Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11208
Gene name
LocationContig_986:1902..4260
Strand-
Gene length (bp)2358
Transcript length (bp)2277
Coding sequence length (bp)2277
Protein length (aa) 759

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 2.7E-148 58 715

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 37 758 0.0E+00
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 35 758 1.0E-170
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 38 758 7.0E-141
sp|O04514|OPT2_ARATH Oligopeptide transporter 2 OS=Arabidopsis thaliana GN=OPT2 PE=2 SV=2 27 728 5.0E-134
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 37 750 3.0E-130
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40900|ISP4_SCHPO Sexual differentiation process protein isp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isp4 PE=2 SV=2 37 758 0.0E+00
sp|O14031|PGT1_SCHPO Glutathione transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgt1 PE=1 SV=1 35 758 1.0E-170
sp|P40897|OPT1_YEAST Oligopeptide transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT1 PE=1 SV=1 38 758 7.0E-141
sp|O04514|OPT2_ARATH Oligopeptide transporter 2 OS=Arabidopsis thaliana GN=OPT2 PE=2 SV=2 27 728 5.0E-134
sp|Q9SUA4|OPT5_ARATH Oligopeptide transporter 5 OS=Arabidopsis thaliana GN=OPT5 PE=2 SV=1 37 750 3.0E-130
sp|Q9FG72|OPT1_ARATH Oligopeptide transporter 1 OS=Arabidopsis thaliana GN=OPT1 PE=2 SV=1 37 728 5.0E-130
sp|O23482|OPT3_ARATH Oligopeptide transporter 3 OS=Arabidopsis thaliana GN=OPT3 PE=2 SV=3 37 729 8.0E-124
sp|Q9FME8|OPT4_ARATH Oligopeptide transporter 4 OS=Arabidopsis thaliana GN=OPT4 PE=1 SV=1 31 729 5.0E-122
sp|Q9FJD1|OPT8_ARATH Oligopeptide transporter 8 OS=Arabidopsis thaliana GN=OPT8 PE=2 SV=1 24 730 7.0E-120
sp|O82485|OPT7_ARATH Oligopeptide transporter 7 OS=Arabidopsis thaliana GN=OPT7 PE=2 SV=1 39 729 3.0E-119
sp|Q9T095|OPT6_ARATH Oligopeptide transporter 6 OS=Arabidopsis thaliana GN=OPT6 PE=2 SV=1 27 747 3.0E-117
sp|Q9FJD2|OPT9_ARATH Oligopeptide transporter 9 OS=Arabidopsis thaliana GN=OPT9 PE=2 SV=1 42 740 1.0E-111
sp|Q7LL00|YQJC_SCHPO Uncharacterized oligopeptide transporter C1840.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1840.12 PE=3 SV=2 32 745 4.0E-104
sp|Q06593|OPT2_YEAST Oligopeptide transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPT2 PE=1 SV=1 6 738 1.0E-90
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 59 81 22
2 86 105 19
3 135 157 22
4 167 189 22
5 245 267 22
6 277 299 22
7 312 334 22
8 387 409 22
9 442 459 17
10 463 480 17
11 485 507 22
12 511 533 22
13 619 636 17
14 656 678 22
15 699 721 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11208
MGLTTWERLTTVKPRLPGLGRSWDAWDPDDDPPGAGEDSPYEEVRAAVRNTDGGEMANTLRAWILGLFFVTLGSG
LHMFLGLRSPVINLSGIVVQLLAYPIGRLWAKVVPRHVFRWGSVEWSFNRGPFTIKEHVVVTLMTNITIGGAYST
DALVALIGKPFYNHDPGWGFALGLTLTTQLMGIGLTGLFRRVLVWPAAMTWPRQFASTALFYALHDGGGPARLPL
RPGWSISRYRWFAAVAGAMFCYHWLPAVLFRGLSVFAFVTWVRPASPVLNQLFGGFSGLSLLPITFDWTYVSAFL
GNPLLAPTHAHVNTLVGLVIFIIITTAGIVYSGALYSQYLPMVTAQTYDNTQSYYNVSRVLVRDPYGNPLFSEKK
YADYSPVFLPPALALNYGLSFAALTSAFVHIWINHGRDIWLRLRTGRKQKADVHLKLMRRYDEFSDLGYFLLFAG
PFGVAWSLCQDRLPLWAFPISIILAVVFIIPVTMVLAVSNIVLGLNVLSPFIAGFIIPGKPFGVMMFNVFSTVLL
LQAQTYSGDLKLAHYMKIPPRLTLSCQLVATFWSSVVQVAVMYWTLGHVDGICENTQPNNFTCPNGRAFFSSNVI
WGIIGPSRMFGARGMYTQLNLFWVVGAALPVLLYVLTKVFKIRFFSHLQAPVILGAMAWLPPGTPLSYSTWAIVG
LVFNYGIRRRFKSWWMAFNFTTAAALDCGLVLCTIVVFLAITLPGIKGPQWWGNTTVFQTLDATNRATLKTVAEG
ETFGPKEW*
Coding >Hirsu2|11208
ATGGGACTGACGACCTGGGAGAGGCTGACGACCGTGAAGCCACGGTTACCCGGCCTTGGTCGAAGCTGGGACGCC
TGGGACCCGGACGATGACCCGCCCGGCGCCGGCGAGGACTCGCCGTACGAGGAGGTGCGGGCGGCGGTGCGCAAC
ACGGACGGGGGCGAGATGGCCAACACGCTGCGGGCCTGGATCCTTGGCCTGTTCTTCGTCACTCTCGGCTCCGGC
CTGCACATGTTTCTCGGCTTGAGGAGCCCGGTCATCAACCTCTCCGGCATCGTCGTCCAGCTGCTGGCCTACCCC
ATCGGCCGGCTCTGGGCCAAGGTGGTCCCCCGGCACGTCTTCCGCTGGGGCTCGGTCGAATGGAGCTTCAACCGC
GGGCCCTTCACCATCAAGGAGCACGTGGTGGTGACTCTGATGACCAACATCACCATCGGCGGCGCCTACAGCACC
GACGCCCTCGTCGCCCTGATCGGCAAGCCCTTCTACAACCACGACCCGGGCTGGGGCTTCGCCTTGGGCCTGACC
CTGACGACGCAGCTGATGGGCATCGGCCTGACCGGCCTCTTCCGCCGCGTGCTCGTCTGGCCGGCCGCCATGACC
TGGCCGCGCCAGTTCGCCAGCACCGCCCTCTTCTACGCGCTGCACGACGGCGGCGGCCCGGCCCGCCTCCCGCTC
CGGCCCGGCTGGTCCATCAGCCGCTACCGCTGGTTCGCGGCCGTGGCCGGCGCCATGTTCTGCTACCACTGGCTG
CCGGCCGTCCTCTTCCGCGGCCTCTCCGTCTTCGCCTTCGTCACCTGGGTCCGGCCCGCCAGCCCCGTCCTCAAC
CAGCTCTTCGGCGGCTTCTCCGGCCTCTCCCTGCTGCCCATCACCTTCGACTGGACCTACGTCTCGGCCTTCCTC
GGCAACCCGCTGCTGGCGCCGACGCACGCCCACGTCAACACCCTGGTCGGCCTCGTCATCTTCATCATCATCACC
ACCGCTGGCATTGTCTACTCCGGCGCCCTGTACTCCCAATATCTGCCCATGGTGACGGCCCAGACGTACGACAAC
ACCCAGTCCTACTACAACGTCTCCCGGGTCCTCGTCCGGGACCCCTACGGCAACCCGCTCTTCAGCGAGAAGAAA
TACGCCGACTACTCGCCTGTCTTCCTCCCGCCTGCCCTCGCCCTCAACTACGGCCTCTCCTTCGCAGCCCTGACC
TCGGCCTTCGTCCACATCTGGATCAATCACGGGCGCGACATCTGGCTCCGCCTCCGCACCGGCCGCAAACAGAAA
GCAGACGTCCACCTGAAGTTGATGCGCCGCTACGACGAGTTCTCCGATCTAGGCTACTTCTTGCTTTTCGCAGGC
CCCTTCGGCGTCGCCTGGTCACTCTGTCAGGACCGCCTCCCGTTATGGGCGTTCCCCATCTCCATCATCCTTGCC
GTCGTCTTCATCATCCCCGTCACCATGGTCCTGGCCGTCTCCAACATCGTGCTCGGCCTCAACGTCCTCTCGCCC
TTCATCGCCGGCTTCATCATTCCGGGCAAGCCCTTCGGCGTCATGATGTTCAACGTCTTCAGCACTGTTCTCCTC
CTGCAGGCCCAGACCTACAGCGGCGACCTCAAGCTGGCCCACTACATGAAGATCCCGCCCAGGCTTACCCTCTCC
TGCCAGCTTGTCGCCACTTTTTGGTCCAGTGTCGTCCAGGTGGCCGTCATGTACTGGACCCTGGGCCACGTCGAC
GGCATCTGCGAGAACACGCAGCCCAACAACTTCACCTGCCCCAATGGCCGGGCCTTTTTCTCCTCCAACGTCATT
TGGGGCATCATCGGCCCGAGCCGCATGTTCGGCGCCCGCGGCATGTACACCCAGCTCAATCTCTTCTGGGTCGTC
GGCGCCGCCCTGCCCGTACTGCTCTACGTCCTCACCAAGGTCTTCAAGATCCGCTTCTTCAGCCACTTACAGGCC
CCCGTCATCCTCGGCGCCATGGCTTGGCTGCCTCCCGGCACGCCCCTTAGCTACTCGACCTGGGCCATCGTCGGC
CTCGTCTTTAACTACGGGATCCGCCGCAGATTCAAGTCCTGGTGGATGGCTTTCAACTTCACCACCGCCGCCGCC
CTCGACTGTGGCCTCGTCCTATGCACCATTGTCGTCTTCCTCGCCATCACTTTGCCGGGGATCAAGGGTCCGCAG
TGGTGGGGGAACACGACTGTGTTCCAGACGCTCGATGCCACGAATCGCGCAACGCTGAAGACGGTGGCTGAGGGA
GAGACCTTTGGACCGAAGGAATGGTAG
Transcript >Hirsu2|11208
ATGGGACTGACGACCTGGGAGAGGCTGACGACCGTGAAGCCACGGTTACCCGGCCTTGGTCGAAGCTGGGACGCC
TGGGACCCGGACGATGACCCGCCCGGCGCCGGCGAGGACTCGCCGTACGAGGAGGTGCGGGCGGCGGTGCGCAAC
ACGGACGGGGGCGAGATGGCCAACACGCTGCGGGCCTGGATCCTTGGCCTGTTCTTCGTCACTCTCGGCTCCGGC
CTGCACATGTTTCTCGGCTTGAGGAGCCCGGTCATCAACCTCTCCGGCATCGTCGTCCAGCTGCTGGCCTACCCC
ATCGGCCGGCTCTGGGCCAAGGTGGTCCCCCGGCACGTCTTCCGCTGGGGCTCGGTCGAATGGAGCTTCAACCGC
GGGCCCTTCACCATCAAGGAGCACGTGGTGGTGACTCTGATGACCAACATCACCATCGGCGGCGCCTACAGCACC
GACGCCCTCGTCGCCCTGATCGGCAAGCCCTTCTACAACCACGACCCGGGCTGGGGCTTCGCCTTGGGCCTGACC
CTGACGACGCAGCTGATGGGCATCGGCCTGACCGGCCTCTTCCGCCGCGTGCTCGTCTGGCCGGCCGCCATGACC
TGGCCGCGCCAGTTCGCCAGCACCGCCCTCTTCTACGCGCTGCACGACGGCGGCGGCCCGGCCCGCCTCCCGCTC
CGGCCCGGCTGGTCCATCAGCCGCTACCGCTGGTTCGCGGCCGTGGCCGGCGCCATGTTCTGCTACCACTGGCTG
CCGGCCGTCCTCTTCCGCGGCCTCTCCGTCTTCGCCTTCGTCACCTGGGTCCGGCCCGCCAGCCCCGTCCTCAAC
CAGCTCTTCGGCGGCTTCTCCGGCCTCTCCCTGCTGCCCATCACCTTCGACTGGACCTACGTCTCGGCCTTCCTC
GGCAACCCGCTGCTGGCGCCGACGCACGCCCACGTCAACACCCTGGTCGGCCTCGTCATCTTCATCATCATCACC
ACCGCTGGCATTGTCTACTCCGGCGCCCTGTACTCCCAATATCTGCCCATGGTGACGGCCCAGACGTACGACAAC
ACCCAGTCCTACTACAACGTCTCCCGGGTCCTCGTCCGGGACCCCTACGGCAACCCGCTCTTCAGCGAGAAGAAA
TACGCCGACTACTCGCCTGTCTTCCTCCCGCCTGCCCTCGCCCTCAACTACGGCCTCTCCTTCGCAGCCCTGACC
TCGGCCTTCGTCCACATCTGGATCAATCACGGGCGCGACATCTGGCTCCGCCTCCGCACCGGCCGCAAACAGAAA
GCAGACGTCCACCTGAAGTTGATGCGCCGCTACGACGAGTTCTCCGATCTAGGCTACTTCTTGCTTTTCGCAGGC
CCCTTCGGCGTCGCCTGGTCACTCTGTCAGGACCGCCTCCCGTTATGGGCGTTCCCCATCTCCATCATCCTTGCC
GTCGTCTTCATCATCCCCGTCACCATGGTCCTGGCCGTCTCCAACATCGTGCTCGGCCTCAACGTCCTCTCGCCC
TTCATCGCCGGCTTCATCATTCCGGGCAAGCCCTTCGGCGTCATGATGTTCAACGTCTTCAGCACTGTTCTCCTC
CTGCAGGCCCAGACCTACAGCGGCGACCTCAAGCTGGCCCACTACATGAAGATCCCGCCCAGGCTTACCCTCTCC
TGCCAGCTTGTCGCCACTTTTTGGTCCAGTGTCGTCCAGGTGGCCGTCATGTACTGGACCCTGGGCCACGTCGAC
GGCATCTGCGAGAACACGCAGCCCAACAACTTCACCTGCCCCAATGGCCGGGCCTTTTTCTCCTCCAACGTCATT
TGGGGCATCATCGGCCCGAGCCGCATGTTCGGCGCCCGCGGCATGTACACCCAGCTCAATCTCTTCTGGGTCGTC
GGCGCCGCCCTGCCCGTACTGCTCTACGTCCTCACCAAGGTCTTCAAGATCCGCTTCTTCAGCCACTTACAGGCC
CCCGTCATCCTCGGCGCCATGGCTTGGCTGCCTCCCGGCACGCCCCTTAGCTACTCGACCTGGGCCATCGTCGGC
CTCGTCTTTAACTACGGGATCCGCCGCAGATTCAAGTCCTGGTGGATGGCTTTCAACTTCACCACCGCCGCCGCC
CTCGACTGTGGCCTCGTCCTATGCACCATTGTCGTCTTCCTCGCCATCACTTTGCCGGGGATCAAGGGTCCGCAG
TGGTGGGGGAACACGACTGTGTTCCAGACGCTCGATGCCACGAATCGCGCAACGCTGAAGACGGTGGCTGAGGGA
GAGACCTTTGGACCGAAGGAATGGTAG
Gene >Hirsu2|11208
ATGGGACTGACGACCTGGGAGAGGCTGACGACCGTGAAGCCACGGTTACCCGGCCTTGGTCGAAGCTGGGACGCC
TGGGACCCGGACGATGACCCGCCCGGCGCCGGCGAGGACTCGCCGTACGAGGAGGTGCGGGCGGCGGTGCGCAAC
ACGGACGGGGGCGAGATGGCCAACACGCTGCGGGCCTGGATCCTTGGCCTGTTCTTCGTCACTCTCGGCTCCGGC
CTGCACATGTTTCTCGGCTTGAGGTGAGTTCGCGCGACAGGGGAAGAGGTGATATGAGATTGGTTTGAGTGAGGC
AGGGCGGAGGCTCACGTTCTCGAGCGCAGGAGCCCGGTCATCAACCTCTCCGGCATCGTCGTCCAGCTGCTGGCC
TACCCCATCGGCCGGCTCTGGGCCAAGGTGGTCCCCCGGCACGTCTTCCGCTGGGGCTCGGTCGAATGGAGCTTC
AACCGCGGGCCCTTCACCATCAAGGAGCACGTGGTGGTGACTCTGATGACCAACATCACCATCGGCGGCGCCTAC
AGCACCGACGCCCTCGTCGCCCTGATCGGCAAGCCCTTCTACAACCACGACCCGGGCTGGGGCTTCGCCTTGGGC
CTGACCCTGACGACGCAGCTGATGGGCATCGGCCTGACCGGCCTCTTCCGCCGCGTGCTCGTCTGGCCGGCCGCC
ATGACCTGGCCGCGCCAGTTCGCCAGCACCGCCCTCTTCTACGCGCTGCACGACGGCGGCGGCCCGGCCCGCCTC
CCGCTCCGGCCCGGCTGGTCCATCAGCCGCTACCGCTGGTTCGCGGCCGTGGCCGGCGCCATGTTCTGCTACCAC
TGGCTGCCGGCCGTCCTCTTCCGCGGCCTCTCCGTCTTCGCCTTCGTCACCTGGGTCCGGCCCGCCAGCCCCGTC
CTCAACCAGCTCTTCGGCGGCTTCTCCGGCCTCTCCCTGCTGCCCATCACCTTCGACTGGACCTACGTCTCGGCC
TTCCTCGGCAACCCGCTGCTGGCGCCGACGCACGCCCACGTCAACACCCTGGTCGGCCTCGTCATCTTCATCATC
ATCACCACCGCTGGCATTGTCTACTCCGGCGCCCTGTACTCCCAATATCTGCCCATGGTGACGGCCCAGACGTAC
GACAACACCCAGTCCTACTACAACGTCTCCCGGGTCCTCGTCCGGGACCCCTACGGCAACCCGCTCTTCAGCGAG
AAGAAATACGCCGACTACTCGCCTGTCTTCCTCCCGCCTGCCCTCGCCCTCAACTACGGCCTCTCCTTCGCAGCC
CTGACCTCGGCCTTCGTCCACATCTGGATCAATCACGGGCGCGACATCTGGCTCCGCCTCCGCACCGGCCGCAAA
CAGAAAGCAGACGTCCACCTGAAGTTGATGCGCCGCTACGACGAGTTCTCCGATCTAGGCTACTTCTTGCTTTTC
GCAGGCCCCTTCGGCGTCGCCTGGTCACTCTGTCAGGACCGCCTCCCGTTATGGGCGTTCCCCATCTCCATCATC
CTTGCCGTCGTCTTCATCATCCCCGTCACCATGGTCCTGGCCGTCTCCAACATCGTGCTCGGCCTCAACGTCCTC
TCGCCCTTCATCGCCGGCTTCATCATTCCGGGCAAGCCCTTCGGCGTCATGATGTTCAACGTCTTCAGCACTGTT
CTCCTCCTGCAGGCCCAGACCTACAGCGGCGACCTCAAGCTGGCCCACTACATGAAGATCCCGCCCAGGCTTACC
CTCTCCTGCCAGCTTGTCGCCACTTTTTGGTCCAGTGTCGTCCAGGTGGCCGTCATGTACTGGACCCTGGGCCAC
GTCGACGGCATCTGCGAGAACACGCAGCCCAACAACTTCACCTGCCCCAATGGCCGGGCCTTTTTCTCCTCCAAC
GTCATTTGGGGCATCATCGGCCCGAGCCGCATGTTCGGCGCCCGCGGCATGTACACCCAGCTCAATCTCTTCTGG
GTCGTCGGCGCCGCCCTGCCCGTACTGCTCTACGTCCTCACCAAGGTCTTCAAGATCCGCTTCTTCAGCCACTTA
CAGGCCCCCGTCATCCTCGGCGCCATGGCTTGGCTGCCTCCCGGCACGCCCCTTAGCTACTCGACCTGGGCCATC
GTCGGCCTCGTCTTTAACTACGGGATCCGCCGCAGATTCAAGTCCTGGTGGATGGCTTTCAACTTCACCACCGCC
GCCGCCCTCGACTGTGGCCTCGTCCTATGCACCATTGTCGTCTTCCTCGCCATCACTTTGCCGGGGATCAAGGGT
CCGCAGTGGTGGGGGAACACGACTGTGTTCCAGACGCTCGATGCCACGAATCGCGCAACGCTGAAGACGGTGGCT
GAGGGAGAGACCTTTGGACCGAAGGAATGGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail