Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11202
Gene name
LocationContig_984:6221..9333
Strand+
Gene length (bp)3112
Transcript length (bp)2952
Coding sequence length (bp)2952
Protein length (aa) 984

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01504 PIP5K Phosphatidylinositol-4-phosphate 5-Kinase 1.7E-102 445 763

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13853|ITS3_SCHPO Phosphatidylinositol 4-phosphate 5-kinase its3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=its3 PE=1 SV=3 314 762 0.0E+00
sp|P38994|MSS4_YEAST Probable phosphatidylinositol 4-phosphate 5-kinase MSS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSS4 PE=1 SV=2 324 762 5.0E-135
sp|Q55GN6|Y7588_DICDI Probable phosphatidylinositol phosphate kinase DDB_G0267588 OS=Dictyostelium discoideum GN=DDB_G0267588 PE=1 SV=1 271 616 3.0E-61
sp|Q9M1K2|PI5K4_ARATH Phosphatidylinositol 4-phosphate 5-kinase 4 OS=Arabidopsis thaliana GN=PIP5K4 PE=3 SV=1 351 761 9.0E-60
sp|Q99755|PI51A_HUMAN Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha OS=Homo sapiens GN=PIP5K1A PE=1 SV=1 370 832 9.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13853|ITS3_SCHPO Phosphatidylinositol 4-phosphate 5-kinase its3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=its3 PE=1 SV=3 314 762 0.0E+00
sp|P38994|MSS4_YEAST Probable phosphatidylinositol 4-phosphate 5-kinase MSS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSS4 PE=1 SV=2 324 762 5.0E-135
sp|Q55GN6|Y7588_DICDI Probable phosphatidylinositol phosphate kinase DDB_G0267588 OS=Dictyostelium discoideum GN=DDB_G0267588 PE=1 SV=1 271 616 3.0E-61
sp|Q9M1K2|PI5K4_ARATH Phosphatidylinositol 4-phosphate 5-kinase 4 OS=Arabidopsis thaliana GN=PIP5K4 PE=3 SV=1 351 761 9.0E-60
sp|Q99755|PI51A_HUMAN Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha OS=Homo sapiens GN=PIP5K1A PE=1 SV=1 370 832 9.0E-60
sp|O48709|PI5K3_ARATH Phosphatidylinositol 4-phosphate 5-kinase 3 OS=Arabidopsis thaliana GN=PIP5K3 PE=3 SV=1 351 766 1.0E-59
sp|Q56YP2|PI5K1_ARATH Phosphatidylinositol 4-phosphate 5-kinase 1 OS=Arabidopsis thaliana GN=PIP5K1 PE=1 SV=1 351 766 3.0E-59
sp|Q9SFB8|PI5K6_ARATH Phosphatidylinositol 4-phosphate 5-kinase 6 OS=Arabidopsis thaliana GN=PIP5K6 PE=2 SV=1 351 761 3.0E-59
sp|Q8L850|PI5K9_ARATH Phosphatidylinositol 4-phosphate 5-kinase 9 OS=Arabidopsis thaliana GN=PIP5K9 PE=1 SV=2 330 764 9.0E-59
sp|Q8L796|PI5K2_ARATH Phosphatidylinositol 4-phosphate 5-kinase 2 OS=Arabidopsis thaliana GN=PIP5K2 PE=1 SV=2 351 766 2.0E-58
sp|O60331|PI51C_HUMAN Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma OS=Homo sapiens GN=PIP5K1C PE=1 SV=2 370 761 2.0E-57
sp|Q9SUI2|PI5K7_ARATH Phosphatidylinositol 4-phosphate 5-kinase 7 OS=Arabidopsis thaliana GN=PIP5K7 PE=1 SV=1 360 764 4.0E-57
sp|Q9SLG9|PI5K5_ARATH Phosphatidylinositol 4-phosphate 5-kinase 5 OS=Arabidopsis thaliana GN=PIP5K5 PE=2 SV=1 351 761 4.0E-57
sp|Q8RY89|PI5K8_ARATH Phosphatidylinositol 4-phosphate 5-kinase 8 OS=Arabidopsis thaliana GN=PIP5K8 PE=1 SV=1 366 761 5.0E-57
sp|D3ZSI8|PI51A_RAT Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha OS=Rattus norvegicus GN=Pip5k1a PE=2 SV=1 370 761 7.0E-57
sp|O70161|PI51C_MOUSE Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma OS=Mus musculus GN=Pip5k1c PE=1 SV=2 370 761 8.0E-57
sp|Q5I6B8|PI51C_RAT Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma OS=Rattus norvegicus GN=Pip5k1c PE=1 SV=1 370 761 2.0E-56
sp|P70182|PI51A_MOUSE Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha OS=Mus musculus GN=Pip5k1a PE=1 SV=2 370 761 2.0E-55
sp|P70181|PI51B_MOUSE Phosphatidylinositol 4-phosphate 5-kinase type-1 beta OS=Mus musculus GN=Pip5k1b PE=1 SV=1 370 761 9.0E-55
sp|Q5CZZ9|PI51B_RAT Phosphatidylinositol 4-phosphate 5-kinase type-1 beta OS=Rattus norvegicus GN=Pip5k1b PE=1 SV=1 370 761 1.0E-54
sp|A2A3N6|PIPSL_HUMAN Putative PIP5K1A and PSMD4-like protein OS=Homo sapiens GN=PIPSL PE=5 SV=1 370 832 3.0E-54
sp|O14986|PI51B_HUMAN Phosphatidylinositol 4-phosphate 5-kinase type-1 beta OS=Homo sapiens GN=PIP5K1B PE=1 SV=2 370 761 5.0E-54
sp|Q5ZJ58|PI51B_CHICK Phosphatidylinositol 4-phosphate 5-kinase type-1 beta OS=Gallus gallus GN=PIP5K1B PE=2 SV=1 370 775 9.0E-53
sp|Q6EX42|PI5K1_ORYSJ Phosphatidylinositol 4-phosphate 5-kinase 1 OS=Oryza sativa subsp. japonica GN=PIPK1 PE=2 SV=2 354 609 9.0E-46
sp|Q8TBX8|PI42C_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma OS=Homo sapiens GN=PIP4K2C PE=1 SV=3 414 764 8.0E-38
sp|Q0P5F7|PI42C_BOVIN Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma OS=Bos taurus GN=PIP4K2C PE=2 SV=1 414 764 2.0E-37
sp|O88377|PI42B_RAT Phosphatidylinositol 5-phosphate 4-kinase type-2 beta OS=Rattus norvegicus GN=Pip4k2b PE=1 SV=1 390 764 9.0E-37
sp|Q5R488|PI42C_PONAB Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma OS=Pongo abelii GN=PIP4K2C PE=2 SV=1 414 764 3.0E-36
sp|P78356|PI42B_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 beta OS=Homo sapiens GN=PIP4K2B PE=1 SV=1 390 614 5.0E-35
sp|Q80XI4|PI42B_MOUSE Phosphatidylinositol 5-phosphate 4-kinase type-2 beta OS=Mus musculus GN=Pip4k2b PE=1 SV=1 390 614 7.0E-35
sp|O13010|PI42A_PIG Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha OS=Sus scrofa GN=PIP4K2A PE=2 SV=1 334 614 3.0E-34
sp|Q5F356|PI42A_CHICK Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha OS=Gallus gallus GN=PIP4K2A PE=2 SV=1 367 614 6.0E-34
sp|Q91XU3|PI42C_MOUSE Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma OS=Mus musculus GN=Pip4k2c PE=1 SV=1 414 764 2.0E-33
sp|O70172|PI42A_MOUSE Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha OS=Mus musculus GN=Pip4k2a PE=1 SV=1 334 614 3.0E-33
sp|P48426|PI42A_HUMAN Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha OS=Homo sapiens GN=PIP4K2A PE=1 SV=2 334 614 3.0E-33
sp|Q9R0I8|PI42A_RAT Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha OS=Rattus norvegicus GN=Pip4k2a PE=1 SV=1 334 614 3.0E-33
sp|Q9LMN1|PI5KA_ARATH Phosphatidylinositol 4-phosphate 5-kinase 10 OS=Arabidopsis thaliana GN=PIP5K10 PE=2 SV=2 384 770 2.0E-30
sp|O88370|PI42C_RAT Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma OS=Rattus norvegicus GN=Pip4k2c PE=1 SV=1 414 764 6.0E-30
sp|Q5PQ01|PI42C_XENLA Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma OS=Xenopus laevis GN=pip4k2c PE=2 SV=1 390 613 3.0E-29
sp|Q6GL14|PI42C_XENTR Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma OS=Xenopus tropicalis GN=pip4k2c PE=2 SV=1 390 614 3.0E-29
sp|Q9M149|PI5KB_ARATH Putative phosphatidylinositol 4-phosphate 5-kinase 11 OS=Arabidopsis thaliana GN=PIP5K11 PE=3 SV=1 408 766 2.0E-28
sp|Q5T9C9|PI5L1_HUMAN Phosphatidylinositol 4-phosphate 5-kinase-like protein 1 OS=Homo sapiens GN=PIP5KL1 PE=2 SV=2 404 765 1.0E-27
sp|Q6IQE1|PI42C_DANRE Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma OS=Danio rerio GN=pip4k2c PE=2 SV=1 390 611 1.0E-26
sp|Q17QS4|PI5L1_BOVIN Phosphatidylinositol 4-phosphate 5-kinase-like protein 1 OS=Bos taurus GN=PIP5KL1 PE=2 SV=1 404 765 2.0E-26
sp|Q6U7H8|PI5L1_MOUSE Phosphatidylinositol 4-phosphate 5-kinase-like protein 1 OS=Mus musculus GN=Pip5kl1 PE=1 SV=1 424 762 9.0E-23
sp|Q9Z1T6|FYV1_MOUSE 1-phosphatidylinositol 3-phosphate 5-kinase OS=Mus musculus GN=Pikfyve PE=1 SV=3 455 612 5.0E-09
sp|Q9Y2I7|FYV1_HUMAN 1-phosphatidylinositol 3-phosphate 5-kinase OS=Homo sapiens GN=PIKFYVE PE=1 SV=3 410 612 6.0E-09
sp|Q0WUR5|FAB1A_ARATH 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A OS=Arabidopsis thaliana GN=FAB1A PE=2 SV=1 408 608 6.0E-09
sp|Q55GN6|Y7588_DICDI Probable phosphatidylinositol phosphate kinase DDB_G0267588 OS=Dictyostelium discoideum GN=DDB_G0267588 PE=1 SV=1 693 764 1.0E-08
sp|Q9LUM0|FAB1B_ARATH 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B OS=Arabidopsis thaliana GN=FAB1B PE=2 SV=1 410 623 5.0E-08
sp|B0G126|FYV1_DICDI 1-phosphatidylinositol 3-phosphate 5-kinase OS=Dictyostelium discoideum GN=pip5k3 PE=3 SV=1 376 612 1.0E-07
sp|Q9XID0|FAB1D_ARATH Putative 1-phosphatidylinositol-3-phosphate 5-kinase FAB1D OS=Arabidopsis thaliana GN=FAB1D PE=3 SV=1 424 623 2.0E-07
sp|O59722|FAB1_SCHPO 1-phosphatidylinositol 3-phosphate 5-kinase fab1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fab1 PE=3 SV=2 452 608 3.0E-07
sp|P34756|FAB1_YEAST 1-phosphatidylinositol 3-phosphate 5-kinase FAB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAB1 PE=1 SV=3 455 608 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0046488 phosphatidylinositol metabolic process Yes
GO:0016307 phosphatidylinositol phosphate kinase activity Yes
GO:0006793 phosphorus metabolic process No
GO:0046486 glycerolipid metabolic process No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0044255 cellular lipid metabolic process No
GO:0016301 kinase activity No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0006629 lipid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006644 phospholipid metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0044237 cellular metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0019637 organophosphate metabolic process No
GO:0006650 glycerophospholipid metabolic process No
GO:0003824 catalytic activity No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11202
MPSFLTDDNSPIFSTEIDVLDLDFGGHFGLAPTDKAKANGASINHARSGLSNESFDESSTLSTHDSDISDALPMP
ANGNGTRPTSMSSLANSKTVLPDADAHDDALSAASKPTSNGTIVLPDRTLPRPPPADAHDDDDARQHGSARETEP
PVRRQPSRDRRSMERTRVPSPAAGYGSSTPVTPNPTDAEPAFYAVEPRSAELPPTSHLLEPAQAKSQPHRFSSPP
AIQHANTSNITSSSGHLQPPPPGASALKQRHTLEVPKVPPSRQSRDGADAAFASGRFSPSVAGSAGNRRASLNLV
RRTTRSMQSDIPRDEIVPDEDALRWAEAYRQKRASKRKRKEEEDDDRVLVGTKVDESHANWVTAYNMLTGIRVSV
SRTNAKLDRELTDADFDAKQKSTFDITGNELVPSAKYDFKFKDYAPWVFRRLRALFRLDPADYLVSLTGKYILSE
LGSPGKSGSFFYFSRDYKYIIKTIHHSEHKFLRKILKDYYTHVQENPNTLLSQFYGLHRVKMPYGKKIHFVVMNN
LFPPHRDIHTTFDLKGSTIGRDYREDDLAKNPRATLKDLNWLRRQQHLELGIQKKQLFLEQLQRDVVLLKRLQIM
DYSLLIGIHDLSRGNEENLRDKTLRVFNPGGEKSPDDDPQSVLLRTPSKMENVRKARELRQMIRQERPVPMGQAL
DRMPNELGEGHSRPGFVFNQDDGGFRATHEDNSPAEEIYYLGVIDCLTHYGMIKKIEHFWKGLSNDRTQISALPP
DEYGDRFYNFIEGITMSGEEARREAQRRDQEAIEAQASEGASHRTSMPLSHHGIPPMPDHQPPAPPTASTSPEGR
ETLEMASREARRTVAHGASEQDVPDRTLRTCPLMADRRDSMQHEPILPVVEEIGENGRAEAGERTVKTRPSNGKA
PIPPPPTGPPPPTPPKSQQLQLKVESSDSGYGGNSNGTLSRDSSLRVRPQPSRESLDKSLPPLPPGAAGDKAKHN
GGGVRLVA*
Coding >Hirsu2|11202
ATGCCCTCGTTCCTCACCGACGACAACTCGCCCATCTTCTCCACCGAGATCGACGTCCTCGACCTCGACTTCGGC
GGCCATTTTGGCCTCGCGCCGACCGACAAGGCCAAGGCAAATGGGGCCTCCATCAACCACGCTCGCTCTGGCCTA
AGCAACGAGAGCTTCGACGAGAGCTCTACCCTCTCGACGCACGACTCGGACATCTCCGACGCGCTTCCGATGCCC
GCGAATGGCAACGGCACGCGTCCCACGAGCATGAGCTCGCTCGCCAACAGCAAGACCGTCCTCCCGGACGCCGAC
GCCCACGACGACGCCCTGTCCGCCGCCAGCAAGCCCACCTCCAACGGCACAATCGTCCTCCCCGACCGCACCCTG
CCGCGACCGCCCCCGGCCGACGCCCACGACGACGACGACGCACGCCAACACGGCTCCGCTCGTGAAACGGAACCG
CCAGTCCGGCGGCAGCCTTCTCGAGACCGCCGGTCCATGGAACGCACCCGTGTCCCCTCGCCCGCGGCCGGGTAC
GGCAGCAGCACGCCCGTCACCCCCAATCCCACCGACGCCGAGCCGGCTTTCTATGCCGTCGAGCCGCGCTCGGCC
GAGCTCCCCCCTACCTCTCACCTCCTCGAGCCCGCACAGGCCAAGAGCCAGCCTCACCGCTTCTCCTCTCCGCCC
GCCATCCAGCACGCCAACACGTCCAACATCACCTCCTCGTCCGGCCACCTCCAGCCGCCGCCGCCCGGCGCATCG
GCGCTCAAGCAGAGGCACACGCTCGAGGTCCCCAAGGTGCCCCCCAGCCGGCAGTCCAGGGATGGCGCCGACGCC
GCCTTCGCCAGTGGCCGCTTCTCGCCCAGCGTCGCCGGCTCCGCGGGCAACCGCCGCGCCTCGCTGAACCTGGTC
CGCCGCACCACCCGGTCCATGCAGTCCGACATCCCTAGGGACGAGATTGTCCCCGACGAGGACGCCCTGAGGTGG
GCCGAGGCCTACCGGCAGAAGCGGGCCAGCAAGCGGAAGCGCAAGGAGGAGGAGGACGACGACCGCGTCCTCGTC
GGCACCAAGGTCGACGAGAGCCACGCCAACTGGGTCACCGCATATAACATGCTGACCGGGATCCGCGTCTCCGTC
TCGAGGACCAACGCCAAGCTCGACCGGGAGCTGACCGACGCCGACTTCGACGCCAAGCAGAAGTCGACCTTTGAC
ATCACCGGCAACGAACTGGTACCCTCGGCCAAGTACGACTTCAAGTTCAAGGACTACGCCCCTTGGGTCTTTCGT
CGGTTGCGAGCCCTCTTCCGCCTCGACCCCGCCGACTATCTCGTTTCATTGACAGGCAAATATATCCTCTCCGAG
CTCGGCTCCCCGGGCAAAAGCGGCAGCTTCTTTTACTTTTCCAGAGACTACAAGTACATCATCAAGACCATCCAC
CACTCCGAACACAAATTCCTCCGCAAGATCCTCAAGGACTACTACACCCACGTCCAGGAGAACCCCAACACACTC
CTCTCCCAGTTCTACGGCCTGCACCGCGTCAAGATGCCGTACGGCAAGAAGATCCATTTCGTCGTCATGAACAAC
CTCTTCCCGCCCCACCGAGACATCCACACCACCTTCGACCTCAAGGGCTCGACCATCGGCCGAGACTACCGAGAA
GACGACCTCGCCAAGAACCCGCGCGCCACGCTCAAGGACCTCAACTGGCTGCGGCGGCAGCAGCACCTCGAGCTC
GGCATCCAGAAGAAGCAGCTGTTCCTCGAGCAGCTGCAGCGCGACGTCGTGCTCCTCAAGCGGCTCCAGATCATG
GACTACTCCCTCCTCATCGGCATCCACGACCTCTCGCGCGGCAACGAGGAGAACCTCCGCGACAAGACGCTGCGG
GTCTTCAACCCCGGAGGCGAGAAGTCGCCCGACGACGACCCCCAATCGGTCCTCCTCCGAACCCCCTCCAAGATG
GAGAACGTGCGCAAGGCCAGGGAGTTGAGACAGATGATTCGACAGGAGCGCCCGGTGCCCATGGGCCAAGCCTTG
GACAGGATGCCCAACGAGCTCGGAGAGGGCCACAGCCGGCCGGGCTTCGTCTTCAACCAGGACGACGGCGGCTTC
CGGGCCACGCACGAGGACAACTCGCCCGCCGAGGAGATTTACTACCTCGGCGTCATCGACTGCCTGACCCACTAC
GGGATGATCAAGAAAATTGAGCACTTTTGGAAGGGCTTGTCCAACGACCGGACGCAGATCTCGGCCCTGCCGCCC
GACGAGTACGGAGACCGCTTCTACAACTTCATCGAGGGCATCACCATGTCCGGCGAGGAGGCCAGGCGGGAGGCC
CAGCGCAGGGACCAGGAAGCCATCGAGGCGCAGGCGTCGGAGGGGGCGTCGCACCGGACCTCGATGCCGCTGTCC
CACCACGGCATCCCCCCCATGCCCGACCACCAGCCGCCGGCGCCGCCGACGGCATCCACGTCGCCGGAAGGCCGA
GAGACGCTCGAGATGGCGTCGAGGGAGGCGCGACGGACGGTGGCGCACGGGGCGTCGGAGCAGGACGTGCCGGAT
CGGACGCTGCGCACGTGCCCGCTCATGGCGGACAGGCGAGACTCGATGCAGCACGAACCCATCCTCCCCGTGGTC
GAGGAGATTGGCGAGAACGGCCGGGCCGAGGCGGGGGAGCGGACGGTCAAGACGAGGCCGTCGAATGGCAAGGCG
CCGATTCCCCCTCCTCCCACGGGCCCGCCGCCGCCGACGCCGCCCAAGAGCCAGCAGCTGCAGCTCAAGGTGGAG
AGCTCCGACAGCGGCTACGGGGGAAACAGCAACGGGACGCTTAGCAGGGACAGCTCCCTGCGGGTACGCCCTCAG
CCGAGCCGCGAGAGCCTCGACAAGTCACTGCCGCCGCTGCCGCCGGGCGCCGCCGGGGATAAGGCGAAGCACAAC
GGCGGCGGGGTGAGGTTGGTCGCATAG
Transcript >Hirsu2|11202
ATGCCCTCGTTCCTCACCGACGACAACTCGCCCATCTTCTCCACCGAGATCGACGTCCTCGACCTCGACTTCGGC
GGCCATTTTGGCCTCGCGCCGACCGACAAGGCCAAGGCAAATGGGGCCTCCATCAACCACGCTCGCTCTGGCCTA
AGCAACGAGAGCTTCGACGAGAGCTCTACCCTCTCGACGCACGACTCGGACATCTCCGACGCGCTTCCGATGCCC
GCGAATGGCAACGGCACGCGTCCCACGAGCATGAGCTCGCTCGCCAACAGCAAGACCGTCCTCCCGGACGCCGAC
GCCCACGACGACGCCCTGTCCGCCGCCAGCAAGCCCACCTCCAACGGCACAATCGTCCTCCCCGACCGCACCCTG
CCGCGACCGCCCCCGGCCGACGCCCACGACGACGACGACGCACGCCAACACGGCTCCGCTCGTGAAACGGAACCG
CCAGTCCGGCGGCAGCCTTCTCGAGACCGCCGGTCCATGGAACGCACCCGTGTCCCCTCGCCCGCGGCCGGGTAC
GGCAGCAGCACGCCCGTCACCCCCAATCCCACCGACGCCGAGCCGGCTTTCTATGCCGTCGAGCCGCGCTCGGCC
GAGCTCCCCCCTACCTCTCACCTCCTCGAGCCCGCACAGGCCAAGAGCCAGCCTCACCGCTTCTCCTCTCCGCCC
GCCATCCAGCACGCCAACACGTCCAACATCACCTCCTCGTCCGGCCACCTCCAGCCGCCGCCGCCCGGCGCATCG
GCGCTCAAGCAGAGGCACACGCTCGAGGTCCCCAAGGTGCCCCCCAGCCGGCAGTCCAGGGATGGCGCCGACGCC
GCCTTCGCCAGTGGCCGCTTCTCGCCCAGCGTCGCCGGCTCCGCGGGCAACCGCCGCGCCTCGCTGAACCTGGTC
CGCCGCACCACCCGGTCCATGCAGTCCGACATCCCTAGGGACGAGATTGTCCCCGACGAGGACGCCCTGAGGTGG
GCCGAGGCCTACCGGCAGAAGCGGGCCAGCAAGCGGAAGCGCAAGGAGGAGGAGGACGACGACCGCGTCCTCGTC
GGCACCAAGGTCGACGAGAGCCACGCCAACTGGGTCACCGCATATAACATGCTGACCGGGATCCGCGTCTCCGTC
TCGAGGACCAACGCCAAGCTCGACCGGGAGCTGACCGACGCCGACTTCGACGCCAAGCAGAAGTCGACCTTTGAC
ATCACCGGCAACGAACTGGTACCCTCGGCCAAGTACGACTTCAAGTTCAAGGACTACGCCCCTTGGGTCTTTCGT
CGGTTGCGAGCCCTCTTCCGCCTCGACCCCGCCGACTATCTCGTTTCATTGACAGGCAAATATATCCTCTCCGAG
CTCGGCTCCCCGGGCAAAAGCGGCAGCTTCTTTTACTTTTCCAGAGACTACAAGTACATCATCAAGACCATCCAC
CACTCCGAACACAAATTCCTCCGCAAGATCCTCAAGGACTACTACACCCACGTCCAGGAGAACCCCAACACACTC
CTCTCCCAGTTCTACGGCCTGCACCGCGTCAAGATGCCGTACGGCAAGAAGATCCATTTCGTCGTCATGAACAAC
CTCTTCCCGCCCCACCGAGACATCCACACCACCTTCGACCTCAAGGGCTCGACCATCGGCCGAGACTACCGAGAA
GACGACCTCGCCAAGAACCCGCGCGCCACGCTCAAGGACCTCAACTGGCTGCGGCGGCAGCAGCACCTCGAGCTC
GGCATCCAGAAGAAGCAGCTGTTCCTCGAGCAGCTGCAGCGCGACGTCGTGCTCCTCAAGCGGCTCCAGATCATG
GACTACTCCCTCCTCATCGGCATCCACGACCTCTCGCGCGGCAACGAGGAGAACCTCCGCGACAAGACGCTGCGG
GTCTTCAACCCCGGAGGCGAGAAGTCGCCCGACGACGACCCCCAATCGGTCCTCCTCCGAACCCCCTCCAAGATG
GAGAACGTGCGCAAGGCCAGGGAGTTGAGACAGATGATTCGACAGGAGCGCCCGGTGCCCATGGGCCAAGCCTTG
GACAGGATGCCCAACGAGCTCGGAGAGGGCCACAGCCGGCCGGGCTTCGTCTTCAACCAGGACGACGGCGGCTTC
CGGGCCACGCACGAGGACAACTCGCCCGCCGAGGAGATTTACTACCTCGGCGTCATCGACTGCCTGACCCACTAC
GGGATGATCAAGAAAATTGAGCACTTTTGGAAGGGCTTGTCCAACGACCGGACGCAGATCTCGGCCCTGCCGCCC
GACGAGTACGGAGACCGCTTCTACAACTTCATCGAGGGCATCACCATGTCCGGCGAGGAGGCCAGGCGGGAGGCC
CAGCGCAGGGACCAGGAAGCCATCGAGGCGCAGGCGTCGGAGGGGGCGTCGCACCGGACCTCGATGCCGCTGTCC
CACCACGGCATCCCCCCCATGCCCGACCACCAGCCGCCGGCGCCGCCGACGGCATCCACGTCGCCGGAAGGCCGA
GAGACGCTCGAGATGGCGTCGAGGGAGGCGCGACGGACGGTGGCGCACGGGGCGTCGGAGCAGGACGTGCCGGAT
CGGACGCTGCGCACGTGCCCGCTCATGGCGGACAGGCGAGACTCGATGCAGCACGAACCCATCCTCCCCGTGGTC
GAGGAGATTGGCGAGAACGGCCGGGCCGAGGCGGGGGAGCGGACGGTCAAGACGAGGCCGTCGAATGGCAAGGCG
CCGATTCCCCCTCCTCCCACGGGCCCGCCGCCGCCGACGCCGCCCAAGAGCCAGCAGCTGCAGCTCAAGGTGGAG
AGCTCCGACAGCGGCTACGGGGGAAACAGCAACGGGACGCTTAGCAGGGACAGCTCCCTGCGGGTACGCCCTCAG
CCGAGCCGCGAGAGCCTCGACAAGTCACTGCCGCCGCTGCCGCCGGGCGCCGCCGGGGATAAGGCGAAGCACAAC
GGCGGCGGGGTGAGGTTGGTCGCATAG
Gene >Hirsu2|11202
ATGCCCTCGTTCCTCACCGACGACAACTCGCCCATCTTCTCCACCGAGATCGACGTCCTCGACCTCGACTTCGGC
GGCCATTTTGGCCTCGCGCCGACCGACAAGGCCAAGGCAAATGGGGCCTCCATCAACCACGCTCGCTCTGGCCTA
AGCAACGAGAGCTTCGACGAGAGCTCTACCCTCTCGACGCACGACTCGGACATCTCCGACGCGCTTCCGATGCCC
GCGAATGGCAACGGCACGCGTCCCACGAGCATGAGCTCGCTCGCCAACAGCAAGACCGTCCTCCCGGACGCCGAC
GCCCACGACGACGCCCTGTCCGCCGCCAGCAAGCCCACCTCCAACGGCACAATCGTCCTCCCCGACCGCACCCTG
CCGCGACCGCCCCCGGCCGACGCCCACGACGACGACGACGCACGCCAACACGGCTCCGCTCGTGAAACGGAACCG
CCAGTCCGGCGGCAGCCTTCTCGAGACCGCCGGTCCATGGAACGCACCCGTGTCCCCTCGCCCGCGGCCGGGTAC
GGCAGCAGCACGCCCGTCACCCCCAATCCCACCGACGCCGAGCCGGCTTTCTATGCCGTCGAGCCGCGCTCGGCC
GAGCTCCCCCCTACCTCTCACCTCCTCGAGCCCGCACAGGCCAAGAGCCAGCCTCACCGCTTCTCCTCTCCGCCC
GCCATCCAGCACGCCAACACGTCCAACATCACCTCCTCGTCCGGCCACCTCCAGCCGCCGCCGCCCGGCGCATCG
GCGCTCAAGCAGAGGCACACGCTCGAGGTCCCCAAGGTGCCCCCCAGCCGGCAGTCCAGGGATGGCGCCGACGCC
GCCTTCGCCAGTGGCCGCTTCTCGCCCAGCGTCGCCGGCTCCGCGGGCAACCGCCGCGCCTCGCTGAACCTGGTC
CGCCGCACCACCCGGTCCATGCAGTCCGACATCCCTAGGGACGAGATTGTCCCCGACGAGGACGCCCTGAGGTGG
GCCGAGGCCTACCGGCAGAAGCGGGCCAGCAAGCGGAAGCGCAAGGAGGAGGAGGACGACGACCGCGTCCTCGTC
GGCACCAAGGTCGACGAGAGCCACGCCAACTGGGTCACCGCATATAACATGCTGACCGGGATCCGCGTCTCCGTC
TCGAGGACCAACGCCAAGCTCGACCGGGAGCTGACCGACGCCGACTTCGACGCCAAGCAGAAGTCGACCTTTGAC
ATGTAAGTCCCGCCCGAGACGATGCCCTGGCCGCGTGGCGCTCACCAGAACCCCCCTCCCCCGACAGCACCGGCA
ACGAACTGGTACCCTCGGCCAAGTACGACTTCAAGTTCAAGGACTACGCCCCTTGGGTCTTTCGTCGGTTGCGAG
CCCTCTTCCGCCTCGACCCCGCCGACTATCTCGTTTCATTGACAGGCAAATATATCCTCTCCGAGCTCGGCTCCC
CGGGCAAAAGCGGCAGCTTCTTTTACTTTTCCAGAGACTACAAGTACATCATCAAGACCATCCACCACTCCGAAC
ACAAATTCCTCCGCAAGATCCTCAAGGACTACTACACCCACGTCCAGGAGAACCCCAACACACTCCTCTCCCAGT
TCTACGGCCTGCACCGCGTCAAGATGCCGTACGGCAAGAAGATCCATTTCGTCGTCATGAACAACCTCTTCCCGC
CCCACCGAGACATCCACACCACCTTCGACCTCAAGGGCTCGACCATCGGCCGAGACTACCGAGAAGACGACCTCG
CCAAGAACCCGCGCGCCACGCTCAAGGACCTCAACTGGCTGCGGCGGCAGCAGCACCTCGAGCTCGGCATCCAGA
AGAAGCAGCTGTTCCTCGAGCAGCTGCAGCGCGACGTCGTGCTCCTCAAGCGGCTCCAGATCATGGACTACTCCC
TCCTCATCGGCATCCACGACCTCTCGCGCGGCAACGAGGAGAACCTCCGCGACAAGACGCTGCGGGTCTTCAACC
CCGGAGGCGAGAAGTCGCCCGACGACGACCCCCAATCGGTCCTCCTCCGAACCCCCTCCAAGATGGAGAACGTGC
GCAAGGCCAGGGAGTTGAGACAGATGATTCGACAGGAGCGCCCGGTGCCCATGGGCCAAGCCTTGGACAGGATGC
CCAACGAGCTCGGAGAGGGCCACAGCCGGCCGGGCTTCGTCTTCAACCAGGACGACGGCGGCTTCCGGGCCACGC
ACGAGGACAACTCGCCCGCCGAGGAGATTTACTACCTCGGCGTCATCGACTGCCTGACCCACGTAAGAACCCGCA
GCCCGGGCGCGAGGACTGCGCGCGCCCCCCCCCCCCCCCCGGTGACGCACGGCCATACTGACAGGGAAATCCAAC
AATGCAGTACGGGATGATCAAGAAAATTGAGCACTTTTGGAAGGGCTTGTCCAACGACCGGACGCAGATCTCGGC
CCTGCCGCCCGACGAGTACGGAGACCGCTTCTACAACTTCATCGAGGGCATCACCATGTCCGGCGAGGAGGCCAG
GCGGGAGGCCCAGCGCAGGGACCAGGAAGCCATCGAGGCGCAGGCGTCGGAGGGGGCGTCGCACCGGACCTCGAT
GCCGCTGTCCCACCACGGCATCCCCCCCATGCCCGACCACCAGCCGCCGGCGCCGCCGACGGCATCCACGTCGCC
GGAAGGCCGAGAGACGCTCGAGATGGCGTCGAGGGAGGCGCGACGGACGGTGGCGCACGGGGCGTCGGAGCAGGA
CGTGCCGGATCGGACGCTGCGCACGTGCCCGCTCATGGCGGACAGGCGAGACTCGATGCAGCACGAACCCATCCT
CCCCGTGGTCGAGGAGATTGGCGAGAACGGCCGGGCCGAGGCGGGGGAGCGGACGGTCAAGACGAGGCCGTCGAA
TGGCAAGGCGCCGATTCCCCCTCCTCCCACGGGCCCGCCGCCGCCGACGCCGCCCAAGAGCCAGCAGCTGCAGCT
CAAGGTGGAGAGCTCCGACAGCGGCTACGGGGGAAACAGCAACGGGACGCTTAGCAGGGACAGCTCCCTGCGGGT
ACGCCCTCAGCCGAGCCGCGAGAGCCTCGACAAGTCACTGCCGCCGCTGCCGCCGGGCGCCGCCGGGGATAAGGC
GAAGCACAACGGCGGCGGGGTGAGGTTGGTCGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail