Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11203
Gene name
LocationContig_985:335..1722
Strand-
Gene length (bp)1387
Transcript length (bp)1125
Coding sequence length (bp)1125
Protein length (aa) 375

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08216 CTNNBL Catenin-beta-like, Arm-motif containing nuclear 5.4E-35 103 206

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9UUK1|CTBL1_SCHPO Beta-catenin-like protein 1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ctnnbl1 PE=1 SV=1 90 373 1.0E-62
sp|Q8WYA6|CTBL1_HUMAN Beta-catenin-like protein 1 OS=Homo sapiens GN=CTNNBL1 PE=1 SV=1 121 366 2.0E-46
sp|Q4V8K2|CTBL1_RAT Beta-catenin-like protein 1 OS=Rattus norvegicus GN=Ctnnbl1 PE=1 SV=1 121 366 7.0E-46
sp|Q9CWL8|CTBL1_MOUSE Beta-catenin-like protein 1 OS=Mus musculus GN=Ctnnbl1 PE=1 SV=1 121 366 2.0E-45
sp|O62703|CTBL1_BOVIN Beta-catenin-like protein 1 OS=Bos taurus GN=CTNNBL1 PE=2 SV=3 121 366 1.0E-44

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11203
MASIDDIFKNVGVPSKRKLEAIKDPNEIYKSSKLSSSNGSSRHGSDPDGGDVAHGDDDDDLEAGPAMPPPPPPPG
QDGPEEPDVGDDDEGRFFGGGITKQESEVLDFVEGAGEAAQGPEKIDLGWLRKTAQNLERRIAKNAELRAKFESE
PAKFIGSEADLDADIKALSILSEHPALYPDFAELGGAGQLVGLLAHDNTDIAIDAIEIIGELTDEDVAAEDEQWN
GLVDALLDADLVGLLVSNFARLDEEDEADRNGVYYALGVVENLCSRPATAARMGREDGLLTWLLRRIQRKEARVS
QNKQYAAEVLAILSQSSAEGRGRIVGLDAVDAMLQLVARYRKGDPDKGGEEEEYMEDLFEALTCLVDEPAGKAK*
Coding >Hirsu2|11203
ATGGCCAGCATCGACGACATTTTCAAGAACGTCGGCGTGCCCAGCAAGCGGAAGCTGGAGGCCATCAAAGACCCG
AACGAGATATACAAGTCCAGCAAGCTCAGCAGCAGCAACGGCTCGAGCCGCCACGGATCCGATCCGGATGGCGGC
GACGTGGCCCACGGCGACGACGATGACGACCTCGAAGCCGGCCCGGCGATGCCGCCGCCGCCGCCGCCGCCGGGG
CAAGACGGCCCGGAAGAGCCCGATGTAGGCGACGACGACGAGGGCCGCTTCTTCGGCGGCGGCATCACCAAGCAG
GAGTCCGAGGTGCTCGACTTCGTAGAGGGCGCCGGCGAGGCGGCCCAGGGCCCCGAAAAGATCGACCTGGGCTGG
CTGCGCAAGACGGCACAGAACCTGGAAAGGCGCATCGCCAAGAACGCCGAGCTGCGGGCCAAGTTCGAGAGTGAG
CCGGCCAAGTTCATCGGCAGCGAGGCCGACCTCGACGCCGACATCAAGGCCCTGTCCATCCTGTCGGAGCACCCC
GCGCTCTACCCGGACTTCGCCGAGCTCGGCGGCGCCGGCCAGCTGGTCGGCCTGCTGGCCCACGACAACACGGAC
ATCGCCATCGACGCCATCGAGATCATCGGCGAGCTGACGGACGAGGACGTGGCCGCCGAAGACGAGCAGTGGAAC
GGCCTGGTCGACGCCCTGCTGGACGCCGACCTTGTCGGCCTGCTCGTCTCCAACTTTGCCCGCCTGGACGAGGAG
GACGAGGCGGACCGGAACGGCGTCTACTACGCGCTCGGCGTCGTCGAGAACCTGTGCTCGCGGCCGGCCACGGCG
GCGCGCATGGGCCGCGAGGACGGCCTGCTGACCTGGCTGCTGCGGCGCATCCAGCGCAAGGAGGCGCGCGTGTCG
CAGAACAAGCAGTACGCGGCCGAGGTGCTGGCCATCCTGTCGCAGTCGTCGGCCGAGGGCCGCGGCCGCATCGTC
GGCCTCGACGCCGTCGACGCCATGCTGCAGCTGGTGGCGCGCTACCGCAAGGGCGACCCGGACAAGGGCGGCGAG
GAGGAGGAGTACATGGAGGACCTGTTCGAGGCCCTGACCTGCCTCGTCGACGAGCCGGCCGGCAAGGCCAAATGA
Transcript >Hirsu2|11203
ATGGCCAGCATCGACGACATTTTCAAGAACGTCGGCGTGCCCAGCAAGCGGAAGCTGGAGGCCATCAAAGACCCG
AACGAGATATACAAGTCCAGCAAGCTCAGCAGCAGCAACGGCTCGAGCCGCCACGGATCCGATCCGGATGGCGGC
GACGTGGCCCACGGCGACGACGATGACGACCTCGAAGCCGGCCCGGCGATGCCGCCGCCGCCGCCGCCGCCGGGG
CAAGACGGCCCGGAAGAGCCCGATGTAGGCGACGACGACGAGGGCCGCTTCTTCGGCGGCGGCATCACCAAGCAG
GAGTCCGAGGTGCTCGACTTCGTAGAGGGCGCCGGCGAGGCGGCCCAGGGCCCCGAAAAGATCGACCTGGGCTGG
CTGCGCAAGACGGCACAGAACCTGGAAAGGCGCATCGCCAAGAACGCCGAGCTGCGGGCCAAGTTCGAGAGTGAG
CCGGCCAAGTTCATCGGCAGCGAGGCCGACCTCGACGCCGACATCAAGGCCCTGTCCATCCTGTCGGAGCACCCC
GCGCTCTACCCGGACTTCGCCGAGCTCGGCGGCGCCGGCCAGCTGGTCGGCCTGCTGGCCCACGACAACACGGAC
ATCGCCATCGACGCCATCGAGATCATCGGCGAGCTGACGGACGAGGACGTGGCCGCCGAAGACGAGCAGTGGAAC
GGCCTGGTCGACGCCCTGCTGGACGCCGACCTTGTCGGCCTGCTCGTCTCCAACTTTGCCCGCCTGGACGAGGAG
GACGAGGCGGACCGGAACGGCGTCTACTACGCGCTCGGCGTCGTCGAGAACCTGTGCTCGCGGCCGGCCACGGCG
GCGCGCATGGGCCGCGAGGACGGCCTGCTGACCTGGCTGCTGCGGCGCATCCAGCGCAAGGAGGCGCGCGTGTCG
CAGAACAAGCAGTACGCGGCCGAGGTGCTGGCCATCCTGTCGCAGTCGTCGGCCGAGGGCCGCGGCCGCATCGTC
GGCCTCGACGCCGTCGACGCCATGCTGCAGCTGGTGGCGCGCTACCGCAAGGGCGACCCGGACAAGGGCGGCGAG
GAGGAGGAGTACATGGAGGACCTGTTCGAGGCCCTGACCTGCCTCGTCGACGAGCCGGCCGGCAAGGCCAAATGA
Gene >Hirsu2|11203
ATGGCCAGCATCGACGACATTTTCAAGGTCCGTCCCGAGCCGGACCATCCTCCGGGCCTCGGCACCGCCCGGATC
GTGCTGACGCCACGTAGAACGTCGGCGTGCCCAGCAAGCGGAAGCTGGAGGCCATCAAAGACCCGAGTCCGTTGC
CTCGTCCCGTCTTGTTCATCTGCCCGTCCCTTCACGCTGGCCGCCGTTCCGACGCGGCGCGGGGAGGCCCCATCT
CAATCCGTTTCCNNNNNNNNNNCCCCCCCCCCCCCCCTCTGCTGACCCTTCTTCGCAGACGAGATATACAAGTCC
AGCAAGCTCAGCAGCAGCAACGGCTCGAGCCGCCACGGATCCGATCCGGATGGCGGCGACGTGGCCCACGGCGAC
GACGATGACGACCTCGAAGCCGGCCCGGCGATGCCGCCGCCGCCGCCGCCGCCGGGGCAAGACGGCCCGGAAGAG
CCCGATGTAGGCGACGACGACGAGGGCCGCTTCTTCGGCGGCGGCATCACCAAGCAGGAGTCCGAGGTGCTCGAC
TTCGTAGAGGGCGCCGGCGAGGCGGCCCAGGGCCCCGAAAAGATCGACCTGGGCTGGCTGCGCAAGACGGCACAG
AACCTGGAAAGGCGCATCGCCAAGAACGCCGAGCTGCGGGCCAAGTTCGAGAGTGAGCCGGCCAAGTTCATCGGC
AGCGAGGCCGACCTCGACGCCGACATCAAGGCCCTGTCCATCCTGTCGGAGCACCCCGCGCTCTACCCGGACTTC
GCCGAGCTCGGCGGCGCCGGCCAGCTGGTCGGCCTGCTGGCCCACGACAACACGGACATCGCCATCGACGCCATC
GAGATCATCGGCGAGCTGACGGACGAGGACGTGGCCGCCGAAGACGAGCAGTGGAACGGCCTGGTCGACGCCCTG
CTGGACGCCGACCTTGTCGGCCTGCTCGTCTCCAACTTTGCCCGCCTGGACGAGGAGGACGAGGCGGACCGGAAC
GGCGTCTACTACGCGCTCGGCGTCGTCGAGAACCTGTGCTCGCGGCCGGCCACGGCGGCGCGCATGGGCCGCGAG
GACGGCCTGCTGACCTGGCTGCTGCGGCGCATCCAGCGCAAGGAGGCGCGCGTGTCGCAGAACAAGCAGTACGCG
GCCGAGGTGCTGGCCATCCTGTCGCAGTCGTCGGCCGAGGGCCGCGGCCGCATCGTCGGCCTCGACGCCGTCGAC
GCCATGCTGCAGCTGGTGGCGCGCTACCGCAAGGGCGACCCGGACAAGGGCGGCGAGGAGGAGGAGTACATGGAG
GACCTGTTCGAGGCCCTGACCTGCCTCGTCGACGAGCCGGCCGGCAAGGCCAAGTTCCTCGAGGCCGAGGGCGTC
GAGCTGTGCCTCATCATGCTCCGGGACGGCAAGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail