Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11188
Gene name
LocationContig_98:36211..38584
Strand+
Gene length (bp)2373
Transcript length (bp)2373
Coding sequence length (bp)2373
Protein length (aa) 791

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 6.4E-34 16 249
PF07993 NAD_binding_4 Male sterility protein 1.6E-18 486 669
PF00550 PP-binding Phosphopantetheine attachment site 1.4E-08 374 439
PF01370 Epimerase NAD dependent epimerase/dehydratase family 1.5E-05 484 677

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 14 788 5.0E-129
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 13 776 1.0E-119
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 18 674 2.0E-46
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 19 433 1.0E-41
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 23 437 3.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 14 788 5.0E-129
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 13 776 1.0E-119
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 18 674 2.0E-46
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 19 433 1.0E-41
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 23 437 3.0E-41
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 17 438 4.0E-41
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 17 444 1.0E-40
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 23 448 5.0E-40
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 19 436 6.0E-40
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 19 437 8.0E-40
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 16 442 2.0E-39
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 22 441 2.0E-39
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 2 440 1.0E-38
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 14 451 3.0E-38
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 19 437 4.0E-38
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 17 438 8.0E-38
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 4 461 8.0E-38
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 18 443 8.0E-38
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 18 437 1.0E-37
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 19 444 2.0E-37
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 18 440 3.0E-37
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 17 437 3.0E-37
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 17 437 3.0E-37
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 16 437 4.0E-37
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 22 437 4.0E-37
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 17 437 5.0E-37
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 23 443 5.0E-37
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 22 437 7.0E-37
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 1 433 9.0E-37
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 23 437 1.0E-36
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 23 512 1.0E-36
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 23 440 2.0E-36
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 26 461 3.0E-36
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1 461 5.0E-36
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 23 445 7.0E-36
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 23 443 8.0E-36
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 15 522 1.0E-35
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 19 437 4.0E-35
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 19 486 6.0E-35
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 22 711 6.0E-35
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 25 461 1.0E-34
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 18 436 1.0E-34
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 23 437 1.0E-34
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 23 436 2.0E-34
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 19 437 2.0E-34
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 22 437 3.0E-34
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 4 436 3.0E-34
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 18 442 3.0E-34
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 17 437 4.0E-34
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 17 437 4.0E-34
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 26 448 4.0E-34
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 23 456 4.0E-34
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 18 442 5.0E-34
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 17 432 6.0E-34
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 22 682 6.0E-34
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1 445 1.0E-33
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 25 461 1.0E-33
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 18 440 1.0E-33
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 15 440 2.0E-33
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 24 492 2.0E-33
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 18 437 4.0E-33
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 23 456 4.0E-33
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 14 437 5.0E-33
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 24 492 5.0E-33
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 25 461 1.0E-32
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 19 451 1.0E-32
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 1 437 2.0E-32
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 18 449 2.0E-32
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 26 443 3.0E-32
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 17 442 7.0E-32
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 26 440 1.0E-31
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 26 492 1.0E-31
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 16 443 1.0E-31
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 25 438 2.0E-31
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 89 756 2.0E-31
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 17 495 3.0E-31
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 17 440 4.0E-31
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 26 451 1.0E-30
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 17 440 3.0E-30
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 1 437 3.0E-30
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 22 759 5.0E-30
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 18 450 7.0E-30
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1 461 7.0E-29
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1 461 8.0E-29
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 14 473 1.0E-28
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 1 762 2.0E-28
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 18 440 4.0E-28
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 14 438 4.0E-28
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 23 442 6.0E-28
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 17 450 6.0E-28
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 17 450 7.0E-28
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 17 440 8.0E-28
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 26 464 1.0E-27
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 17 440 1.0E-27
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 1 437 4.0E-27
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 1 437 4.0E-27
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 1 437 4.0E-27
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 15 437 6.0E-27
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 22 437 7.0E-27
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 17 437 7.0E-27
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 26 464 4.0E-26
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 17 437 6.0E-26
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 14 443 1.0E-25
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 14 443 2.0E-25
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 14 443 2.0E-25
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 17 440 1.0E-24
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 17 416 1.0E-24
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 14 353 2.0E-24
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 125 440 2.0E-24
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 15 433 9.0E-24
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 17 444 3.0E-23
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 9 444 3.0E-23
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 23 440 3.0E-23
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 18 436 6.0E-23
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 19 439 2.0E-22
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 17 445 2.0E-22
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 17 441 5.0E-22
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 17 441 5.0E-22
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 17 441 2.0E-21
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 14 345 2.0E-20
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 16 440 3.0E-20
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 125 436 5.0E-20
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 17 452 7.0E-20
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 14 349 1.0E-19
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 13 479 2.0E-19
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 121 447 3.0E-19
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 3 451 3.0E-19
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 19 345 3.0E-19
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 123 437 6.0E-19
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 17 348 7.0E-19
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 19 345 1.0E-18
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 18 436 2.0E-18
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 18 436 2.0E-18
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 23 444 2.0E-18
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 92 443 4.0E-18
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 4 410 6.0E-18
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 123 434 7.0E-18
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 16 350 9.0E-18
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 11 350 1.0E-17
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 17 344 1.0E-17
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 17 344 1.0E-17
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 1 348 2.0E-17
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 1 348 2.0E-17
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 17 345 2.0E-17
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 11 350 3.0E-17
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 17 344 4.0E-17
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 17 344 4.0E-17
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 17 344 4.0E-17
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 17 344 4.0E-17
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 15 344 4.0E-17
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 16 350 4.0E-17
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 15 344 4.0E-17
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 15 344 4.0E-17
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 15 344 4.0E-17
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 16 350 4.0E-17
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 15 344 4.0E-17
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 15 344 4.0E-17
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 4 410 5.0E-17
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 11 350 5.0E-17
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 11 350 5.0E-17
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 15 344 5.0E-17
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 15 344 5.0E-17
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 15 344 5.0E-17
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 15 344 5.0E-17
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 15 344 5.0E-17
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 11 350 5.0E-17
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 102 438 5.0E-17
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 11 350 5.0E-17
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 11 350 6.0E-17
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 11 350 6.0E-17
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 11 350 6.0E-17
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 11 350 6.0E-17
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 11 350 6.0E-17
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 11 350 6.0E-17
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 15 344 6.0E-17
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 11 350 6.0E-17
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 11 350 6.0E-17
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 11 350 6.0E-17
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 11 350 6.0E-17
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 4 410 7.0E-17
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 17 344 9.0E-17
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 26 436 1.0E-16
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 9 438 1.0E-16
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 14 437 1.0E-16
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 14 436 1.0E-16
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 1 348 1.0E-16
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 17 350 1.0E-16
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 17 350 1.0E-16
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 15 291 2.0E-16
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 16 350 2.0E-16
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 17 350 3.0E-16
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 17 344 3.0E-16
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 16 350 4.0E-16
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 17 437 6.0E-16
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 16 350 8.0E-16
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 19 351 9.0E-16
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 10 436 1.0E-15
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 19 351 1.0E-15
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 4 437 2.0E-15
sp|P38137|FAT2_YEAST Peroxisomal-coenzyme A synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCS60 PE=1 SV=1 165 345 3.0E-15
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 14 473 7.0E-15
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 14 336 1.0E-13
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 15 453 2.0E-13
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 19 351 2.0E-13
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 19 351 2.0E-13
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 19 351 2.0E-13
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 19 351 2.0E-13
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 19 351 2.0E-13
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 19 351 2.0E-13
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 17 275 5.0E-13
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 1 350 6.0E-13
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 19 345 6.0E-13
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 23 451 1.0E-12
sp|Q6AYT9|ACSM5_RAT Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Rattus norvegicus GN=Acsm5 PE=2 SV=1 1 350 1.0E-12
sp|Q9BEA2|ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus GN=ACSM1 PE=1 SV=2 29 350 2.0E-12
sp|Q8BGA8|ACSM5_MOUSE Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 1 350 3.0E-12
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 17 438 4.0E-12
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 26 289 4.0E-12
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 5 440 1.0E-11
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 166 465 1.0E-11
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 25 289 2.0E-11
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 125 440 2.0E-11
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 10 348 2.0E-11
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 98 348 6.0E-11
sp|Q6SKG1|ACSM3_RAT Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Rattus norvegicus GN=Acsm3 PE=2 SV=1 29 349 1.0E-10
sp|P0C7M7|ACSM4_HUMAN Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Homo sapiens GN=ACSM4 PE=2 SV=1 69 349 2.0E-10
sp|Q08AH1|ACSM1_HUMAN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Homo sapiens GN=ACSM1 PE=1 SV=1 5 350 2.0E-10
sp|P37693|HETM_NOSS1 Polyketide synthase HetM OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetM PE=3 SV=1 477 690 2.0E-10
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 177 437 6.0E-10
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 69 349 7.0E-10
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 269 442 8.0E-10
sp|Q80W40|ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 29 349 9.0E-10
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 17 434 1.0E-09
sp|Q8K0L3|ACSM2_MOUSE Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Mus musculus GN=Acsm2 PE=1 SV=1 18 350 2.0E-09
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 24 436 2.0E-09
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 89 350 3.0E-09
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 24 433 3.0E-09
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 320 452 4.0E-09
sp|Q3UNX5|ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus GN=Acsm3 PE=1 SV=2 41 349 7.0E-09
sp|Q5REV5|ACSM3_PONAB Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Pongo abelii GN=ACSM3 PE=2 SV=1 29 349 1.0E-08
sp|Q53FZ2|ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens GN=ACSM3 PE=1 SV=2 29 349 2.0E-08
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 40 351 2.0E-08
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 320 442 1.0E-07
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 309 442 1.0E-07
sp|Q68CK6|ACS2B_HUMAN Acyl-coenzyme A synthetase ACSM2B, mitochondrial OS=Homo sapiens GN=ACSM2B PE=1 SV=2 41 349 1.0E-07
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 91 350 1.0E-07
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 174 437 1.0E-07
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 174 345 3.0E-07
sp|Q08AH3|ACS2A_HUMAN Acyl-coenzyme A synthetase ACSM2A, mitochondrial OS=Homo sapiens GN=ACSM2A PE=1 SV=2 39 349 3.0E-07
sp|Q8GQN9|BCLA_THAAR Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 161 350 4.0E-07
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 172 351 5.0E-07
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 95 345 6.0E-07
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 95 345 6.0E-07
sp|Q9LQS1|AAE8_ARATH Probable acyl-activating enzyme 8 OS=Arabidopsis thaliana GN=AAE8 PE=2 SV=1 186 351 7.0E-07
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 34 345 7.0E-07
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 30 348 2.0E-06
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 94 350 2.0E-06
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 88 350 3.0E-06
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 230 453 4.0E-06
sp|Q7XXL2|4CLL9_ORYSJ 4-coumarate--CoA ligase-like 9 OS=Oryza sativa subsp. japonica GN=4CLL9 PE=2 SV=2 107 349 4.0E-06
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 174 353 5.0E-06
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 95 345 9.0E-06
sp|O31826|YNGI_BACSU Putative acyl-CoA synthetase YngI OS=Bacillus subtilis (strain 168) GN=yngI PE=3 SV=1 161 353 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11188
MNYAASKIRMLGLGQVKVLSQTSIGFDMAVAQAFNAFAAGGTLVVAPLKARGDPSMISKIMLDEAIEFTLCTPSE
YLMLATYAADCLRQCTSWRHACSGGEVVTQRLVHALQRLELPNLAFTDCYGPTEVSCATTFRTIPLQSAMSSAGG
GDGEGVNSVVGRAIPNTAVYIVGDDGNTALPPGMAGEICVGGAGVAMGYLDDGLSRDRFAKNPFATPEDVARGHV
VMYKTGDRGYLQPDGFLTFLGRTDGGGTVVKLRGLRIDLDEVAAAILKAAPEDCLADAVVTIRGEPQFLVAHVAL
LPGKSLRADELSSLVSELALPRYMIPSVVVPLDRLPTTSNGKIDRAFLQSVTLPERLDRTEKQAAALTVPEGELR
VMWVQLLGQSAMSASIGPYSDFFTVGGSSLLLVRLQSILRERTGVRLSLQELYQASTLRKMAAAMHKERGQLAEE
KIDWGEETAVPDDVIEVARGLPESPEPRKHDRQVLLTGASTFLGGEILRRLIADEDVGKVHCIAVSDDERHKLPS
REHEKVVVYGGSLTSPTLGLSGKETAFLRASVDQILHAAVQGHCMNNYSSVRQALYVSTQWLVRLALPRRIPFHF
VSAPRVVLLSGRHEGAPVSMAGHAPPTDGSQGVTASKWASERFLEEAARAAALPVVVHRHCALVGERAPADDVMN
SVVRFSRLSRKVPDVAAAEGFFDFKDVVAVAAEMASEPPAEPGPVRFRHHSSGVRVPFGRFADRMRALYGGEFEL
IDPSTWLRAAAAHGMGDLLVMHLRANMESGKPMVFPYLGA*
Coding >Hirsu2|11188
ATGAATTACGCTGCTTCAAAGATTCGGATGTTGGGTCTGGGCCAGGTCAAGGTCCTAAGCCAGACCTCCATTGGC
TTCGACATGGCCGTTGCCCAGGCATTCAACGCCTTCGCCGCAGGGGGCACGCTTGTCGTCGCTCCCTTGAAGGCG
CGCGGCGATCCAAGCATGATATCGAAGATCATGCTCGACGAGGCCATCGAGTTCACTCTTTGTACCCCTTCCGAG
TACCTCATGCTCGCCACCTATGCCGCCGACTGTCTCCGACAGTGCACTTCGTGGCGCCACGCCTGCTCCGGGGGA
GAGGTTGTCACGCAGAGGCTCGTGCATGCGCTACAGCGTCTGGAGCTCCCGAATCTTGCTTTCACCGACTGCTAC
GGGCCTACCGAGGTCTCGTGCGCGACCACGTTTCGAACGATTCCGTTGCAGTCTGCCATGAGCTCGGCCGGCGGC
GGCGATGGAGAGGGTGTTAACAGCGTCGTCGGAAGGGCCATACCAAACACAGCGGTCTACATTGTCGGCGATGAC
GGCAACACGGCGCTGCCGCCCGGCATGGCGGGAGAGATCTGCGTTGGTGGCGCCGGCGTCGCGATGGGCTACTTG
GACGACGGTCTGAGCCGGGACAGGTTCGCCAAGAACCCCTTTGCGACTCCCGAGGACGTTGCCCGAGGTCACGTC
GTCATGTACAAGACGGGAGACAGGGGCTATCTCCAGCCGGACGGATTCCTCACGTTCCTGGGCCGAACAGACGGC
GGCGGGACGGTGGTGAAGCTCCGCGGTCTGCGGATCGATCTGGACGAGGTTGCGGCCGCCATCCTCAAAGCTGCG
CCAGAAGACTGCCTGGCCGATGCTGTCGTGACGATCCGAGGAGAGCCACAGTTTCTCGTCGCGCATGTGGCGTTG
CTGCCTGGGAAGAGTCTGAGAGCCGACGAGTTGAGCTCGCTTGTTAGCGAACTGGCGCTGCCACGATACATGATT
CCGTCTGTGGTAGTGCCCTTGGACCGTTTGCCAACAACGTCCAACGGAAAGATTGATCGAGCGTTCTTACAGTCC
GTCACGCTCCCCGAACGACTGGATCGAACGGAGAAGCAGGCGGCGGCTCTGACGGTGCCCGAGGGAGAGCTCCGG
GTGATGTGGGTGCAGCTCCTGGGCCAGAGCGCGATGTCAGCCAGCATCGGCCCGTACTCGGATTTCTTCACCGTG
GGGGGGAGCTCGCTCCTCCTCGTGCGCCTGCAGAGCATCCTCAGGGAAAGGACGGGTGTCAGGCTGTCACTGCAG
GAGCTCTACCAGGCGTCCACGTTGCGAAAGATGGCGGCGGCGATGCACAAGGAACGGGGCCAACTGGCGGAGGAG
AAGATTGATTGGGGCGAGGAGACGGCGGTCCCCGACGACGTCATCGAAGTCGCTCGAGGCCTGCCGGAGTCGCCC
GAGCCCCGAAAACATGACCGACAGGTTCTTCTTACCGGGGCATCGACGTTCCTAGGCGGCGAGATCCTGCGACGG
CTGATTGCCGACGAAGACGTCGGCAAGGTCCACTGCATCGCCGTCTCGGACGACGAGCGACACAAGCTGCCGTCG
AGGGAGCACGAGAAGGTGGTCGTCTATGGCGGCAGTCTGACGAGCCCTACTCTGGGCCTGTCAGGCAAGGAGACG
GCCTTCCTGCGGGCGAGCGTGGACCAGATCCTACACGCGGCCGTCCAGGGCCACTGCATGAACAACTACAGCTCG
GTCAGACAGGCGCTGTACGTCTCGACGCAGTGGCTGGTCAGGCTGGCGCTCCCGCGGAGGATCCCCTTTCACTTC
GTCTCCGCGCCGCGCGTTGTCCTGCTGTCGGGCCGGCACGAGGGAGCGCCGGTCTCGATGGCCGGGCACGCGCCC
CCGACGGACGGCTCGCAGGGCGTCACGGCGTCCAAGTGGGCGAGCGAACGCTTCCTGGAGGAGGCGGCGCGGGCG
GCGGCGCTGCCGGTCGTGGTGCACCGGCACTGCGCCCTGGTCGGCGAGCGGGCACCGGCCGACGACGTCATGAAC
TCGGTCGTGCGCTTCTCCCGGCTCAGCCGCAAGGTGCCGGACGTGGCCGCCGCCGAGGGCTTCTTCGACTTCAAG
GACGTCGTCGCGGTGGCGGCGGAGATGGCGAGCGAGCCGCCGGCCGAGCCCGGACCCGTCCGCTTCCGCCACCAC
AGCAGCGGCGTGCGCGTGCCGTTCGGCCGGTTCGCGGACCGGATGCGCGCTCTCTACGGGGGCGAGTTCGAGCTT
ATCGACCCGTCGACCTGGTTGCGGGCCGCGGCGGCGCACGGCATGGGGGATCTGCTCGTGATGCACCTCAGGGCC
AACATGGAGAGCGGCAAGCCGATGGTGTTTCCATACCTCGGCGCGTGA
Transcript >Hirsu2|11188
ATGAATTACGCTGCTTCAAAGATTCGGATGTTGGGTCTGGGCCAGGTCAAGGTCCTAAGCCAGACCTCCATTGGC
TTCGACATGGCCGTTGCCCAGGCATTCAACGCCTTCGCCGCAGGGGGCACGCTTGTCGTCGCTCCCTTGAAGGCG
CGCGGCGATCCAAGCATGATATCGAAGATCATGCTCGACGAGGCCATCGAGTTCACTCTTTGTACCCCTTCCGAG
TACCTCATGCTCGCCACCTATGCCGCCGACTGTCTCCGACAGTGCACTTCGTGGCGCCACGCCTGCTCCGGGGGA
GAGGTTGTCACGCAGAGGCTCGTGCATGCGCTACAGCGTCTGGAGCTCCCGAATCTTGCTTTCACCGACTGCTAC
GGGCCTACCGAGGTCTCGTGCGCGACCACGTTTCGAACGATTCCGTTGCAGTCTGCCATGAGCTCGGCCGGCGGC
GGCGATGGAGAGGGTGTTAACAGCGTCGTCGGAAGGGCCATACCAAACACAGCGGTCTACATTGTCGGCGATGAC
GGCAACACGGCGCTGCCGCCCGGCATGGCGGGAGAGATCTGCGTTGGTGGCGCCGGCGTCGCGATGGGCTACTTG
GACGACGGTCTGAGCCGGGACAGGTTCGCCAAGAACCCCTTTGCGACTCCCGAGGACGTTGCCCGAGGTCACGTC
GTCATGTACAAGACGGGAGACAGGGGCTATCTCCAGCCGGACGGATTCCTCACGTTCCTGGGCCGAACAGACGGC
GGCGGGACGGTGGTGAAGCTCCGCGGTCTGCGGATCGATCTGGACGAGGTTGCGGCCGCCATCCTCAAAGCTGCG
CCAGAAGACTGCCTGGCCGATGCTGTCGTGACGATCCGAGGAGAGCCACAGTTTCTCGTCGCGCATGTGGCGTTG
CTGCCTGGGAAGAGTCTGAGAGCCGACGAGTTGAGCTCGCTTGTTAGCGAACTGGCGCTGCCACGATACATGATT
CCGTCTGTGGTAGTGCCCTTGGACCGTTTGCCAACAACGTCCAACGGAAAGATTGATCGAGCGTTCTTACAGTCC
GTCACGCTCCCCGAACGACTGGATCGAACGGAGAAGCAGGCGGCGGCTCTGACGGTGCCCGAGGGAGAGCTCCGG
GTGATGTGGGTGCAGCTCCTGGGCCAGAGCGCGATGTCAGCCAGCATCGGCCCGTACTCGGATTTCTTCACCGTG
GGGGGGAGCTCGCTCCTCCTCGTGCGCCTGCAGAGCATCCTCAGGGAAAGGACGGGTGTCAGGCTGTCACTGCAG
GAGCTCTACCAGGCGTCCACGTTGCGAAAGATGGCGGCGGCGATGCACAAGGAACGGGGCCAACTGGCGGAGGAG
AAGATTGATTGGGGCGAGGAGACGGCGGTCCCCGACGACGTCATCGAAGTCGCTCGAGGCCTGCCGGAGTCGCCC
GAGCCCCGAAAACATGACCGACAGGTTCTTCTTACCGGGGCATCGACGTTCCTAGGCGGCGAGATCCTGCGACGG
CTGATTGCCGACGAAGACGTCGGCAAGGTCCACTGCATCGCCGTCTCGGACGACGAGCGACACAAGCTGCCGTCG
AGGGAGCACGAGAAGGTGGTCGTCTATGGCGGCAGTCTGACGAGCCCTACTCTGGGCCTGTCAGGCAAGGAGACG
GCCTTCCTGCGGGCGAGCGTGGACCAGATCCTACACGCGGCCGTCCAGGGCCACTGCATGAACAACTACAGCTCG
GTCAGACAGGCGCTGTACGTCTCGACGCAGTGGCTGGTCAGGCTGGCGCTCCCGCGGAGGATCCCCTTTCACTTC
GTCTCCGCGCCGCGCGTTGTCCTGCTGTCGGGCCGGCACGAGGGAGCGCCGGTCTCGATGGCCGGGCACGCGCCC
CCGACGGACGGCTCGCAGGGCGTCACGGCGTCCAAGTGGGCGAGCGAACGCTTCCTGGAGGAGGCGGCGCGGGCG
GCGGCGCTGCCGGTCGTGGTGCACCGGCACTGCGCCCTGGTCGGCGAGCGGGCACCGGCCGACGACGTCATGAAC
TCGGTCGTGCGCTTCTCCCGGCTCAGCCGCAAGGTGCCGGACGTGGCCGCCGCCGAGGGCTTCTTCGACTTCAAG
GACGTCGTCGCGGTGGCGGCGGAGATGGCGAGCGAGCCGCCGGCCGAGCCCGGACCCGTCCGCTTCCGCCACCAC
AGCAGCGGCGTGCGCGTGCCGTTCGGCCGGTTCGCGGACCGGATGCGCGCTCTCTACGGGGGCGAGTTCGAGCTT
ATCGACCCGTCGACCTGGTTGCGGGCCGCGGCGGCGCACGGCATGGGGGATCTGCTCGTGATGCACCTCAGGGCC
AACATGGAGAGCGGCAAGCCGATGGTGTTTCCATACCTCGGCGCGTGA
Gene >Hirsu2|11188
ATGAATTACGCTGCTTCAAAGATTCGGATGTTGGGTCTGGGCCAGGTCAAGGTCCTAAGCCAGACCTCCATTGGC
TTCGACATGGCCGTTGCCCAGGCATTCAACGCCTTCGCCGCAGGGGGCACGCTTGTCGTCGCTCCCTTGAAGGCG
CGCGGCGATCCAAGCATGATATCGAAGATCATGCTCGACGAGGCCATCGAGTTCACTCTTTGTACCCCTTCCGAG
TACCTCATGCTCGCCACCTATGCCGCCGACTGTCTCCGACAGTGCACTTCGTGGCGCCACGCCTGCTCCGGGGGA
GAGGTTGTCACGCAGAGGCTCGTGCATGCGCTACAGCGTCTGGAGCTCCCGAATCTTGCTTTCACCGACTGCTAC
GGGCCTACCGAGGTCTCGTGCGCGACCACGTTTCGAACGATTCCGTTGCAGTCTGCCATGAGCTCGGCCGGCGGC
GGCGATGGAGAGGGTGTTAACAGCGTCGTCGGAAGGGCCATACCAAACACAGCGGTCTACATTGTCGGCGATGAC
GGCAACACGGCGCTGCCGCCCGGCATGGCGGGAGAGATCTGCGTTGGTGGCGCCGGCGTCGCGATGGGCTACTTG
GACGACGGTCTGAGCCGGGACAGGTTCGCCAAGAACCCCTTTGCGACTCCCGAGGACGTTGCCCGAGGTCACGTC
GTCATGTACAAGACGGGAGACAGGGGCTATCTCCAGCCGGACGGATTCCTCACGTTCCTGGGCCGAACAGACGGC
GGCGGGACGGTGGTGAAGCTCCGCGGTCTGCGGATCGATCTGGACGAGGTTGCGGCCGCCATCCTCAAAGCTGCG
CCAGAAGACTGCCTGGCCGATGCTGTCGTGACGATCCGAGGAGAGCCACAGTTTCTCGTCGCGCATGTGGCGTTG
CTGCCTGGGAAGAGTCTGAGAGCCGACGAGTTGAGCTCGCTTGTTAGCGAACTGGCGCTGCCACGATACATGATT
CCGTCTGTGGTAGTGCCCTTGGACCGTTTGCCAACAACGTCCAACGGAAAGATTGATCGAGCGTTCTTACAGTCC
GTCACGCTCCCCGAACGACTGGATCGAACGGAGAAGCAGGCGGCGGCTCTGACGGTGCCCGAGGGAGAGCTCCGG
GTGATGTGGGTGCAGCTCCTGGGCCAGAGCGCGATGTCAGCCAGCATCGGCCCGTACTCGGATTTCTTCACCGTG
GGGGGGAGCTCGCTCCTCCTCGTGCGCCTGCAGAGCATCCTCAGGGAAAGGACGGGTGTCAGGCTGTCACTGCAG
GAGCTCTACCAGGCGTCCACGTTGCGAAAGATGGCGGCGGCGATGCACAAGGAACGGGGCCAACTGGCGGAGGAG
AAGATTGATTGGGGCGAGGAGACGGCGGTCCCCGACGACGTCATCGAAGTCGCTCGAGGCCTGCCGGAGTCGCCC
GAGCCCCGAAAACATGACCGACAGGTTCTTCTTACCGGGGCATCGACGTTCCTAGGCGGCGAGATCCTGCGACGG
CTGATTGCCGACGAAGACGTCGGCAAGGTCCACTGCATCGCCGTCTCGGACGACGAGCGACACAAGCTGCCGTCG
AGGGAGCACGAGAAGGTGGTCGTCTATGGCGGCAGTCTGACGAGCCCTACTCTGGGCCTGTCAGGCAAGGAGACG
GCCTTCCTGCGGGCGAGCGTGGACCAGATCCTACACGCGGCCGTCCAGGGCCACTGCATGAACAACTACAGCTCG
GTCAGACAGGCGCTGTACGTCTCGACGCAGTGGCTGGTCAGGCTGGCGCTCCCGCGGAGGATCCCCTTTCACTTC
GTCTCCGCGCCGCGCGTTGTCCTGCTGTCGGGCCGGCACGAGGGAGCGCCGGTCTCGATGGCCGGGCACGCGCCC
CCGACGGACGGCTCGCAGGGCGTCACGGCGTCCAAGTGGGCGAGCGAACGCTTCCTGGAGGAGGCGGCGCGGGCG
GCGGCGCTGCCGGTCGTGGTGCACCGGCACTGCGCCCTGGTCGGCGAGCGGGCACCGGCCGACGACGTCATGAAC
TCGGTCGTGCGCTTCTCCCGGCTCAGCCGCAAGGTGCCGGACGTGGCCGCCGCCGAGGGCTTCTTCGACTTCAAG
GACGTCGTCGCGGTGGCGGCGGAGATGGCGAGCGAGCCGCCGGCCGAGCCCGGACCCGTCCGCTTCCGCCACCAC
AGCAGCGGCGTGCGCGTGCCGTTCGGCCGGTTCGCGGACCGGATGCGCGCTCTCTACGGGGGCGAGTTCGAGCTT
ATCGACCCGTCGACCTGGTTGCGGGCCGCGGCGGCGCACGGCATGGGGGATCTGCTCGTGATGCACCTCAGGGCC
AACATGGAGAGCGGCAAGCCGATGGTGTTTCCATACCTCGGCGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail