGGAGCTTGCCGTTGCGAGAAAGGAAGGCAGGGAAAAGAAAGAGGTGG
ATTGGAAGGCTCGAGCGCCTCTCGCCGCCAAAAGCACAAACGTCGAGATGCGCTCGCCCAAAAAGAGCTTCAAGC
CAAAGGGGGCCGAGGCGGGACCGGCATCGACCAAGATAGAGCTGACGACGAAGCCCAAGGGCCCCATCGGACGGC
CCAGGTCCAAGGCGAAGAGCAACCCGCCCGCCAAAGCCGAGGCGGAGCCGGGGCCGGAGGCGGCTCTGCAACCGA
CGACGGACCTGGCACCACCAGTCCCCCCCGGAGAGCCGCCGGTCTTGCTCTCGCCGAGTTCGCCGGAACGGCCGG
GCGGCGAGCCGAGTCCTCGAGGCGACACGCCGCCGCCCGCCGACATCTCCTCCCGCGGCGAGACGACGCGGCCCA
GCCGACGCAACAGAGCGGCCGTCAGCTACGCCGAGCCGAACCTGAGAGACAAGATGCGGCGGCCGTCCAAGGGGA
TGACCGACGCCGTGGCCGGCGAGGGCAGGTACTCTCGGCGGTCCAGCAGCCAGGTCGACACGCCCGTTTCCGAGT
CCTGTCCGCCGAAGCACGAGCCCGAAGACGAGGGGGATGCGTGGAAAGCAACGGCTGCCGAGGCGCGGGAGGCCG
ACGACCCGCCTCCCAGCCCCTTGGCCGGCAAGGATTCCCCGCCCGCGCGGGAACTGCCCGACACGATCGTGACGG
AGCGGCGACGGCGGCCGTCGTCCACGACGAACGCCAAGAAGGCCGAAAGAACGGCCAGCGAGGGCACTACGGGGG
CGGCGCAGGGGAGAGCAGCGGATTCCGACGAGGCCAAGCCGGATCCGAACGAGTCGGGCAGTGTCGACATCTACG
AGTTCACGAGCTCCTCGCCCCAGGCCGACAGGGAAGAGGCGGGCGAGGCAAACAAGACCAACAACCGCCGCCAGA
CCATGGCTTCGCGGCGGGTCTCGGCTGCCGTCGACAACGACAAGCCTTCTACCGGGGCGAGAGAGCGCAGCTCGA
GCAGGCGACGGAGCATGATGGTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail