Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11218
Gene name
LocationContig_989:801..3715
Strand-
Gene length (bp)2914
Transcript length (bp)2778
Coding sequence length (bp)2778
Protein length (aa) 926

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08161 NUC173 NUC173 domain 4.9E-76 383 585

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12754|RRP12_YEAST Ribosomal RNA-processing protein 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP12 PE=1 SV=1 6 920 0.0E+00
sp|Q9C0X8|RRP12_SCHPO Putative ribosomal RNA-processing protein 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp12 PE=3 SV=1 26 921 3.0E-119
sp|Q5ZKD5|RRP12_CHICK RRP12-like protein OS=Gallus gallus GN=RRP12 PE=2 SV=1 20 916 2.0E-92
sp|Q6P5B0|RRP12_MOUSE RRP12-like protein OS=Mus musculus GN=Rrp12 PE=1 SV=1 20 916 1.0E-82
sp|Q5JTH9|RRP12_HUMAN RRP12-like protein OS=Homo sapiens GN=RRP12 PE=1 SV=2 20 916 9.0E-82
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12754|RRP12_YEAST Ribosomal RNA-processing protein 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP12 PE=1 SV=1 6 920 0.0E+00
sp|Q9C0X8|RRP12_SCHPO Putative ribosomal RNA-processing protein 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp12 PE=3 SV=1 26 921 3.0E-119
sp|Q5ZKD5|RRP12_CHICK RRP12-like protein OS=Gallus gallus GN=RRP12 PE=2 SV=1 20 916 2.0E-92
sp|Q6P5B0|RRP12_MOUSE RRP12-like protein OS=Mus musculus GN=Rrp12 PE=1 SV=1 20 916 1.0E-82
sp|Q5JTH9|RRP12_HUMAN RRP12-like protein OS=Homo sapiens GN=RRP12 PE=1 SV=2 20 916 9.0E-82
sp|Q9VYA7|RRP12_DROME RRP12-like protein OS=Drosophila melanogaster GN=CG2691 PE=1 SV=2 21 671 2.0E-39
sp|Q9Y824|YON1_SCHPO Uncharacterized protein C1105.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1105.01 PE=1 SV=2 785 920 1.0E-13
sp|Q9Y824|YON1_SCHPO Uncharacterized protein C1105.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1105.01 PE=1 SV=2 14 161 2.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 61 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11218
MATPTLAERLDKIKSPGLQSQQKTVVILQAVESTLKEQNTTASPTGYFAALLALLQQANGNGNVNTELATPVVYL
LDVVTPHAPQPLLRSKFTQILTLLAPVLLMQDAEPILLRTSIGCLESLLLAQDGSSWELSVTQIGPRRAVAGLLN
LSLDHRPKVRKRAQDALKRVLKNPPPSPSLDHPAADMCAQTALKNLDELAGKAAQARRGRKSAATAHDPALIHAL
QLVKSVAAASGGWPSTKIESLCELLLNIAKTGNEYMTMAGFEIFELIFESMSDDVSSAKLPRLMEIISELRPAAN
DTQLVPPWLAILSRGYDVSSQLEPEETFQKLPDLFSMVAHFLESLSENIRISASECLVSFAANCIPAQVILEPSI
YDDKTLDKIAKSAESLLTVQYQAAWLQTFNVLGALFSALRWRAHPRMLTITRTIGEIRENPSFRNKKEADEVIGQ
AVRAMGPEAVLSVLPLNIARPVKGQSGRAWMFPILRDYTSNTHLGHFRREMVPLSELMFQKVLDHGDAEKTMEVK
IYETLVQQTWSILPGYCDLPLDLAEAFDQQFAEMLANLLYKQVDLRLSICKALKTLIESNQAMSGIADDEDDFLL
QSRVSRETAAKNLAHLGQYSGNMLAVLFNVYTQTLPQSRGPMLQTINAFLSTTPRREVVDTFDRVSKMLAAELQA
GAAAAEKGKQQQQQQQKSKDPMPSTAQTLMDLVITMSGYLPRESFAALFEIASVIAYKEDEPQLQKKAYKLIPRL
AGSELGRAALRERNGELQQLMLSSAQKVSAPARRERLAAILALLPFVPDDSLHFLPSVLSEVVICCKENNERARE
TAYELLVQMGYRMVAADGVAIDNSRVPHMPDDAAPGQANIEEYLTMVSAGLAGSTPHMISASITAISRLLFEFRS
SLSEQTLSDLVQTMDLSASSACPWS*
Coding >Hirsu2|11218
ATGGCGACCCCAACATTGGCCGAGAGGCTTGACAAGATCAAGTCTCCCGGCTTGCAAAGCCAGCAGAAGACCGTC
GTCATCCTCCAAGCCGTCGAGTCGACGCTGAAAGAGCAGAACACCACCGCCTCGCCGACCGGCTACTTCGCAGCC
CTGCTCGCCCTCTTGCAGCAAGCCAATGGCAATGGCAACGTCAACACCGAACTGGCGACGCCCGTCGTCTACCTC
CTGGACGTCGTCACGCCCCACGCCCCGCAGCCCCTGCTGCGATCCAAGTTCACGCAGATCCTCACCCTGCTGGCG
CCCGTGCTGCTGATGCAGGACGCGGAGCCGATACTCCTCAGGACGTCCATCGGCTGTCTCGAGTCCCTCTTGCTG
GCCCAGGACGGCTCCTCGTGGGAGCTCTCCGTCACGCAGATCGGCCCCCGCCGCGCCGTGGCCGGCCTGCTCAAC
CTGTCGCTGGACCACAGGCCCAAGGTCCGCAAGCGCGCGCAGGACGCGCTCAAGAGGGTCCTCAAGAATCCGCCG
CCGAGCCCCTCGCTCGACCACCCGGCCGCCGACATGTGCGCCCAGACGGCGCTCAAAAACCTCGACGAGCTCGCC
GGCAAGGCGGCCCAGGCGCGGAGGGGCAGGAAGTCGGCCGCCACGGCCCACGACCCGGCCCTGATCCACGCGCTG
CAGCTGGTCAAGTCGGTCGCTGCCGCGAGCGGCGGCTGGCCGAGCACCAAGATCGAGTCCCTCTGCGAACTGCTG
CTGAACATCGCCAAGACCGGAAACGAGTACATGACCATGGCCGGCTTCGAGATCTTCGAGCTCATCTTCGAGAGC
ATGTCGGACGACGTGTCCTCGGCCAAGCTGCCGCGCCTCATGGAAATCATATCCGAGCTGCGCCCGGCCGCCAAC
GACACCCAGCTCGTGCCGCCCTGGCTGGCGATCCTCTCGCGAGGATACGACGTCTCGTCCCAGCTGGAGCCGGAA
GAGACGTTCCAGAAGCTCCCCGACCTCTTCTCCATGGTCGCCCACTTCCTCGAGTCGCTTTCGGAGAACATCCGG
ATCTCGGCCTCGGAGTGCCTGGTGTCCTTTGCGGCCAACTGCATCCCCGCGCAGGTCATCCTCGAGCCTTCGATA
TACGACGACAAGACGCTGGACAAGATCGCCAAGTCTGCCGAGTCGCTGCTCACCGTCCAGTACCAGGCGGCCTGG
CTCCAGACGTTCAACGTGCTGGGCGCCCTGTTCAGCGCCCTCAGGTGGAGGGCCCATCCGCGGATGCTCACCATC
ACGCGCACCATCGGCGAGATCCGGGAGAACCCGTCCTTCCGCAACAAGAAGGAGGCCGACGAGGTGATTGGCCAG
GCCGTCCGAGCCATGGGCCCCGAGGCCGTCCTGTCGGTGCTGCCGCTGAACATCGCCAGGCCCGTCAAGGGCCAG
TCGGGCAGGGCCTGGATGTTCCCCATCCTGCGCGACTACACCAGCAACACCCACCTCGGCCACTTCAGGAGGGAG
ATGGTGCCCCTGAGCGAGCTCATGTTCCAGAAGGTGCTGGACCACGGGGACGCGGAAAAGACGATGGAGGTCAAG
ATCTACGAGACGCTCGTCCAGCAGACGTGGTCCATCCTCCCCGGCTACTGCGACCTGCCCCTCGACCTGGCCGAG
GCCTTCGACCAGCAGTTCGCCGAGATGCTCGCCAACCTCCTCTACAAACAGGTCGACCTGCGGCTGAGCATCTGC
AAGGCCCTCAAGACCCTGATCGAGTCCAACCAAGCCATGTCCGGCATCGCCGACGACGAAGACGACTTTTTGCTC
CAGAGCCGCGTCTCCCGCGAGACGGCCGCCAAGAACCTGGCCCACCTCGGCCAATACTCGGGCAACATGCTCGCC
GTGCTCTTCAACGTCTACACGCAAACCCTGCCGCAGAGCCGGGGCCCCATGCTGCAGACCATCAACGCGTTTCTC
AGCACGACGCCCCGCCGGGAGGTGGTCGACACCTTCGACCGGGTCAGCAAGATGCTGGCGGCCGAGCTCCAGGCC
GGCGCAGCGGCGGCGGAGAAGGGCAAGCAGCAGCAGCAGCAACAGCAAAAGTCGAAGGATCCCATGCCGTCCACG
GCCCAGACGCTGATGGACCTCGTCATCACCATGTCTGGCTACCTGCCCCGGGAAAGCTTCGCCGCGCTGTTCGAG
ATCGCGTCCGTGATCGCGTACAAGGAGGACGAGCCCCAGCTGCAAAAGAAGGCCTACAAGCTGATCCCCCGGCTG
GCGGGCTCCGAGCTCGGCAGGGCGGCGCTGCGGGAGAGGAACGGCGAGCTGCAGCAGCTGATGCTGTCCAGCGCC
CAGAAGGTGTCGGCCCCCGCGCGACGCGAGCGGCTGGCCGCTATCCTGGCCCTCCTCCCCTTCGTGCCGGACGAC
TCGCTCCACTTCCTGCCGTCGGTGCTCAGCGAGGTCGTCATCTGCTGCAAGGAGAACAACGAGCGGGCGCGGGAG
ACGGCGTACGAGCTGCTGGTCCAGATGGGCTACCGCATGGTGGCCGCCGACGGCGTCGCCATCGACAACAGCCGG
GTCCCGCACATGCCCGACGACGCGGCGCCGGGGCAGGCGAACATCGAGGAATACCTGACCATGGTCAGCGCCGGC
CTGGCCGGCAGCACGCCGCACATGATCTCGGCCTCCATCACGGCCATCAGCCGGCTCCTGTTCGAGTTCCGGTCC
AGCCTGAGCGAGCAGACGCTGTCGGACCTGGTGCAGACGATGGACCTGTCTGCATCATCGGCCTGCCCGTGGAGC
TGA
Transcript >Hirsu2|11218
ATGGCGACCCCAACATTGGCCGAGAGGCTTGACAAGATCAAGTCTCCCGGCTTGCAAAGCCAGCAGAAGACCGTC
GTCATCCTCCAAGCCGTCGAGTCGACGCTGAAAGAGCAGAACACCACCGCCTCGCCGACCGGCTACTTCGCAGCC
CTGCTCGCCCTCTTGCAGCAAGCCAATGGCAATGGCAACGTCAACACCGAACTGGCGACGCCCGTCGTCTACCTC
CTGGACGTCGTCACGCCCCACGCCCCGCAGCCCCTGCTGCGATCCAAGTTCACGCAGATCCTCACCCTGCTGGCG
CCCGTGCTGCTGATGCAGGACGCGGAGCCGATACTCCTCAGGACGTCCATCGGCTGTCTCGAGTCCCTCTTGCTG
GCCCAGGACGGCTCCTCGTGGGAGCTCTCCGTCACGCAGATCGGCCCCCGCCGCGCCGTGGCCGGCCTGCTCAAC
CTGTCGCTGGACCACAGGCCCAAGGTCCGCAAGCGCGCGCAGGACGCGCTCAAGAGGGTCCTCAAGAATCCGCCG
CCGAGCCCCTCGCTCGACCACCCGGCCGCCGACATGTGCGCCCAGACGGCGCTCAAAAACCTCGACGAGCTCGCC
GGCAAGGCGGCCCAGGCGCGGAGGGGCAGGAAGTCGGCCGCCACGGCCCACGACCCGGCCCTGATCCACGCGCTG
CAGCTGGTCAAGTCGGTCGCTGCCGCGAGCGGCGGCTGGCCGAGCACCAAGATCGAGTCCCTCTGCGAACTGCTG
CTGAACATCGCCAAGACCGGAAACGAGTACATGACCATGGCCGGCTTCGAGATCTTCGAGCTCATCTTCGAGAGC
ATGTCGGACGACGTGTCCTCGGCCAAGCTGCCGCGCCTCATGGAAATCATATCCGAGCTGCGCCCGGCCGCCAAC
GACACCCAGCTCGTGCCGCCCTGGCTGGCGATCCTCTCGCGAGGATACGACGTCTCGTCCCAGCTGGAGCCGGAA
GAGACGTTCCAGAAGCTCCCCGACCTCTTCTCCATGGTCGCCCACTTCCTCGAGTCGCTTTCGGAGAACATCCGG
ATCTCGGCCTCGGAGTGCCTGGTGTCCTTTGCGGCCAACTGCATCCCCGCGCAGGTCATCCTCGAGCCTTCGATA
TACGACGACAAGACGCTGGACAAGATCGCCAAGTCTGCCGAGTCGCTGCTCACCGTCCAGTACCAGGCGGCCTGG
CTCCAGACGTTCAACGTGCTGGGCGCCCTGTTCAGCGCCCTCAGGTGGAGGGCCCATCCGCGGATGCTCACCATC
ACGCGCACCATCGGCGAGATCCGGGAGAACCCGTCCTTCCGCAACAAGAAGGAGGCCGACGAGGTGATTGGCCAG
GCCGTCCGAGCCATGGGCCCCGAGGCCGTCCTGTCGGTGCTGCCGCTGAACATCGCCAGGCCCGTCAAGGGCCAG
TCGGGCAGGGCCTGGATGTTCCCCATCCTGCGCGACTACACCAGCAACACCCACCTCGGCCACTTCAGGAGGGAG
ATGGTGCCCCTGAGCGAGCTCATGTTCCAGAAGGTGCTGGACCACGGGGACGCGGAAAAGACGATGGAGGTCAAG
ATCTACGAGACGCTCGTCCAGCAGACGTGGTCCATCCTCCCCGGCTACTGCGACCTGCCCCTCGACCTGGCCGAG
GCCTTCGACCAGCAGTTCGCCGAGATGCTCGCCAACCTCCTCTACAAACAGGTCGACCTGCGGCTGAGCATCTGC
AAGGCCCTCAAGACCCTGATCGAGTCCAACCAAGCCATGTCCGGCATCGCCGACGACGAAGACGACTTTTTGCTC
CAGAGCCGCGTCTCCCGCGAGACGGCCGCCAAGAACCTGGCCCACCTCGGCCAATACTCGGGCAACATGCTCGCC
GTGCTCTTCAACGTCTACACGCAAACCCTGCCGCAGAGCCGGGGCCCCATGCTGCAGACCATCAACGCGTTTCTC
AGCACGACGCCCCGCCGGGAGGTGGTCGACACCTTCGACCGGGTCAGCAAGATGCTGGCGGCCGAGCTCCAGGCC
GGCGCAGCGGCGGCGGAGAAGGGCAAGCAGCAGCAGCAGCAACAGCAAAAGTCGAAGGATCCCATGCCGTCCACG
GCCCAGACGCTGATGGACCTCGTCATCACCATGTCTGGCTACCTGCCCCGGGAAAGCTTCGCCGCGCTGTTCGAG
ATCGCGTCCGTGATCGCGTACAAGGAGGACGAGCCCCAGCTGCAAAAGAAGGCCTACAAGCTGATCCCCCGGCTG
GCGGGCTCCGAGCTCGGCAGGGCGGCGCTGCGGGAGAGGAACGGCGAGCTGCAGCAGCTGATGCTGTCCAGCGCC
CAGAAGGTGTCGGCCCCCGCGCGACGCGAGCGGCTGGCCGCTATCCTGGCCCTCCTCCCCTTCGTGCCGGACGAC
TCGCTCCACTTCCTGCCGTCGGTGCTCAGCGAGGTCGTCATCTGCTGCAAGGAGAACAACGAGCGGGCGCGGGAG
ACGGCGTACGAGCTGCTGGTCCAGATGGGCTACCGCATGGTGGCCGCCGACGGCGTCGCCATCGACAACAGCCGG
GTCCCGCACATGCCCGACGACGCGGCGCCGGGGCAGGCGAACATCGAGGAATACCTGACCATGGTCAGCGCCGGC
CTGGCCGGCAGCACGCCGCACATGATCTCGGCCTCCATCACGGCCATCAGCCGGCTCCTGTTCGAGTTCCGGTCC
AGCCTGAGCGAGCAGACGCTGTCGGACCTGGTGCAGACGATGGACCTGTCTGCATCATCGGCCTGCCCGTGGAGC
TGA
Gene >Hirsu2|11218
ATGGCGACCCCAACATTGGCCGAGAGGCTTGACAAGATCAAGTCTCCCGGCTTGCAAAGCCAGCAGAAGGTACAT
CTCTCCCGCGCTCTCGCACAAGACAAATATGTATATATATACGGATCTAACACGGGATTCCACCTCCGTCCATAG
ACCGTCGTCATCCTCCAAGCCGTCGAGTCGACGCTGAAAGAGCAGAACACCACCGCCTCGCCGACCGGCTACTTC
GCAGCCCTGCTCGCCCTCTTGCAGCAAGCCAATGGCAATGGCAACGTCAACACCGAACTGGCGACGCCCGTCGTC
TACCTCCTGGACGTCGTCACGCCCCACGCCCCGCAGCCCCTGCTGCGATCCAAGTTCACGCAGATCCTCACCCTG
CTGGCGCCCGTGCTGCTGATGCAGGACGCGGAGCCGATACTCCTCAGGACGTCCATCGGCTGTCTCGAGTCCCTC
TTGCTGGCCCAGGACGGCTCCTCGTGGGAGCTCTCCGTCACGCAGATCGGCCCCCGCCGCGCCGTGGCCGGCCTG
CTCAACCTGTCGCTGGACCACAGGCCCAAGGTCCGCAAGCGCGCGCAGGACGCGCTCAAGAGGGTCCTCAAGAAT
CCGCCGCCGAGCCCCTCGCTCGACCACCCGGCCGCCGACATGTGCGCCCAGACGGCGCTCAAAAACCTCGACGAG
CTCGCCGGCAAGGCGGCCCAGGCGCGGAGGGGCAGGAAGTCGGCCGCCACGGCCCACGACCCGGCCCTGATCCAC
GCGCTGCAGCTGGTCAAGTCGGTCGCTGCCGCGAGCGGCGGCTGGCCGAGCACCAAGATCGAGTCCCTCTGCGAA
CTGCTGCTGAACATCGCCAAGACCGGAAACGAGTACATGACCATGGCCGGCTTCGAGATCTTCGAGCTCATCTTC
GAGAGCATGTCGGACGACGTGTCCTCGGCCAAGCTGCCGCGCCTCATGGAAATCATATCCGAGCTGCGCCCGGCC
GCCAACGACACCCAGCTCGTGCCGCCCTGGCTGGCGATCCTCTCGCGAGGATACGACGTCTCGTCCCAGCTGGAG
CCGGAAGAGACGTTCCAGAAGCTCCCCGACCTCTTCTCCATGGTCGCCCACTTCCTCGAGTCGCTTTCGGAGAAC
ATCCGGATCTCGGCCTCGGAGTGCCTGGTGTCCTTTGCGGCCAACTGCATCCCCGCGCAGGTCATCCTCGAGCCT
TCGATATACGACGACAAGACGCTGGACAAGATCGCCAAGTCTGCCGAGTCGCTGCTCACCGTCCAGTACCAGGCG
GCCTGGCTCCAGACGTTCAACGTGCTGGGCGCCCTGTTCAGCGCCCTCAGGTGGAGGGCCCATCCGCGGATGCTC
ACCATCACGCGCACCATCGGCGAGATCCGGGAGAACCCGTCCTTCCGCAACAAGAAGGAGGCCGACGAGGTGATT
GGCCAGGCCGTCCGAGCCATGGGCCCCGAGGCCGTCCTGTCGGTGCTGCCGCTGAACATCGCCAGGCCCGTCAAG
GGCCAGTCGGGCAGGGCCTGGATGTTCCCCATCCTGCGCGACTACACCAGCAACACCCACCTCGGCCACTTCAGG
AGGGAGATGGTGCCCCTGAGCGAGCTCATGTTCCAGAAGGTGCTGGACCACGGGGACGCGGAAAAGACGATGGAG
GTCAAGATCTACGAGACGCTCGTCCAGCAGACGTGGTCCATCCTCCCCGGCTACTGCGACCTGCCCCTCGACCTG
GCCGAGGCCTTCGACCAGCAGTTCGCCGAGATGCTCGCCAACCTCCTCTACAAACAGGTCGACCTGCGGCTGAGC
ATCTGCAAGGCCCTCAAGACCCTGATCGAGTCCAACCAAGCCATGTCCGGCATCGCCGACGACGAAGACGACTTT
TTGCTCCAGAGCCGCGTCTCCCGCGAGACGGCCGCCAAGAACCTGGCCCACCTCGGCCAATACTCGGGCAACATG
CTCGCCGTGCTCTTCAACGTCTACACGCAAACCCTGCCGCAGAGCCGGGGCCCCATGCTGCAGACCATCAACGCG
TTTCTCAGCACGACGCCCCGCCGGGAGGTGGTCGACACCTTCGACCGGGTCAGCAAGATGCTGGCGGCCGAGCTC
CAGGCCGGCGCAGCGGCGGCGGAGAAGGGCAAGCAGCAGCAGCAGCAACAGCAAAAGTCGAAGGATCCCATGCCG
TCCACGGCCCAGACGCTGATGGACCTCGTCATCACCATGTCTGGCTACCTGCCCCGGGAAAGCTTCGCCGCGCTG
TTCGAGATCGCGTCCGTGATCGCGTACAAGGAGGACGAGCCCCAGCTGCAAAAGAAGGCCTACAAGCTGATCCCC
CGGCTGGCGGGCTCCGAGCTCGGCAGGGCGGCGCTGCGGGAGAGGAACGGCGAGCTGCAGCAGCTGATGCTGTCC
AGCGCCCAGAAGGTGTCGGCCCCCGCGCGACGCGAGCGGCTGGCCGCTATCCTGGCCCTCCTCCCCTTCGTGCCG
GACGACTCGCTCCACTTCCTGCCGTCGGTGCTCAGCGAGGTCGTCATCTGCTGCAAGGAGAACAACGAGCGGGCG
CGGGAGACGGCGTACGAGCTGCTGGTCCAGATGGGCTACCGCATGGTGGCCGCCGACGGCGTCGCCATCGACAAC
AGCCGGGTCCCGCACATGCCCGACGACGCGGCGCCGGGGCAGGCGAACATCGAGGAATACCTGACCATGGTCAGC
GCCGGCCTGGCCGGCAGCACGCCGCACATGATCTCGGCCTCCATCACGGCCATCAGCCGGCTCCTGTTCGAGTTC
CGGTCCAGCCTGAGCGAGCAGACGCTGTCGGACCTGGTGCAGACGATGGACCTGTTCCTGACGTCGAACAACCGA
GAAATCGTCAAGAGCTGCCTGGGCTTCGTCAAGGTCTGCATCATCGGCCTGCCCGTGGAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail