Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1121
Gene name
LocationContig_1236:5616..7200
Strand+
Gene length (bp)1584
Transcript length (bp)1317
Coding sequence length (bp)1317
Protein length (aa) 439

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00809 Pterin_bind Pterin binding enzyme 3.1E-79 172 420
PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK) 5.2E-31 1 121

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P29251|FOL1_PNECA Folic acid synthesis protein fol1 OS=Pneumocystis carinii GN=fol1 PE=1 SV=1 1 437 2.0E-132
sp|Q4LB35|FOL1_SCHPO Folic acid synthesis protein fol1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fol1 PE=1 SV=2 1 435 9.0E-121
sp|Q9SZV3|FOLM_ARATH Folate synthesis bifunctional protein, mitochondrial OS=Arabidopsis thaliana GN=MitHPPK/DHPS PE=2 SV=1 1 437 2.0E-103
sp|O04862|FOLM_PEA Folate synthesis bifunctional protein, mitochondrial OS=Pisum sativum GN=MitHPPK/DHPS PE=1 SV=1 1 437 2.0E-96
sp|Q1ENB6|FOLC_ARATH Folate synthesis bifunctional protein OS=Arabidopsis thaliana GN=CytHPPK/DHPS PE=1 SV=1 1 435 6.0E-94
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P29251|FOL1_PNECA Folic acid synthesis protein fol1 OS=Pneumocystis carinii GN=fol1 PE=1 SV=1 1 437 2.0E-132
sp|Q4LB35|FOL1_SCHPO Folic acid synthesis protein fol1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fol1 PE=1 SV=2 1 435 9.0E-121
sp|Q9SZV3|FOLM_ARATH Folate synthesis bifunctional protein, mitochondrial OS=Arabidopsis thaliana GN=MitHPPK/DHPS PE=2 SV=1 1 437 2.0E-103
sp|O04862|FOLM_PEA Folate synthesis bifunctional protein, mitochondrial OS=Pisum sativum GN=MitHPPK/DHPS PE=1 SV=1 1 437 2.0E-96
sp|Q1ENB6|FOLC_ARATH Folate synthesis bifunctional protein OS=Arabidopsis thaliana GN=CytHPPK/DHPS PE=1 SV=1 1 435 6.0E-94
sp|P53848|FOL1_YEAST Folic acid synthesis protein FOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FOL1 PE=1 SV=2 1 437 1.0E-82
sp|P73248|DHPS_SYNY3 Dihydropteroate synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=folP PE=3 SV=1 167 437 1.0E-77
sp|P28822|DHPS_BACSU Dihydropteroate synthase OS=Bacillus subtilis (strain 168) GN=sul PE=3 SV=2 161 437 1.0E-56
sp|P0AC15|DHPS_SHIFL Dihydropteroate synthase OS=Shigella flexneri GN=folP PE=3 SV=1 170 424 3.0E-56
sp|P0AC13|DHPS_ECOLI Dihydropteroate synthase OS=Escherichia coli (strain K12) GN=folP PE=1 SV=1 170 424 3.0E-56
sp|P0AC14|DHPS_ECOL6 Dihydropteroate synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=folP PE=3 SV=1 170 424 3.0E-56
sp|Q05621|DHPS_CLOB8 Dihydropteroate synthase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=Cbei_0206 PE=3 SV=2 167 437 2.0E-53
sp|P43776|DHPS_HAEIN Dihydropteroate synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=folP-A PE=3 SV=1 170 437 1.0E-48
sp|Q59919|DHPS_STAHA Dihydropteroate synthase OS=Staphylococcus haemolyticus GN=folP PE=3 SV=1 168 421 5.0E-47
sp|O05701|DHPS_STAAU Dihydropteroate synthase OS=Staphylococcus aureus GN=folP PE=1 SV=1 168 421 3.0E-45
sp|Q6GJF7|DHPS_STAAR Dihydropteroate synthase OS=Staphylococcus aureus (strain MRSA252) GN=folP PE=3 SV=1 168 421 3.0E-45
sp|Q54YD9|FOL1_DICDI Folic acid synthesis protein FOL1 OS=Dictyostelium discoideum GN=fol1 PE=3 SV=1 1 289 4.0E-45
sp|Q8NXZ2|DHPS_STAAW Dihydropteroate synthase OS=Staphylococcus aureus (strain MW2) GN=folP PE=3 SV=1 168 421 4.0E-45
sp|P64142|DHPS_STAAN Dihydropteroate synthase OS=Staphylococcus aureus (strain N315) GN=folP PE=3 SV=1 168 421 4.0E-45
sp|P64141|DHPS_STAAM Dihydropteroate synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=folP PE=1 SV=1 168 421 4.0E-45
sp|P0C0G0|DHPS_STRPY Dihydropteroate synthase OS=Streptococcus pyogenes GN=folP PE=3 SV=1 171 432 5.0E-45
sp|Q5HIG1|DHPS_STAAC Dihydropteroate synthase OS=Staphylococcus aureus (strain COL) GN=folP PE=3 SV=1 168 421 7.0E-45
sp|P0DB09|DHPS_STRPQ Dihydropteroate synthase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=folP PE=3 SV=1 171 432 7.0E-45
sp|P0DB08|DHPS_STRP3 Dihydropteroate synthase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=folP PE=3 SV=1 171 432 7.0E-45
sp|Q6GBX4|DHPS_STAAS Dihydropteroate synthase OS=Staphylococcus aureus (strain MSSA476) GN=folP PE=3 SV=1 168 421 2.0E-44
sp|Q5XCA8|DHPS_STRP6 Dihydropteroate synthase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=folP PE=1 SV=1 171 432 3.0E-44
sp|Q8P152|DHPS_STRP8 Dihydropteroate synthase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=folP PE=3 SV=1 171 432 1.0E-43
sp|P0C0G1|DHPS_STRP1 Dihydropteroate synthase OS=Streptococcus pyogenes serotype M1 GN=folP PE=3 SV=1 171 432 1.0E-43
sp|Q5HRP0|DHPS_STAEQ Dihydropteroate synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=folP PE=3 SV=1 168 421 2.0E-43
sp|Q51161|DHPS_NEIMB Dihydropteroate synthase OS=Neisseria meningitidis serogroup B (strain MC58) GN=folP PE=3 SV=2 168 435 1.0E-41
sp|Q8CMT7|DHPS_STAES Dihydropteroate synthase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=folP PE=3 SV=1 168 421 2.0E-41
sp|P82602|FOLKP_CHLMU Folate synthesis bifunctional protein OS=Chlamydia muridarum (strain MoPn / Nigg) GN=folKP PE=3 SV=1 1 420 4.0E-41
sp|Q821E2|FOLKP_CHLCV Folate synthesis bifunctional protein OS=Chlamydophila caviae (strain GPIC) GN=folKP PE=3 SV=1 1 436 1.0E-39
sp|P57696|DHPS_NEIMC Dihydropteroate synthase OS=Neisseria meningitidis serogroup C GN=folP PE=3 SV=2 168 435 2.0E-39
sp|Q9JT70|DHPS_NEIMA Dihydropteroate synthase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=folP PE=3 SV=1 168 435 8.0E-39
sp|O84619|FOLKP_CHLTR Folate synthesis bifunctional protein OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=folKP PE=3 SV=1 1 420 1.0E-37
sp|Q9HS44|FOLCP_HALSA Probable bifunctional folylpolyglutamate synthase/dihydropteroate synthase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=folP PE=3 SV=1 167 424 1.0E-37
sp|P0C0X1|DHPS1_MYCLE Dihydropteroate synthase OS=Mycobacterium leprae (strain TN) GN=folP1 PE=1 SV=1 163 421 1.0E-36
sp|P0A579|DHPS1_MYCBO Dihydropteroate synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=folP1 PE=3 SV=1 169 421 1.0E-34
sp|P9WND1|DHPS1_MYCTU Dihydropteroate synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=folP1 PE=1 SV=1 169 421 1.0E-34
sp|P9WND0|DHPS1_MYCTO Dihydropteroate synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=folP1 PE=3 SV=1 169 421 1.0E-34
sp|D4GW05|FOLCP_HALVD Probable bifunctional folylpolyglutamate synthase/dihydropteroate synthase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=folCP PE=3 SV=1 169 435 2.0E-33
sp|Q9Z7E8|FOLKP_CHLPN Folate synthesis bifunctional protein OS=Chlamydia pneumoniae GN=folKP PE=3 SV=1 1 421 6.0E-33
sp|O25830|DHPRS_HELPY Bifunctional dihydropteroate synthase/dihydropteroate reductase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=folP PE=1 SV=1 160 424 3.0E-31
sp|P0C0X2|DHPS2_MYCLE Inactive dihydropteroate synthase 2 OS=Mycobacterium leprae (strain TN) GN=folP2 PE=3 SV=1 162 435 9.0E-29
sp|P05382|DHPS_STRPN Dihydropteroate synthase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=sulA PE=1 SV=2 160 435 2.0E-26
sp|P59655|DHPS_STRR6 Dihydropteroate synthase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=sulA PE=1 SV=1 160 435 2.0E-26
sp|P0AC12|DHP2_SHIFL Dihydropteroate synthase type-2 OS=Shigella flexneri GN=sulII PE=3 SV=1 171 421 8.0E-24
sp|P0AC11|DHP2_ECOLX Dihydropteroate synthase type-2 OS=Escherichia coli GN=sulII PE=3 SV=1 171 421 8.0E-24
sp|P29252|HPPK_BACSU 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase OS=Bacillus subtilis (strain 168) GN=folK PE=3 SV=2 1 132 6.0E-22
sp|P0C0G2|HPPK_STRPY 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase OS=Streptococcus pyogenes GN=folK PE=3 SV=1 1 141 7.0E-22
sp|P0C0G3|HPPK_STRP1 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase OS=Streptococcus pyogenes serotype M1 GN=folK PE=3 SV=1 1 141 7.0E-22
sp|P0C003|DHP1_PSEAI Dihydropteroate synthase type-1 OS=Pseudomonas aeruginosa GN=sulI PE=3 SV=1 171 437 7.0E-22
sp|P0C002|DHP1_ECOLX Dihydropteroate synthase type-1 OS=Escherichia coli GN=sulI PE=3 SV=1 171 437 7.0E-22
sp|P0C004|DHP1_CORGT Dihydropteroate synthase type-1 OS=Corynebacterium glutamicum GN=sulI PE=3 SV=1 171 437 7.0E-22
sp|Q49184|DHP1_MYCFO Dihydropteroate synthase type-1 OS=Mycobacterium fortuitum GN=sulI PE=3 SV=1 168 437 1.0E-21
sp|Q8P151|HPPK_STRP8 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=folK PE=3 SV=1 1 141 1.0E-21
sp|P0DB11|HPPK_STRPQ 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=folK PE=3 SV=1 1 141 5.0E-21
sp|P0DB10|HPPK_STRP3 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=folK PE=3 SV=1 1 141 5.0E-21
sp|Q5XCA6|HPPK_STRP6 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=folK PE=3 SV=1 1 141 8.0E-21
sp|P43777|HPPK_HAEIN 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=folK PE=1 SV=1 25 119 2.0E-20
sp|P9WNC9|DHPS2_MYCTU Inactive dihydropteroate synthase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=folP2 PE=1 SV=1 171 391 6.0E-20
sp|P9WNC8|DHPS2_MYCTO Inactive dihydropteroate synthase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=folP2 PE=3 SV=1 171 391 6.0E-20
sp|P64140|DHPS2_MYCBO Inactive dihydropteroate synthase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=folP2 PE=3 SV=1 171 391 6.0E-20
sp|Q8GJP4|FOLKE_LACLM Bifunctional protein FolKE OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=folKE PE=3 SV=1 1 122 8.0E-18
sp|P71512|HPPK_METEA 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase OS=Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) GN=folK PE=3 SV=2 1 121 9.0E-18
sp|O66550|HPPK_AQUAE 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase OS=Aquifex aeolicus (strain VF5) GN=folK PE=3 SV=1 1 122 1.0E-17
sp|P59657|SULD_STRR6 Bifunctional folate synthesis protein OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=sulD PE=1 SV=1 1 122 1.0E-17
sp|P22291|SULD_STRPN Bifunctional folate synthesis protein OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=sulD PE=1 SV=3 1 122 1.0E-17
sp|Q9HV71|HPPK_PSEAE 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=folK PE=3 SV=1 21 129 2.0E-16
sp|P72736|HPPK_SYNY3 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=folK PE=3 SV=1 19 121 9.0E-16
sp|P26281|HPPK_ECOLI 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase OS=Escherichia coli (strain K12) GN=folK PE=1 SV=3 26 122 1.0E-15
sp|Q54YD9|FOL1_DICDI Folic acid synthesis protein FOL1 OS=Dictyostelium discoideum GN=fol1 PE=3 SV=1 326 435 6.0E-15
sp|P0C936|HPPK_PORGI 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=folK PE=3 SV=1 1 130 3.0E-13
sp|B2RI92|HPPK_PORG3 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=folK PE=3 SV=2 1 130 3.0E-13
sp|Q9CGE3|FOLKE_LACLA Bifunctional protein FolKE OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=folKE PE=3 SV=1 1 120 7.0E-09
sp|Q9PJ54|HPPK_CAMJE 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=folK PE=3 SV=1 15 116 7.0E-08
sp|O87790|HPPK_PSEPU 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (Fragment) OS=Pseudomonas putida GN=folK PE=3 SV=1 63 103 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003848 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase activity Yes
GO:0009396 folic acid-containing compound biosynthetic process Yes
GO:0042558 pteridine-containing compound metabolic process Yes
GO:0008150 biological_process No
GO:0019752 carboxylic acid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0042559 pteridine-containing compound biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006732 coenzyme metabolic process No
GO:0043436 oxoacid metabolic process No
GO:0009108 coenzyme biosynthetic process No
GO:0008152 metabolic process No
GO:0046394 carboxylic acid biosynthetic process No
GO:0044283 small molecule biosynthetic process No
GO:0046483 heterocycle metabolic process No
GO:0006575 cellular modified amino acid metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0042398 cellular modified amino acid biosynthetic process No
GO:0016053 organic acid biosynthetic process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0006760 folic acid-containing compound metabolic process No
GO:0016778 diphosphotransferase activity No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0051186 cofactor metabolic process No
GO:0044281 small molecule metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0003824 catalytic activity No
GO:0044249 cellular biosynthetic process No
GO:0051188 cofactor biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009058 biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0006082 organic acid metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0043604 amide biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1121
MGDRVAEIEKACREMDRRGIRVKRTSSLWETEPMYVTDQDRFLNGACEIETELEPVALLDQLQQIERDLGRRKLV
DKGPRNIDLDILLYGDQKVDHPRLKVPHAGIPEREFVLRPLSQLIPSKALDASRPWKLVQDYLNELAPGEPLSSV
TPLAPLSSLLTPLAPSRKTHVMAILNLTPDSFSDGGRHSLSSLPGTVADMVRGGATIIDVGGQSTAPGRAQATAE
EEAARVVPAIELIRSLPEARDTVISVDTYRASVAERAVASGADVINDVSAGTLDPAMLPTAARLGATICLMHMRG
TPQTMMGLTAYPDGLLSTVASELLARVAAAERAGIRRWRIMLDPGIGFAKTGAQNLELLRRLDDLRRWPGLEGLP
WLVGTSRKAFVGKVTGAAQPADRIWGTAATVAAAVQGGADVVRVHDATEMSMVAAMSDAIWRC*
Coding >Hirsu2|1121
ATGGGTGATCGCGTGGCCGAGATCGAGAAGGCCTGTCGCGAGATGGATCGACGCGGCATTCGCGTCAAGCGCACC
AGCAGTCTGTGGGAGACGGAGCCCATGTACGTCACGGATCAGGACCGCTTTCTCAATGGCGCCTGCGAGATCGAG
ACCGAACTGGAACCGGTCGCGCTACTGGACCAGCTCCAGCAGATCGAGAGAGACTTGGGACGACGGAAGCTCGTC
GACAAGGGCCCGCGCAATATCGACCTGGATATCCTCCTCTACGGCGACCAAAAGGTCGACCACCCACGGCTCAAG
GTGCCGCATGCCGGCATTCCCGAGCGCGAGTTTGTCCTGAGGCCGCTCTCACAGTTGATCCCGTCAAAAGCGCTG
GATGCGTCCCGGCCGTGGAAGCTGGTGCAGGACTACCTAAACGAGCTTGCGCCAGGCGAGCCGCTGTCGTCGGTC
ACCCCGTTGGCCCCGCTGTCGTCTCTCCTCACGCCACTAGCACCGAGCCGCAAGACGCACGTCATGGCGATCCTG
AACCTCACGCCGGACTCCTTCTCTGACGGGGGTCGCCACAGCCTCAGCAGCCTGCCGGGCACGGTAGCCGACATG
GTGCGCGGCGGGGCCACCATCATCGACGTTGGAGGCCAGTCGACGGCGCCCGGCCGAGCCCAGGCGACGGCTGAG
GAGGAGGCGGCCCGCGTCGTGCCGGCCATTGAGCTCATCCGATCGCTTCCCGAGGCTCGGGACACGGTGATCAGC
GTGGACACGTACCGCGCCTCGGTCGCCGAGAGGGCCGTCGCCAGCGGGGCCGACGTGATCAACGATGTCTCGGCC
GGCACGCTCGACCCAGCCATGCTTCCGACGGCAGCCAGGCTGGGCGCGACCATCTGCCTGATGCACATGCGAGGC
ACGCCACAGACCATGATGGGCTTGACGGCGTACCCGGACGGGCTGCTGTCGACCGTGGCGTCGGAGCTGCTGGCA
CGCGTTGCTGCCGCCGAACGGGCGGGCATACGACGCTGGCGGATCATGCTCGACCCCGGCATCGGCTTCGCCAAG
ACGGGCGCGCAGAACCTGGAACTGCTGAGGAGGCTCGACGACCTCAGGCGCTGGCCGGGGCTCGAGGGCCTGCCG
TGGCTTGTGGGCACCAGCCGGAAGGCCTTTGTAGGCAAGGTTACGGGCGCAGCTCAGCCAGCTGACCGGATCTGG
GGCACGGCCGCGACTGTGGCGGCTGCGGTGCAGGGGGGAGCCGACGTGGTGCGGGTGCATGACGCCACGGAGATG
TCCATGGTGGCGGCCATGTCGGATGCCATCTGGAGATGTTGA
Transcript >Hirsu2|1121
ATGGGTGATCGCGTGGCCGAGATCGAGAAGGCCTGTCGCGAGATGGATCGACGCGGCATTCGCGTCAAGCGCACC
AGCAGTCTGTGGGAGACGGAGCCCATGTACGTCACGGATCAGGACCGCTTTCTCAATGGCGCCTGCGAGATCGAG
ACCGAACTGGAACCGGTCGCGCTACTGGACCAGCTCCAGCAGATCGAGAGAGACTTGGGACGACGGAAGCTCGTC
GACAAGGGCCCGCGCAATATCGACCTGGATATCCTCCTCTACGGCGACCAAAAGGTCGACCACCCACGGCTCAAG
GTGCCGCATGCCGGCATTCCCGAGCGCGAGTTTGTCCTGAGGCCGCTCTCACAGTTGATCCCGTCAAAAGCGCTG
GATGCGTCCCGGCCGTGGAAGCTGGTGCAGGACTACCTAAACGAGCTTGCGCCAGGCGAGCCGCTGTCGTCGGTC
ACCCCGTTGGCCCCGCTGTCGTCTCTCCTCACGCCACTAGCACCGAGCCGCAAGACGCACGTCATGGCGATCCTG
AACCTCACGCCGGACTCCTTCTCTGACGGGGGTCGCCACAGCCTCAGCAGCCTGCCGGGCACGGTAGCCGACATG
GTGCGCGGCGGGGCCACCATCATCGACGTTGGAGGCCAGTCGACGGCGCCCGGCCGAGCCCAGGCGACGGCTGAG
GAGGAGGCGGCCCGCGTCGTGCCGGCCATTGAGCTCATCCGATCGCTTCCCGAGGCTCGGGACACGGTGATCAGC
GTGGACACGTACCGCGCCTCGGTCGCCGAGAGGGCCGTCGCCAGCGGGGCCGACGTGATCAACGATGTCTCGGCC
GGCACGCTCGACCCAGCCATGCTTCCGACGGCAGCCAGGCTGGGCGCGACCATCTGCCTGATGCACATGCGAGGC
ACGCCACAGACCATGATGGGCTTGACGGCGTACCCGGACGGGCTGCTGTCGACCGTGGCGTCGGAGCTGCTGGCA
CGCGTTGCTGCCGCCGAACGGGCGGGCATACGACGCTGGCGGATCATGCTCGACCCCGGCATCGGCTTCGCCAAG
ACGGGCGCGCAGAACCTGGAACTGCTGAGGAGGCTCGACGACCTCAGGCGCTGGCCGGGGCTCGAGGGCCTGCCG
TGGCTTGTGGGCACCAGCCGGAAGGCCTTTGTAGGCAAGGTTACGGGCGCAGCTCAGCCAGCTGACCGGATCTGG
GGCACGGCCGCGACTGTGGCGGCTGCGGTGCAGGGGGGAGCCGACGTGGTGCGGGTGCATGACGCCACGGAGATG
TCCATGGTGGCGGCCATGTCGGATGCCATCTGGAGATGTTGA
Gene >Hirsu2|1121
ATGGGTGATCGCGTGGCCGAGATCGAGAAGGCCTGTCGCGAGATGGATCGACGCGGCATTCGCGTCAAGCGCACC
AGCAGTCTGTGGGAGACGGAGCCCATGTACGTCACGGATCAGGACCGCTTTCTCAATGGCGCCTGCGAGGTCAGT
CTCCGCGCATCATCACCGCCGCCACCATCACAATGGTCTTGATATGTACGTTGTATCATCATCTTCGAGGAACGG
GAAGGAGAAGAATAGGGCGGAGGAAAGGGTGAAGAGGGAAAAGAGTCAAACCAGAGACTTGCCAGTTGGCCAGCC
GCTTACGCTCTGTCTCGGCCCTGCCCCGGCTGCCTTCCGTCCCGCAGATCGAGACCGAACTGGAACCGGTCGCGC
TACTGGACCAGCTCCAGCAGATCGAGAGAGACTTGGGACGACGGAAGCTCGTCGACAAGGGCCCGCGCAATATCG
ACCTGGATATCCTCCTCTACGGCGACCAAAAGGTCGACCACCCACGGCTCAAGGTGCCGCATGCCGGCATTCCCG
AGCGCGAGTTTGTCCTGAGGCCGCTCTCACAGTCGGTGCCCGAATCTTCTCTCTCCTCTTCCCTCCCTGGCGTCC
GGTGTGGCTCACTCGCGCAGGTTGATCCCGTCAAAAGCGCTGGATGCGTCCCGGCCGTGGAAGCTGGTGCAGGAC
TACCTAAACGAGCTTGCGCCAGGCGAGCCGCTGTCGTCGGTCACCCCGTTGGCCCCGCTGTCGTCTCTCCTCACG
CCACTAGCACCGAGCCGCAAGACGCACGTCATGGCGATCCTGAACCTCACGCCGGACTCCTTCTCTGACGGGGGT
CGCCACAGCCTCAGCAGCCTGCCGGGCACGGTAGCCGACATGGTGCGCGGCGGGGCCACCATCATCGACGTTGGA
GGCCAGTCGACGGCGCCCGGCCGAGCCCAGGCGACGGCTGAGGAGGAGGCGGCCCGCGTCGTGCCGGCCATTGAG
CTCATCCGATCGCTTCCCGAGGCTCGGGACACGGTGATCAGCGTGGACACGTACCGCGCCTCGGTCGCCGAGAGG
GCCGTCGCCAGCGGGGCCGACGTGATCAACGATGTCTCGGCCGGCACGCTCGACCCAGCCATGCTTCCGACGGCA
GCCAGGCTGGGCGCGACCATCTGCCTGATGCACATGCGAGGCACGCCACAGACCATGATGGGCTTGACGGCGTAC
CCGGACGGGCTGCTGTCGACCGTGGCGTCGGAGCTGCTGGCACGCGTTGCTGCCGCCGAACGGGCGGGCATACGA
CGCTGGCGGATCATGCTCGACCCCGGCATCGGCTTCGCCAAGACGGGCGCGCAGAACCTGGAACTGCTGAGGAGG
CTCGACGACCTCAGGCGCTGGCCGGGGCTCGAGGGCCTGCCGTGGCTTGTGGGCACCAGCCGGAAGGCCTTTGTA
GGCAAGGTTACGGGCGCAGCTCAGCCAGCTGACCGGATCTGGGGCACGGCCGCGACTGTGGCGGCTGCGGTGCAG
GGGGGAGCCGACGTGGTGCGGGTGCATGACGCCACGGAGATGTCCATGGTGGCGGCCATGTCGGATGCCATCTGG
AGATGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail