Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1120
Gene name
LocationContig_1236:2542..3887
Strand-
Gene length (bp)1345
Transcript length (bp)1140
Coding sequence length (bp)1140
Protein length (aa) 380

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03060 NMO Nitronate monooxygenase 2.4E-56 9 282
PF00478 IMPDH IMP dehydrogenase / GMP reductase domain 3.2E-11 6 237

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q49W60|2NPD_STAS1 Probable nitronate monooxygenase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1854 PE=3 SV=1 6 272 3.0E-35
sp|O06179|Y1533_MYCTU Putative monooxygenase Rv1533 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1533 PE=1 SV=1 7 275 3.0E-31
sp|Q99VF6|2NPD_STAAN Probable nitronate monooxygenase OS=Staphylococcus aureus (strain N315) GN=SA0781 PE=3 SV=1 8 273 2.0E-27
sp|A5IR97|2NPD_STAA9 Probable nitronate monooxygenase OS=Staphylococcus aureus (strain JH9) GN=SaurJH9_0919 PE=3 SV=1 8 273 2.0E-27
sp|A6U025|2NPD_STAA2 Probable nitronate monooxygenase OS=Staphylococcus aureus (strain JH1) GN=SaurJH1_0937 PE=3 SV=1 8 273 2.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q49W60|2NPD_STAS1 Probable nitronate monooxygenase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1854 PE=3 SV=1 6 272 3.0E-35
sp|O06179|Y1533_MYCTU Putative monooxygenase Rv1533 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1533 PE=1 SV=1 7 275 3.0E-31
sp|Q99VF6|2NPD_STAAN Probable nitronate monooxygenase OS=Staphylococcus aureus (strain N315) GN=SA0781 PE=3 SV=1 8 273 2.0E-27
sp|A5IR97|2NPD_STAA9 Probable nitronate monooxygenase OS=Staphylococcus aureus (strain JH9) GN=SaurJH9_0919 PE=3 SV=1 8 273 2.0E-27
sp|A6U025|2NPD_STAA2 Probable nitronate monooxygenase OS=Staphylococcus aureus (strain JH1) GN=SaurJH1_0937 PE=3 SV=1 8 273 2.0E-27
sp|Q4L4T4|2NPD_STAHJ Probable nitronate monooxygenase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH2032 PE=3 SV=1 11 281 2.0E-27
sp|Q6GB05|2NPD_STAAS Probable nitronate monooxygenase OS=Staphylococcus aureus (strain MSSA476) GN=SAS0791 PE=3 SV=1 8 273 3.0E-27
sp|Q6GIG7|2NPD_STAAR Probable nitronate monooxygenase OS=Staphylococcus aureus (strain MRSA252) GN=SAR0883 PE=3 SV=1 8 273 5.0E-27
sp|Q8NXG7|2NPD_STAAW Probable nitronate monooxygenase OS=Staphylococcus aureus (strain MW2) GN=MW0803 PE=3 SV=1 8 273 1.0E-26
sp|A8Z1H7|2NPD_STAAT Probable nitronate monooxygenase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=USA300HOU_0879 PE=3 SV=1 8 273 2.0E-26
sp|Q2FIF3|2NPD_STAA3 Probable nitronate monooxygenase OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_0825 PE=3 SV=1 8 273 2.0E-26
sp|Q2FZX9|2NPD_STAA8 Probable nitronate monooxygenase OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_00855 PE=3 SV=1 8 273 2.0E-26
sp|Q5HHG4|2NPD_STAAC Probable nitronate monooxygenase OS=Staphylococcus aureus (strain COL) GN=SACOL0922 PE=3 SV=1 8 273 2.0E-26
sp|A6QFD2|2NPD_STAAE Probable nitronate monooxygenase OS=Staphylococcus aureus (strain Newman) GN=NWMN_0792 PE=3 SV=1 8 273 2.0E-26
sp|O05413|2NPD_BACSU Probable nitronate monooxygenase OS=Bacillus subtilis (strain 168) GN=yrpB PE=3 SV=1 15 301 6.0E-26
sp|Q9I4V0|2NPD_PSEAE Nitronate monooxygenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA1024 PE=1 SV=1 7 306 2.0E-20
sp|Q12723|2NPD_CYBMR Nitronate monooxygenase OS=Cyberlindnera mrakii PE=3 SV=1 15 273 9.0E-14
sp|Q01284|2NPD_NEUCR Nitronate monooxygenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ncd-2 PE=1 SV=1 3 289 1.0E-09
sp|P47177|2NDP_YEAST Putative nitronate monooxygenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJR149W PE=1 SV=2 113 281 5.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0018580 nitronate monooxygenase activity Yes
GO:0003824 catalytic activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0016491 oxidoreductase activity No
GO:0008152 metabolic process No
GO:0016703 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of one atom of oxygen (internal monooxygenases or internal mixed function oxidases) No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0004497 monooxygenase activity No
GO:0016701 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1120
MASPQQIRTPITDLFKIKHPVLLAGMNVAAGPKLAAAVTNAGGLGVIGGVGYTPDMLREQIAELKEYLDDKNAPF
GVDLLLPQVGGSARKTNYDYTKGKLDELIDIIIDSGAKLFVSAVGVPPKAVVDKLHNAGIVYMNMIGHVKHVKKC
LDLGVDIICAQGGEGGGHTGDIPTTVLIPAVVDICKKAKSPLTGGPVQVIAAGGIHNGQLLAASLMMGAGAVWVG
TRFVLTDEAGAPKAHKEAVRTAGHDDNVRTIIFTGRPLRVRNNSYINDWETNRQAEMKELAAKGTIPYEADLDKY
MSGGDGGSSGEHRGIQDPAPASDDDDDDGDDPLEQFRPYLMGKCAAVCNEQKSAKAVVDEFVTDAVAWMRAGNKM
LAKL*
Coding >Hirsu2|1120
ATGGCTTCTCCACAGCAGATCCGCACCCCCATCACCGATCTTTTCAAGATCAAGCACCCCGTCCTGCTGGCCGGC
ATGAACGTCGCCGCCGGGCCCAAGCTGGCCGCCGCCGTCACCAACGCCGGCGGCCTTGGTGTCATTGGCGGCGTC
GGCTACACCCCCGACATGCTCCGGGAGCAGATTGCCGAGCTGAAGGAATATCTCGACGACAAGAACGCTCCCTTT
GGCGTTGACCTGCTTCTTCCCCAGGTCGGCGGCAGCGCTCGCAAGACAAATTACGACTACACCAAGGGCAAACTC
GACGAGCTGATCGACATCATCATCGACTCCGGCGCCAAGCTCTTCGTCTCCGCCGTCGGCGTCCCCCCCAAGGCC
GTCGTCGACAAGCTGCACAACGCCGGTATCGTCTACATGAACATGATCGGGCACGTCAAGCACGTCAAGAAGTGT
CTCGACCTCGGCGTCGACATCATCTGTGCCCAGGGCGGTGAGGGCGGCGGCCACACGGGCGACATCCCCACCACC
GTCCTCATCCCCGCCGTCGTCGACATCTGCAAGAAGGCCAAGTCGCCGCTGACGGGCGGGCCCGTCCAGGTTATC
GCCGCAGGCGGCATCCACAACGGACAGCTGCTCGCGGCCTCGCTCATGATGGGCGCCGGCGCCGTCTGGGTCGGC
ACTCGCTTCGTCCTGACGGACGAGGCCGGCGCGCCCAAAGCCCACAAGGAGGCCGTCCGCACTGCCGGCCACGAC
GACAATGTGCGCACCATCATCTTCACTGGCCGCCCGCTGCGCGTACGCAACAACTCCTACATCAACGACTGGGAG
ACCAACCGCCAGGCCGAGATGAAGGAGCTCGCCGCCAAGGGCACCATCCCGTACGAGGCCGACCTGGACAAGTAC
ATGAGCGGCGGCGACGGCGGCAGCAGCGGCGAGCACCGCGGCATTCAGGACCCGGCCCCCGCCAGCGACGACGAC
GACGACGACGGCGACGACCCCCTCGAGCAGTTCCGCCCCTACCTGATGGGCAAGTGCGCGGCCGTGTGCAACGAG
CAGAAGTCGGCCAAGGCCGTCGTCGACGAGTTCGTCACCGACGCCGTCGCGTGGATGCGCGCCGGCAACAAAATG
CTTGCCAAGCTGTAG
Transcript >Hirsu2|1120
ATGGCTTCTCCACAGCAGATCCGCACCCCCATCACCGATCTTTTCAAGATCAAGCACCCCGTCCTGCTGGCCGGC
ATGAACGTCGCCGCCGGGCCCAAGCTGGCCGCCGCCGTCACCAACGCCGGCGGCCTTGGTGTCATTGGCGGCGTC
GGCTACACCCCCGACATGCTCCGGGAGCAGATTGCCGAGCTGAAGGAATATCTCGACGACAAGAACGCTCCCTTT
GGCGTTGACCTGCTTCTTCCCCAGGTCGGCGGCAGCGCTCGCAAGACAAATTACGACTACACCAAGGGCAAACTC
GACGAGCTGATCGACATCATCATCGACTCCGGCGCCAAGCTCTTCGTCTCCGCCGTCGGCGTCCCCCCCAAGGCC
GTCGTCGACAAGCTGCACAACGCCGGTATCGTCTACATGAACATGATCGGGCACGTCAAGCACGTCAAGAAGTGT
CTCGACCTCGGCGTCGACATCATCTGTGCCCAGGGCGGTGAGGGCGGCGGCCACACGGGCGACATCCCCACCACC
GTCCTCATCCCCGCCGTCGTCGACATCTGCAAGAAGGCCAAGTCGCCGCTGACGGGCGGGCCCGTCCAGGTTATC
GCCGCAGGCGGCATCCACAACGGACAGCTGCTCGCGGCCTCGCTCATGATGGGCGCCGGCGCCGTCTGGGTCGGC
ACTCGCTTCGTCCTGACGGACGAGGCCGGCGCGCCCAAAGCCCACAAGGAGGCCGTCCGCACTGCCGGCCACGAC
GACAATGTGCGCACCATCATCTTCACTGGCCGCCCGCTGCGCGTACGCAACAACTCCTACATCAACGACTGGGAG
ACCAACCGCCAGGCCGAGATGAAGGAGCTCGCCGCCAAGGGCACCATCCCGTACGAGGCCGACCTGGACAAGTAC
ATGAGCGGCGGCGACGGCGGCAGCAGCGGCGAGCACCGCGGCATTCAGGACCCGGCCCCCGCCAGCGACGACGAC
GACGACGACGGCGACGACCCCCTCGAGCAGTTCCGCCCCTACCTGATGGGCAAGTGCGCGGCCGTGTGCAACGAG
CAGAAGTCGGCCAAGGCCGTCGTCGACGAGTTCGTCACCGACGCCGTCGCGTGGATGCGCGCCGGCAACAAAATG
CTTGCCAAGCTGTAG
Gene >Hirsu2|1120
ATGGCTTCTCCACGTACGTCACCCGAGTTACGAAGATGCCATGGGACTGACCGTCAGCGACAACAGAGCAGATCC
GCACCCCCATCACCGATCTTTTCAAGATCAAGCACCCCGTCCTGCTGGCCGGCATGAACGTCGCCGCCGGGCCCA
AGCTGGCCGCCGCCGTCACCAACGCCGGCGGCCTTGGTGTCATTGGCGGCGTCGGCTACACCCCCGACATGCTCC
GGGAGCAGATTGCCGAGCTGAAGGAATATCTCGACGACAAGAACGCTCCCTTTGGCGTTGACCTGCTTCTTCCCC
AGGTCGGCGGCAGCGCTCGCAAGACAAAGTCTGTCTCCTGTTCTCCTTCCTCCCCCCTAATCGCCGGAATGGCAA
TCGACGCGCTCGGAGGTCAGCATCATATGTTGCGAGTCGTCCGAGCCGCTCGCCATCCACGACCCCGAATGCCTA
GCGTACTGACTCGCCCGCCTTACCCCCCAGTTACGACTACACCAAGGGCAAACTCGACGAGCTGATCGACATCAT
CATCGACTCCGGCGCCAAGCTCTTCGTCTCCGCCGTCGGCGTCCCCCCCAAGGCCGTCGTCGACAAGCTGCACAA
CGCCGGTATCGTCTACATGAACATGATCGGGCACGTCAAGCACGTCAAGAAGTGTCTCGACCTCGGCGTCGACAT
CATCTGTGCCCAGGGCGGTGAGGGCGGCGGCCACACGGGCGACATCCCCACCACCGTCCTCATCCCCGCCGTCGT
CGACATCTGCAAGAAGGCCAAGTCGCCGCTGACGGGCGGGCCCGTCCAGGTTATCGCCGCAGGCGGCATCCACAA
CGGACAGCTGCTCGCGGCCTCGCTCATGATGGGCGCCGGCGCCGTCTGGGTCGGCACTCGCTTCGTCCTGACGGA
CGAGGCCGGCGCGCCCAAAGCCCACAAGGAGGCCGTCCGCACTGCCGGCCACGACGACAATGTGCGCACCATCAT
CTTCACTGGCCGCCCGCTGCGCGTACGCAACAACTCCTACATCAACGACTGGGAGACCAACCGCCAGGCCGAGAT
GAAGGAGCTCGCCGCCAAGGGCACCATCCCGTACGAGGCCGACCTGGACAAGTACATGAGCGGCGGCGACGGCGG
CAGCAGCGGCGAGCACCGCGGCATTCAGGACCCGGCCCCCGCCAGCGACGACGACGACGACGACGGCGACGACCC
CCTCGAGCAGTTCCGCCCCTACCTGATGGGCAAGTGCGCGGCCGTGTGCAACGAGCAGAAGTCGGCCAAGGCCGT
CGTCGACGAGTTCGTCACCGACGCCGTCGCGTGGATGCGCGCCGGCAACAAAATGCTTGCCAAGCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail