Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11187
Gene name
LocationContig_98:32941..33699
Strand+
Gene length (bp)758
Transcript length (bp)684
Coding sequence length (bp)684
Protein length (aa) 228

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08659 KR KR domain 2.8E-41 1 156
PF00106 adh_short short chain dehydrogenase 4.6E-07 3 139

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1 200 2.0E-39
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1 164 5.0E-35
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 1 199 7.0E-29
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 1 199 4.0E-28
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1 198 9.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1 200 2.0E-39
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1 164 5.0E-35
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 1 199 7.0E-29
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 1 199 4.0E-28
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1 198 9.0E-21
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 1 160 6.0E-18
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 1 160 6.0E-18
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 1 160 6.0E-18
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 5 189 2.0E-16
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 5 160 3.0E-16
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 5 160 3.0E-16
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 5 193 7.0E-16
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 1 201 3.0E-15
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 1 166 1.0E-14
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 1 160 3.0E-14
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 1 160 3.0E-14
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 1 160 3.0E-14
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 1 160 3.0E-14
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 1 160 3.0E-14
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 1 177 9.0E-14
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 1 177 2.0E-13
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 1 177 2.0E-13
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 3 161 4.0E-13
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 25 185 1.0E-12
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 9 160 1.0E-12
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 5 155 1.0E-12
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 5 160 1.0E-12
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 5 163 1.0E-12
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 23 150 1.0E-11
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 1 149 2.0E-11
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 1 160 4.0E-11
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 1 165 5.0E-11
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 1 164 6.0E-10
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 1 164 6.0E-10
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 1 141 1.0E-09
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 1 164 2.0E-09
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 4 163 3.0E-09
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 1 160 6.0E-09
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 1 160 6.0E-09
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 36 166 3.0E-08
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 23 150 5.0E-08
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 9 161 9.0E-08
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 24 174 2.0E-07
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 24 174 2.0E-07
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 24 174 2.0E-07
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 5 160 4.0E-07
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 1 155 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11187
MVRGGARHIVLASRSPTKDPHWILELRSTGADIRVVKMDVTDQAQVSETVAMLRRTMPEIGGVANAALVFEAGIF
VNFSADNVARQLKPKVDGTVHLDREFAHDNLDFFLTFGSLATVCGNPGQSLYHAGNCFMASLVEKRRRRGQAASI
LNFGLLVDVGYVARMDRADGTDIEGTLRSLLLTPLSEAEFHHLVLQGIVLSAAMGRQSLLLAHDPRPGDLDKFGT
VQ*
Coding >Hirsu2|11187
ATGGTTCGGGGCGGTGCTCGCCACATCGTCCTGGCCAGTCGTAGTCCTACCAAAGATCCGCACTGGATCTTGGAG
CTTCGCTCGACTGGCGCCGACATTCGCGTCGTCAAGATGGACGTGACCGACCAGGCGCAGGTCAGCGAGACAGTC
GCCATGCTGCGCCGAACCATGCCCGAGATCGGGGGCGTGGCAAATGCTGCTCTTGTCTTCGAAGCAGGCATCTTC
GTCAACTTCTCGGCCGACAACGTGGCAAGGCAGCTCAAGCCCAAGGTGGACGGCACCGTCCATCTAGACAGAGAG
TTTGCTCACGACAATCTCGACTTCTTCCTGACGTTCGGCAGCTTGGCCACAGTGTGCGGAAATCCAGGCCAGAGT
CTCTACCATGCGGGCAATTGTTTCATGGCGAGCCTGGTCGAGAAGAGACGACGTCGCGGCCAGGCCGCCTCGATC
CTCAACTTCGGCTTGCTTGTCGACGTCGGCTACGTGGCGAGGATGGATCGAGCCGATGGCACGGACATCGAGGGG
ACCCTGCGCTCCTTGCTGCTGACGCCTCTGTCCGAGGCCGAGTTCCACCATCTCGTGCTTCAGGGCATCGTCCTC
TCGGCCGCCATGGGTCGACAAAGCTTGCTTCTCGCACATGATCCACGCCCCGGCGACCTCGACAAGTTCGGCACC
GTCCAATGA
Transcript >Hirsu2|11187
ATGGTTCGGGGCGGTGCTCGCCACATCGTCCTGGCCAGTCGTAGTCCTACCAAAGATCCGCACTGGATCTTGGAG
CTTCGCTCGACTGGCGCCGACATTCGCGTCGTCAAGATGGACGTGACCGACCAGGCGCAGGTCAGCGAGACAGTC
GCCATGCTGCGCCGAACCATGCCCGAGATCGGGGGCGTGGCAAATGCTGCTCTTGTCTTCGAAGCAGGCATCTTC
GTCAACTTCTCGGCCGACAACGTGGCAAGGCAGCTCAAGCCCAAGGTGGACGGCACCGTCCATCTAGACAGAGAG
TTTGCTCACGACAATCTCGACTTCTTCCTGACGTTCGGCAGCTTGGCCACAGTGTGCGGAAATCCAGGCCAGAGT
CTCTACCATGCGGGCAATTGTTTCATGGCGAGCCTGGTCGAGAAGAGACGACGTCGCGGCCAGGCCGCCTCGATC
CTCAACTTCGGCTTGCTTGTCGACGTCGGCTACGTGGCGAGGATGGATCGAGCCGATGGCACGGACATCGAGGGG
ACCCTGCGCTCCTTGCTGCTGACGCCTCTGTCCGAGGCCGAGTTCCACCATCTCGTGCTTCAGGGCATCGTCCTC
TCGGCCGCCATGGGTCGACAAAGCTTGCTTCTCGCACATGATCCACGCCCCGGCGACCTCGACAAGTTCGGCACC
GTCCAATGA
Gene >Hirsu2|11187
ATGGTTCGGGGCGGTGCTCGCCACATCGTCCTGGCCAGTCGTAGTCCTACCAAAGATCCGCACTGGATCTTGGAG
CTTCGCTCGACTGGCGCCGACATTCGCGTCGTCAAGATGGACGTGACCGACCAGGCGCAGGTCAGCGAGACAGTC
GCCATGCTGCGCCGAACCATGCCCGAGATCGGGGGCGTGGCAAATGCTGCTCTTGTCTTCGAAGCAGGCATCTTC
GTCAACTTCTCGGCCGACAACGTGGCAAGGCAGCTCAAGCCCAAGGTGGACGGCACCGTCCATCTAGACAGAGAG
TTTGCTCACGACAATCTCGACTTCTTCCTGACGTTCGGCAGCTTGGCCACAGTGTGCGGAAATCCAGGCCAGAGT
CTCTACCATGCGGGCAATTGTTTCATGGCGAGCCTGGTCGAGAAGAGACGACGTCGCGGCCAGGCCGCCTCGATC
CTCAACTTCGGCTTGCTTGTCGACGTCGGCTACGTGGCGAGGATGGATCGAGCCGATGGCACGGACATCGAGGGG
ACCCTGCGCTCCTTGCTGCTGACGCCTCTGTCCGAGGCCGAGTTCCACCATCTCGTGCTTCAGGGCATCGTGTCC
GGTCGCCCGGGCTCAGCCAGCGGAGAGGTCATCGTGGGGATGACGCCGTATATCGATGACGGGAAAGCAGCCTCT
CGGCCGCCATGGGTCGACAAAGCTTGCTTCTCGCACATGATCCACGCCCCGGCGACCTCGACAAGTTCGGCACCG
TCCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail