Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11183
Gene name
LocationContig_98:16695..20331
Strand-
Gene length (bp)3636
Transcript length (bp)3579
Coding sequence length (bp)3579
Protein length (aa) 1193

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02626 CT_A_B Carboxyltransferase domain, subdomain A and B 3.9E-88 453 729
PF02786 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP binding domain 9.3E-62 93 296
PF02682 CT_C_D Carboxyltransferase domain, subdomain C and D 1.9E-34 786 999
PF02785 Biotin_carb_C Biotin carboxylase C-terminal domain 4.7E-31 317 421
PF00289 Biotin_carb_N Biotin carboxylase, N-terminal domain 1.5E-26 1 87
PF00364 Biotin_lipoyl Biotin-requiring enzyme 3.8E-11 1117 1183
PF13533 Biotin_lipoyl_2 Biotin-lipoyl like 7.6E-06 1153 1186
PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus 2.5E-09 122 269

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32528|DUR1_YEAST Urea amidolyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUR1,2 PE=1 SV=2 1 1184 0.0E+00
sp|A5H0J2|DUR1_LACKL Urea amidolyase OS=Lachancea kluyveri GN=DUR1,2 PE=3 SV=1 1 1183 0.0E+00
sp|P38095|LAMA_EMENI Putative urea carboxylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lamA PE=2 SV=2 1 1183 0.0E+00
sp|Q9KDS9|ACCC_BACHD Biotin carboxylase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=accC PE=3 SV=1 1 417 1.0E-105
sp|Q42523|MCCA_ARATH Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Arabidopsis thaliana GN=MCCA PE=1 SV=2 1 429 2.0E-102
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32528|DUR1_YEAST Urea amidolyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUR1,2 PE=1 SV=2 1 1184 0.0E+00
sp|A5H0J2|DUR1_LACKL Urea amidolyase OS=Lachancea kluyveri GN=DUR1,2 PE=3 SV=1 1 1183 0.0E+00
sp|P38095|LAMA_EMENI Putative urea carboxylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lamA PE=2 SV=2 1 1183 0.0E+00
sp|Q9KDS9|ACCC_BACHD Biotin carboxylase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=accC PE=3 SV=1 1 417 1.0E-105
sp|Q42523|MCCA_ARATH Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Arabidopsis thaliana GN=MCCA PE=1 SV=2 1 429 2.0E-102
sp|Q42777|MCCA_SOYBN Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Glycine max GN=MCCA PE=1 SV=2 1 432 3.0E-99
sp|O34544|ACCC2_BACSU Biotin carboxylase 2 OS=Bacillus subtilis (strain 168) GN=accC2 PE=3 SV=1 1 424 6.0E-99
sp|P49787|ACCC1_BACSU Biotin carboxylase 1 OS=Bacillus subtilis (strain 168) GN=accC1 PE=3 SV=3 1 423 2.0E-96
sp|Q2QMG2|MCCA_ORYSJ Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Oryza sativa subsp. japonica GN=MCCA PE=2 SV=2 1 423 5.0E-96
sp|Q5I0C3|MCCA_RAT Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Rattus norvegicus GN=Mccc1 PE=1 SV=1 1 417 9.0E-96
sp|P9WPQ3|BCCA_MYCTU Acetyl-/propionyl-coenzyme A carboxylase alpha chain OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=accA1 PE=1 SV=1 1 421 2.0E-94
sp|P9WPQ2|BCCA_MYCTO Acetyl-/propionyl-coenzyme A carboxylase alpha chain OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=accA1 PE=3 SV=1 1 421 2.0E-94
sp|P0A509|BCCA_MYCBO Acetyl-/propionyl-coenzyme A carboxylase alpha chain OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=accA1 PE=3 SV=1 1 421 2.0E-94
sp|Q96RQ3|MCCA_HUMAN Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Homo sapiens GN=MCCC1 PE=1 SV=3 1 417 4.0E-94
sp|Q58626|PYCA_METJA Pyruvate carboxylase subunit A OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pycA PE=1 SV=1 1 421 2.0E-93
sp|Q54KE6|MCCA_DICDI Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Dictyostelium discoideum GN=mccA PE=3 SV=1 2 417 4.0E-92
sp|O27939|PYCA_METTH Pyruvate carboxylase subunit A OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pycA PE=1 SV=1 1 423 9.0E-91
sp|Q99MR8|MCCA_MOUSE Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial OS=Mus musculus GN=Mccc1 PE=1 SV=2 1 417 1.0E-90
sp|Q06862|ACCC_NOSS1 Biotin carboxylase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=accC PE=3 SV=1 1 417 2.0E-89
sp|P05165|PCCA_HUMAN Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Homo sapiens GN=PCCA PE=1 SV=4 1 420 9.0E-89
sp|O30019|PYCA_ARCFU Pyruvate carboxylase subunit A OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pycA PE=3 SV=1 1 421 3.0E-86
sp|B9HBA8|ACCC1_POPTR Biotin carboxylase 1, chloroplastic OS=Populus trichocarpa GN=POPTRDRAFT_831870 PE=2 SV=1 1 417 7.0E-85
sp|Q91ZA3|PCCA_MOUSE Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus GN=Pcca PE=1 SV=2 1 420 8.0E-85
sp|Q05920|PYC_MOUSE Pyruvate carboxylase, mitochondrial OS=Mus musculus GN=Pc PE=1 SV=1 1 421 1.0E-84
sp|P11498|PYC_HUMAN Pyruvate carboxylase, mitochondrial OS=Homo sapiens GN=PC PE=1 SV=2 1 421 2.0E-84
sp|B9N843|ACCC2_POPTR Biotin carboxylase 2, chloroplastic OS=Populus trichocarpa GN=POPTR_0018s14250g PE=2 SV=2 1 417 3.0E-84
sp|Q612F5|PCCA_CAEBR Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Caenorhabditis briggsae GN=pcca-1 PE=3 SV=1 1 420 4.0E-84
sp|P52873|PYC_RAT Pyruvate carboxylase, mitochondrial OS=Rattus norvegicus GN=Pc PE=1 SV=2 1 421 5.0E-84
sp|Q19842|PCCA_CAEEL Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Caenorhabditis elegans GN=pcca-1 PE=1 SV=1 1 420 5.0E-84
sp|Q29RK2|PYC_BOVIN Pyruvate carboxylase, mitochondrial OS=Bos taurus GN=PC PE=2 SV=2 1 421 6.0E-84
sp|O04983|ACCC_ARATH Biotin carboxylase, chloroplastic OS=Arabidopsis thaliana GN=CAC2 PE=1 SV=1 1 417 5.0E-83
sp|P14882|PCCA_RAT Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Rattus norvegicus GN=Pcca PE=1 SV=3 1 420 7.0E-83
sp|P46392|BCCA_MYCLE Acetyl-/propionyl-coenzyme A carboxylase alpha chain OS=Mycobacterium leprae (strain TN) GN=bccA PE=3 SV=2 5 406 1.0E-82
sp|D3DJ42|2OCS_HYDTT 2-oxoglutarate carboxylase small subunit OS=Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) GN=cfiB PE=1 SV=1 1 421 2.0E-81
sp|P43873|ACCC_HAEIN Biotin carboxylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=accC PE=1 SV=1 1 421 5.0E-81
sp|Q9KWU4|PYC_BACSU Pyruvate carboxylase OS=Bacillus subtilis (strain 168) GN=pyc PE=3 SV=1 1 446 3.0E-79
sp|P37798|ACCC_PSEAE Biotin carboxylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=accC PE=1 SV=1 1 428 1.0E-78
sp|O17732|PYC1_CAEEL Pyruvate carboxylase 1 OS=Caenorhabditis elegans GN=pyc-1 PE=1 SV=1 5 428 4.0E-78
sp|O52058|ACCC_ALLVD Biotin carboxylase OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=accC PE=3 SV=2 1 424 1.0E-77
sp|P24182|ACCC_ECOLI Biotin carboxylase OS=Escherichia coli (strain K12) GN=accC PE=1 SV=2 1 421 2.0E-75
sp|Q8X9B6|ACCC_ECO57 Biotin carboxylase OS=Escherichia coli O157:H7 GN=accC PE=3 SV=1 1 421 4.0E-75
sp|Q8X1T3|PYC_PICAN Pyruvate carboxylase OS=Pichia angusta GN=PYC PE=3 SV=1 1 421 7.0E-73
sp|Q9HES8|PYC_ASPNG Pyruvate carboxylase OS=Aspergillus niger GN=pyc PE=3 SV=1 1 421 2.0E-72
sp|P32327|PYC2_YEAST Pyruvate carboxylase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PYC2 PE=1 SV=2 1 421 1.0E-71
sp|O93918|PYC_ASPTE Pyruvate carboxylase OS=Aspergillus terreus GN=pyc PE=2 SV=1 1 421 3.0E-70
sp|Q0CLK1|PYC_ASPTN Pyruvate carboxylase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pyc PE=3 SV=2 1 421 3.0E-70
sp|P11154|PYC1_YEAST Pyruvate carboxylase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PYC1 PE=1 SV=2 1 421 2.0E-69
sp|Q9UUE1|PYC_SCHPO Pyruvate carboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pyr1 PE=3 SV=1 1 421 2.0E-69
sp|P78992|PYC_PICPA Pyruvate carboxylase OS=Komagataella pastoris GN=PYC1 PE=3 SV=1 1 421 5.0E-69
sp|Q54J08|ACAC_DICDI Acetyl-CoA carboxylase OS=Dictyostelium discoideum GN=accA PE=3 SV=1 2 421 4.0E-59
sp|B3LM95|HFA1_YEAS1 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=HFA1 PE=3 SV=2 3 429 1.0E-54
sp|A6ZMR9|HFA1_YEAS7 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=HFA1 PE=3 SV=2 3 429 2.0E-54
sp|C7GRE4|HFA1_YEAS2 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain JAY291) GN=HFA1 PE=3 SV=2 3 429 2.0E-54
sp|C8ZF72|HFA1_YEAS8 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=HFA1 PE=3 SV=2 3 429 2.0E-54
sp|P32874|HFA1_YEAST Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HFA1 PE=1 SV=2 3 429 2.0E-54
sp|Q38970|ACC1_ARATH Acetyl-CoA carboxylase 1 OS=Arabidopsis thaliana GN=ACC1 PE=1 SV=1 18 421 5.0E-54
sp|Q8S6N5|ACC1_ORYSJ Acetyl-CoA carboxylase 1 OS=Oryza sativa subsp. japonica GN=ACC1 PE=3 SV=1 18 421 5.0E-53
sp|F4I1L3|ACC2_ARATH Acetyl-CoA carboxylase 2 OS=Arabidopsis thaliana GN=ACC2 PE=2 SV=1 2 421 5.0E-53
sp|Q00955|ACAC_YEAST Acetyl-CoA carboxylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACC1 PE=1 SV=2 3 421 3.0E-52
sp|O00763|ACACB_HUMAN Acetyl-CoA carboxylase 2 OS=Homo sapiens GN=ACACB PE=1 SV=3 2 424 6.0E-52
sp|B9FK36|ACC2_ORYSJ Acetyl-CoA carboxylase 2 OS=Oryza sativa subsp. japonica GN=ACC2 PE=3 SV=2 2 421 6.0E-52
sp|P78820|ACAC_SCHPO Acetyl-CoA carboxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut6 PE=1 SV=2 18 426 1.0E-49
sp|Q13085|ACACA_HUMAN Acetyl-CoA carboxylase 1 OS=Homo sapiens GN=ACACA PE=1 SV=2 2 421 5.0E-49
sp|Q5SWU9|ACACA_MOUSE Acetyl-CoA carboxylase 1 OS=Mus musculus GN=Acaca PE=1 SV=1 2 421 5.0E-49
sp|P11029|ACAC_CHICK Acetyl-CoA carboxylase OS=Gallus gallus GN=ACAC PE=1 SV=1 2 421 8.0E-49
sp|Q9TTS3|ACACA_BOVIN Acetyl-CoA carboxylase 1 OS=Bos taurus GN=ACACA PE=2 SV=1 2 421 9.0E-49
sp|Q28559|ACACA_SHEEP Acetyl-CoA carboxylase 1 OS=Ovis aries GN=ACACA PE=2 SV=1 2 421 1.0E-48
sp|E9Q4Z2|ACACB_MOUSE Acetyl-CoA carboxylase 2 OS=Mus musculus GN=Acacb PE=1 SV=1 2 426 9.0E-48
sp|P11497|ACACA_RAT Acetyl-CoA carboxylase 1 OS=Rattus norvegicus GN=Acaca PE=1 SV=1 43 421 2.0E-47
sp|Q7WY77|KIPA_BACSU KipI antagonist OS=Bacillus subtilis (strain 168) GN=kipA PE=2 SV=2 430 759 6.0E-30
sp|P75745|YBGK_ECOLI Uncharacterized protein YbgK OS=Escherichia coli (strain K12) GN=ybgK PE=4 SV=1 430 742 6.0E-28
sp|P44298|Y1730_HAEIN Uncharacterized protein HI_1730 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1730 PE=4 SV=1 430 742 1.0E-24
sp|P59448|CARB_BUCBP Carbamoyl-phosphate synthase large chain OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=carB PE=3 SV=1 2 296 2.0E-10
sp|Q91293|CPSM_LITCT Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Lithobates catesbeiana PE=2 SV=1 43 296 3.0E-09
sp|Q8Z9L7|CARB_SALTI Carbamoyl-phosphate synthase large chain OS=Salmonella typhi GN=carB PE=3 SV=3 21 318 5.0E-09
sp|P14846|CARB_SALTY Carbamoyl-phosphate synthase large chain OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=carB PE=3 SV=4 21 318 5.0E-09
sp|Q9KPH9|CARB_VIBCH Carbamoyl-phosphate synthase large chain OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=carB PE=3 SV=1 21 318 1.0E-08
sp|Q8ZIL4|CARB_YERPE Carbamoyl-phosphate synthase large chain OS=Yersinia pestis GN=carB PE=3 SV=3 21 296 3.0E-08
sp|P00968|CARB_ECOLI Carbamoyl-phosphate synthase large chain OS=Escherichia coli (strain K12) GN=carB PE=1 SV=2 21 318 3.0E-08
sp|Q8FLB0|CARB_ECOL6 Carbamoyl-phosphate synthase large chain OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=carB PE=3 SV=3 21 318 3.0E-08
sp|P63738|CARB_SHIFL Carbamoyl-phosphate synthase large chain OS=Shigella flexneri GN=carB PE=3 SV=2 21 318 3.0E-08
sp|P63737|CARB_ECO57 Carbamoyl-phosphate synthase large chain OS=Escherichia coli O157:H7 GN=carB PE=3 SV=2 21 318 3.0E-08
sp|Q87SF3|CARB_VIBPA Carbamoyl-phosphate synthase large chain OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=carB PE=3 SV=1 21 296 4.0E-08
sp|C1A4I5|CARB_GEMAT Carbamoyl-phosphate synthase large chain OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=carB PE=3 SV=1 68 334 4.0E-08
sp|Q1AVY9|CARB_RUBXD Carbamoyl-phosphate synthase large chain OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=carB PE=3 SV=1 41 296 2.0E-07
sp|P46537|CARB_BACCL Carbamoyl-phosphate synthase pyrimidine-specific large chain OS=Bacillus caldolyticus GN=pyrAB PE=3 SV=1 43 296 2.0E-07
sp|Q7MNU0|CARB_VIBVY Carbamoyl-phosphate synthase large chain OS=Vibrio vulnificus (strain YJ016) GN=carB PE=3 SV=1 21 296 2.0E-07
sp|Q8DEM2|CARB_VIBVU Carbamoyl-phosphate synthase large chain OS=Vibrio vulnificus (strain CMCP6) GN=carB PE=3 SV=1 21 296 2.0E-07
sp|O50302|CARB_GEOSE Carbamoyl-phosphate synthase pyrimidine-specific large chain OS=Geobacillus stearothermophilus GN=pyrAB PE=3 SV=1 43 296 3.0E-07
sp|Q97FT3|CARB_CLOAB Carbamoyl-phosphate synthase large chain OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=carB PE=3 SV=1 21 328 4.0E-07
sp|C4ZEK2|CARB_EUBR3 Carbamoyl-phosphate synthase large chain OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=carB PE=3 SV=1 72 296 6.0E-07
sp|A2BJL3|CARB_HYPBU Carbamoyl-phosphate synthase large chain OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=carB PE=3 SV=1 2 296 7.0E-07
sp|Q8C196|CPSM_MOUSE Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Mus musculus GN=Cps1 PE=1 SV=2 115 296 9.0E-07
sp|P07756|CPSM_RAT Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Rattus norvegicus GN=Cps1 PE=1 SV=1 115 296 1.0E-06
sp|A6LPD9|CARB_CLOB8 Carbamoyl-phosphate synthase large chain OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=carB PE=3 SV=1 1 296 3.0E-06
sp|P31327|CPSM_HUMAN Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens GN=CPS1 PE=1 SV=2 115 296 3.0E-06
sp|P08955|PYR1_MESAU CAD protein OS=Mesocricetus auratus GN=CAD PE=1 SV=4 117 296 7.0E-06
sp|P58943|CARB_XANCP Carbamoyl-phosphate synthase large chain OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=carB PE=3 SV=1 21 318 7.0E-06
sp|P27708|PYR1_HUMAN CAD protein OS=Homo sapiens GN=CAD PE=1 SV=3 117 296 7.0E-06
sp|Q8U085|CARB_PYRFU Carbamoyl-phosphate synthase large chain OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=carB PE=3 SV=1 120 296 7.0E-06
sp|B2RQC6|PYR1_MOUSE CAD protein OS=Mus musculus GN=Cad PE=1 SV=1 117 296 7.0E-06
sp|Q7UJ58|CARB_RHOBA Carbamoyl-phosphate synthase large chain OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=carB PE=3 SV=1 1 296 9.0E-06
sp|Q67Q54|CARB_SYMTH Carbamoyl-phosphate synthase large chain OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=carB PE=3 SV=1 67 296 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008716 D-alanine-D-alanine ligase activity Yes
GO:0005524 ATP binding Yes
GO:0032553 ribonucleotide binding No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:0003674 molecular_function No
GO:0008144 drug binding No
GO:0036094 small molecule binding No
GO:0016874 ligase activity No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0016881 acid-amino acid ligase activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11183
MGIEAVSIYTTADAGSPHVRDADTSLRLQGSSVAETYLDGAQVIRLAKSAGADAIIPGYGFLAESADFARAVEEA
GLVWIGPTAEQMSDLGLKHRAREIAVASKVPVVPGSPQLVMSLADAHEEAERLGFPLMLKSTAGGGGIGLRCCRD
AESLADAFDAVQRLAAVNFGEAGVFLERYIENSRHIEVQILGDGTGRVLALSERDCSLQRRHQKVVEECPAFAVP
AQVRASMRASAIRLAAAVKYRNVGTVEYIYDIDTQEYYLLEVNTRLQVEHPVTESVTGLDLVECMLKVARGDCGQ
LFDGETGTISQQGASIEVRVYAESPLENFRPCAGSITSLSLPSSLRVDAWVDVGTEVSTRYDPLLAKLIATGRDR
REALQRLAAGLRETRIEGVQTNLEYLRQIVSWSLFQTGSYTTKSLDFFLFQDSSFNVIESGAMTTIQDYPGRTGL
WSIGIPPSGPMDHLSFRLANRLVGNDQGAAALECTFQGPTLKFHCDTIVAVVGAEAPVTVDGEPRPSNESFPLQA
GQVLAVGSVENGYRMYIAVAGGINTPMVMGSRATFEVGNLGGKNGSKLQPGDIIPIGASPPPSKASEHLPVCPDI
PIPSQPNACWTIGVVPGPHGAPDYFTQDGLATLFAGEWRVHHNSNRLGVRLTGPRPQWARETGGEAGLHPSNIHD
SPYSIGSVSFTGDEAVVLTCDGPSLGGFVVFCVVASSEMWKLGQARPGDTIRLRAMSTESASRLDRELSASIQGL
SELPKLENLLPEDNKGAGVGTPMVGAIECGGDKVLVRQAGDRSMLLEFGEDEIFDLEQSFKIQAFCQNHASTPIE
GIHEVTPGVRTVHLIYASGLSPDTVLARLSRHMCSYVVPTRMLSRTLHLPLAFDDSVSQAAVERYAASIRSEAPW
LPSNVAFLEKLNGLDDLPSILYNASYLVLGLGDVFLGSPCAVPLDPRHRLFGTKYNPSRSFTPRRSVGIGGNYCC
IYATDSPGGYQLVGRTVDIWDAKSVQADQVQLMAKGSGKADVPWMFRPFDVIKFYAVAESELDAAPASKLIKVTE
GELDLEEYQAWLASQKDSIDAMAAHREDSMSKSPFLPELRQPYKPKTASADVADVASSSGLNLAGEKVKAMMPGR
CYNFQVKDGGMVKKGEILMWVESSKMEIEIRSPVSGRCVALGVREGGLVDAGQTLLTIDPAHENGGK*
Coding >Hirsu2|11183
ATGGGCATCGAGGCTGTCTCGATATATACGACCGCGGATGCCGGCTCGCCCCACGTCCGTGACGCCGACACGTCA
CTTCGCCTCCAAGGAAGCTCGGTAGCGGAAACATATCTTGACGGCGCGCAGGTCATACGGCTGGCAAAGTCGGCC
GGGGCCGACGCCATCATTCCCGGCTATGGATTTCTGGCCGAGAGTGCCGACTTCGCCCGCGCGGTCGAAGAGGCA
GGGCTCGTGTGGATTGGGCCGACAGCTGAGCAGATGTCCGACCTGGGCCTGAAGCACCGAGCGCGAGAGATCGCG
GTCGCTTCGAAGGTTCCGGTCGTCCCAGGAAGTCCCCAGTTGGTCATGTCGCTTGCCGATGCTCACGAAGAGGCC
GAGCGGCTGGGATTCCCGCTGATGCTGAAGAGCACAGCCGGAGGCGGCGGTATTGGCCTTCGATGTTGCCGGGAT
GCCGAAAGCCTGGCTGATGCCTTTGATGCCGTCCAACGACTCGCTGCCGTGAATTTTGGCGAGGCTGGCGTCTTC
TTGGAGCGATACATCGAGAATTCTCGCCACATTGAGGTCCAGATCCTCGGGGACGGCACCGGTCGCGTCCTCGCC
TTGAGTGAGCGTGACTGCTCCCTGCAGAGGCGGCATCAGAAGGTCGTTGAAGAGTGCCCGGCATTTGCCGTCCCC
GCGCAGGTTAGGGCCAGCATGAGGGCGTCAGCTATTCGGCTGGCCGCCGCCGTCAAATATCGCAATGTCGGTACC
GTCGAATATATCTACGATATCGATACGCAGGAGTACTACTTGCTCGAGGTCAATACGCGTCTCCAGGTCGAGCAC
CCCGTCACGGAGTCCGTCACGGGTCTCGACCTTGTGGAGTGCATGTTGAAGGTCGCTCGGGGTGACTGCGGCCAG
CTGTTCGACGGCGAAACTGGCACCATCTCTCAGCAGGGGGCATCCATCGAGGTTAGAGTTTACGCTGAGAGCCCG
CTGGAAAACTTCAGGCCGTGCGCCGGAAGCATCACCTCCTTGTCGCTTCCTTCTAGCCTGCGGGTTGATGCCTGG
GTCGACGTTGGCACAGAGGTATCGACTCGCTATGATCCCCTGCTGGCGAAGCTCATTGCTACCGGTCGCGATCGG
CGGGAAGCCCTGCAGCGGCTCGCAGCAGGTCTCAGGGAAACGCGGATCGAGGGCGTTCAGACCAATCTCGAATAC
CTCCGTCAGATTGTCTCGTGGTCGCTGTTCCAAACTGGCAGCTACACCACCAAGTCACTGGACTTCTTCTTGTTT
CAGGACTCGTCGTTCAATGTGATCGAGTCAGGGGCTATGACCACGATTCAGGATTATCCCGGGCGGACTGGACTT
TGGAGCATAGGCATCCCGCCTTCGGGGCCTATGGACCATCTTTCTTTCCGCCTGGCGAACCGCCTCGTCGGCAAT
GACCAAGGCGCCGCGGCGCTCGAGTGTACTTTCCAAGGCCCGACTCTCAAGTTTCACTGCGACACGATTGTCGCT
GTCGTGGGAGCCGAGGCACCCGTCACGGTGGACGGAGAGCCCAGGCCGTCCAACGAGTCATTTCCGTTGCAGGCT
GGCCAGGTACTCGCCGTCGGCTCGGTCGAAAACGGGTATCGGATGTATATCGCCGTCGCAGGAGGGATCAATACC
CCCATGGTGATGGGCAGCCGGGCCACGTTCGAGGTCGGGAATTTGGGGGGCAAGAACGGCAGCAAGCTTCAACCC
GGCGACATCATTCCGATTGGTGCATCGCCTCCCCCGAGCAAAGCTTCCGAACATCTTCCGGTCTGCCCGGATATA
CCAATTCCTTCCCAGCCCAACGCCTGCTGGACGATTGGGGTAGTGCCAGGCCCCCATGGCGCTCCGGACTACTTC
ACCCAAGATGGCCTCGCCACCCTTTTTGCCGGAGAGTGGCGTGTCCACCACAACAGCAACAGGCTGGGCGTCCGT
TTAACAGGGCCACGGCCGCAGTGGGCGCGTGAGACCGGCGGCGAAGCAGGTCTACATCCGTCCAATATCCACGAT
AGCCCGTACTCGATCGGCAGCGTCAGCTTCACCGGTGACGAGGCGGTCGTGTTGACTTGTGATGGCCCAAGTCTA
GGCGGCTTTGTCGTCTTCTGCGTCGTTGCCTCGTCAGAGATGTGGAAGCTGGGCCAAGCCCGACCGGGAGACACC
ATTCGACTGCGGGCAATGAGCACGGAATCTGCCTCTCGGCTGGATAGAGAACTGAGCGCTTCCATCCAAGGTCTC
TCCGAGCTGCCCAAGTTGGAGAACTTACTCCCGGAAGACAATAAAGGCGCCGGCGTGGGCACGCCCATGGTGGGT
GCCATTGAGTGTGGCGGTGATAAGGTGCTGGTTCGCCAGGCCGGAGACCGGTCCATGTTGCTCGAGTTTGGCGAA
GACGAGATATTCGACCTCGAGCAAAGCTTCAAGATCCAGGCCTTCTGCCAGAACCACGCCAGCACACCGATCGAG
GGCATCCACGAGGTCACGCCCGGCGTGCGCACCGTCCACCTCATCTACGCCAGCGGCCTGTCTCCCGACACCGTC
CTCGCTCGTCTCTCCCGCCACATGTGCTCGTACGTCGTTCCCACCCGAATGCTATCACGCACGCTCCACCTCCCA
CTCGCGTTCGACGACTCGGTCAGCCAGGCTGCCGTGGAGCGCTACGCCGCAAGCATCCGGTCCGAGGCGCCGTGG
CTTCCGAGCAACGTGGCTTTCCTGGAGAAGCTGAACGGCTTGGACGATTTACCAAGTATCCTGTACAACGCAAGC
TACTTGGTCCTGGGGCTCGGCGACGTGTTCCTCGGCTCCCCGTGCGCCGTTCCTCTGGACCCGCGCCATCGGCTG
TTCGGGACCAAGTACAACCCTTCCCGCTCATTCACCCCCCGCCGCTCGGTGGGCATAGGAGGCAACTATTGTTGC
ATATATGCGACCGACTCTCCGGGCGGGTACCAGCTTGTCGGGCGAACGGTGGACATCTGGGACGCGAAATCAGTT
CAGGCGGACCAGGTGCAGCTGATGGCGAAGGGGTCTGGCAAAGCCGACGTCCCATGGATGTTCCGCCCCTTCGAC
GTCATCAAGTTCTATGCCGTGGCGGAGTCGGAGCTCGACGCCGCACCCGCTTCGAAACTGATTAAAGTCACGGAG
GGAGAGCTAGATCTTGAAGAATACCAAGCATGGCTCGCGTCACAAAAGGACTCGATCGACGCGATGGCGGCCCAC
CGAGAAGACTCCATGTCCAAATCGCCGTTCCTTCCCGAGCTCCGCCAGCCGTACAAACCGAAGACGGCCAGTGCT
GATGTCGCCGACGTCGCCTCGAGTTCGGGACTCAATTTGGCGGGCGAAAAGGTCAAGGCCATGATGCCGGGACGG
TGCTACAACTTCCAGGTCAAGGACGGCGGCATGGTCAAGAAGGGCGAGATTCTGATGTGGGTAGAGTCGAGCAAG
ATGGAAATCGAGATTCGCAGCCCGGTCAGCGGCCGATGCGTCGCTCTCGGCGTCCGAGAGGGCGGGCTGGTGGAT
GCCGGCCAGACGCTGCTCACGATTGATCCGGCGCACGAGAATGGCGGGAAATGA
Transcript >Hirsu2|11183
ATGGGCATCGAGGCTGTCTCGATATATACGACCGCGGATGCCGGCTCGCCCCACGTCCGTGACGCCGACACGTCA
CTTCGCCTCCAAGGAAGCTCGGTAGCGGAAACATATCTTGACGGCGCGCAGGTCATACGGCTGGCAAAGTCGGCC
GGGGCCGACGCCATCATTCCCGGCTATGGATTTCTGGCCGAGAGTGCCGACTTCGCCCGCGCGGTCGAAGAGGCA
GGGCTCGTGTGGATTGGGCCGACAGCTGAGCAGATGTCCGACCTGGGCCTGAAGCACCGAGCGCGAGAGATCGCG
GTCGCTTCGAAGGTTCCGGTCGTCCCAGGAAGTCCCCAGTTGGTCATGTCGCTTGCCGATGCTCACGAAGAGGCC
GAGCGGCTGGGATTCCCGCTGATGCTGAAGAGCACAGCCGGAGGCGGCGGTATTGGCCTTCGATGTTGCCGGGAT
GCCGAAAGCCTGGCTGATGCCTTTGATGCCGTCCAACGACTCGCTGCCGTGAATTTTGGCGAGGCTGGCGTCTTC
TTGGAGCGATACATCGAGAATTCTCGCCACATTGAGGTCCAGATCCTCGGGGACGGCACCGGTCGCGTCCTCGCC
TTGAGTGAGCGTGACTGCTCCCTGCAGAGGCGGCATCAGAAGGTCGTTGAAGAGTGCCCGGCATTTGCCGTCCCC
GCGCAGGTTAGGGCCAGCATGAGGGCGTCAGCTATTCGGCTGGCCGCCGCCGTCAAATATCGCAATGTCGGTACC
GTCGAATATATCTACGATATCGATACGCAGGAGTACTACTTGCTCGAGGTCAATACGCGTCTCCAGGTCGAGCAC
CCCGTCACGGAGTCCGTCACGGGTCTCGACCTTGTGGAGTGCATGTTGAAGGTCGCTCGGGGTGACTGCGGCCAG
CTGTTCGACGGCGAAACTGGCACCATCTCTCAGCAGGGGGCATCCATCGAGGTTAGAGTTTACGCTGAGAGCCCG
CTGGAAAACTTCAGGCCGTGCGCCGGAAGCATCACCTCCTTGTCGCTTCCTTCTAGCCTGCGGGTTGATGCCTGG
GTCGACGTTGGCACAGAGGTATCGACTCGCTATGATCCCCTGCTGGCGAAGCTCATTGCTACCGGTCGCGATCGG
CGGGAAGCCCTGCAGCGGCTCGCAGCAGGTCTCAGGGAAACGCGGATCGAGGGCGTTCAGACCAATCTCGAATAC
CTCCGTCAGATTGTCTCGTGGTCGCTGTTCCAAACTGGCAGCTACACCACCAAGTCACTGGACTTCTTCTTGTTT
CAGGACTCGTCGTTCAATGTGATCGAGTCAGGGGCTATGACCACGATTCAGGATTATCCCGGGCGGACTGGACTT
TGGAGCATAGGCATCCCGCCTTCGGGGCCTATGGACCATCTTTCTTTCCGCCTGGCGAACCGCCTCGTCGGCAAT
GACCAAGGCGCCGCGGCGCTCGAGTGTACTTTCCAAGGCCCGACTCTCAAGTTTCACTGCGACACGATTGTCGCT
GTCGTGGGAGCCGAGGCACCCGTCACGGTGGACGGAGAGCCCAGGCCGTCCAACGAGTCATTTCCGTTGCAGGCT
GGCCAGGTACTCGCCGTCGGCTCGGTCGAAAACGGGTATCGGATGTATATCGCCGTCGCAGGAGGGATCAATACC
CCCATGGTGATGGGCAGCCGGGCCACGTTCGAGGTCGGGAATTTGGGGGGCAAGAACGGCAGCAAGCTTCAACCC
GGCGACATCATTCCGATTGGTGCATCGCCTCCCCCGAGCAAAGCTTCCGAACATCTTCCGGTCTGCCCGGATATA
CCAATTCCTTCCCAGCCCAACGCCTGCTGGACGATTGGGGTAGTGCCAGGCCCCCATGGCGCTCCGGACTACTTC
ACCCAAGATGGCCTCGCCACCCTTTTTGCCGGAGAGTGGCGTGTCCACCACAACAGCAACAGGCTGGGCGTCCGT
TTAACAGGGCCACGGCCGCAGTGGGCGCGTGAGACCGGCGGCGAAGCAGGTCTACATCCGTCCAATATCCACGAT
AGCCCGTACTCGATCGGCAGCGTCAGCTTCACCGGTGACGAGGCGGTCGTGTTGACTTGTGATGGCCCAAGTCTA
GGCGGCTTTGTCGTCTTCTGCGTCGTTGCCTCGTCAGAGATGTGGAAGCTGGGCCAAGCCCGACCGGGAGACACC
ATTCGACTGCGGGCAATGAGCACGGAATCTGCCTCTCGGCTGGATAGAGAACTGAGCGCTTCCATCCAAGGTCTC
TCCGAGCTGCCCAAGTTGGAGAACTTACTCCCGGAAGACAATAAAGGCGCCGGCGTGGGCACGCCCATGGTGGGT
GCCATTGAGTGTGGCGGTGATAAGGTGCTGGTTCGCCAGGCCGGAGACCGGTCCATGTTGCTCGAGTTTGGCGAA
GACGAGATATTCGACCTCGAGCAAAGCTTCAAGATCCAGGCCTTCTGCCAGAACCACGCCAGCACACCGATCGAG
GGCATCCACGAGGTCACGCCCGGCGTGCGCACCGTCCACCTCATCTACGCCAGCGGCCTGTCTCCCGACACCGTC
CTCGCTCGTCTCTCCCGCCACATGTGCTCGTACGTCGTTCCCACCCGAATGCTATCACGCACGCTCCACCTCCCA
CTCGCGTTCGACGACTCGGTCAGCCAGGCTGCCGTGGAGCGCTACGCCGCAAGCATCCGGTCCGAGGCGCCGTGG
CTTCCGAGCAACGTGGCTTTCCTGGAGAAGCTGAACGGCTTGGACGATTTACCAAGTATCCTGTACAACGCAAGC
TACTTGGTCCTGGGGCTCGGCGACGTGTTCCTCGGCTCCCCGTGCGCCGTTCCTCTGGACCCGCGCCATCGGCTG
TTCGGGACCAAGTACAACCCTTCCCGCTCATTCACCCCCCGCCGCTCGGTGGGCATAGGAGGCAACTATTGTTGC
ATATATGCGACCGACTCTCCGGGCGGGTACCAGCTTGTCGGGCGAACGGTGGACATCTGGGACGCGAAATCAGTT
CAGGCGGACCAGGTGCAGCTGATGGCGAAGGGGTCTGGCAAAGCCGACGTCCCATGGATGTTCCGCCCCTTCGAC
GTCATCAAGTTCTATGCCGTGGCGGAGTCGGAGCTCGACGCCGCACCCGCTTCGAAACTGATTAAAGTCACGGAG
GGAGAGCTAGATCTTGAAGAATACCAAGCATGGCTCGCGTCACAAAAGGACTCGATCGACGCGATGGCGGCCCAC
CGAGAAGACTCCATGTCCAAATCGCCGTTCCTTCCCGAGCTCCGCCAGCCGTACAAACCGAAGACGGCCAGTGCT
GATGTCGCCGACGTCGCCTCGAGTTCGGGACTCAATTTGGCGGGCGAAAAGGTCAAGGCCATGATGCCGGGACGG
TGCTACAACTTCCAGGTCAAGGACGGCGGCATGGTCAAGAAGGGCGAGATTCTGATGTGGGTAGAGTCGAGCAAG
ATGGAAATCGAGATTCGCAGCCCGGTCAGCGGCCGATGCGTCGCTCTCGGCGTCCGAGAGGGCGGGCTGGTGGAT
GCCGGCCAGACGCTGCTCACGATTGATCCGGCGCACGAGAATGGCGGGAAATGA
Gene >Hirsu2|11183
ATGGGCATCGAGGCTGTCTCGATATATACGACCGCGGATGCCGGCTCGCCCCACGTCCGTGACGCCGACACGTCA
CTTCGCCTCCAAGGAAGCTCGGTAGCGGAAACATATCTTGACGGCGCGCAGGTCATACGGCTGGCAAAGTCGGCC
GGGGCCGACGCCATCATTCCCGGCTATGGATTTCTGGCCGAGAGTGCCGACTTCGCCCGCGCGGTCGAAGAGGCA
GGGCTCGTGTGGATTGGGCCGACAGCTGAGCAGATGTCCGACCTGGGCCTGAAGCACCGAGCGCGAGAGATCGCG
GTCGCTTCGAAGGTTCCGGTCGTCCCAGGAAGTCCCCAGTTGGTCATGTCGCTTGCCGATGCTCACGAAGAGGCC
GAGCGGCTGGGATTCCCGCTGATGCTGAAGAGCACAGCCGGAGGCGGCGGTATTGGCCTTCGATGTTGCCGGGAT
GCCGAAAGCCTGGCTGATGCCTTTGATGCCGTCCAACGACTCGCTGCCGTGAATTTTGGCGAGGCTGGCGTCTTC
TTGGAGCGATACATCGAGAATTCTCGCCACATTGAGGTCCAGATCCTCGGGGACGGCACCGGTCGCGTCCTCGCC
TTGAGTGAGCGTGACTGCTCCCTGCAGAGGCGGCATCAGAAGGTCGTTGAAGAGTGCCCGGCATTTGCCGTCCCC
GCGCAGGTTAGGGCCAGCATGAGGGCGTCAGCTATTCGGCTGGCCGCCGCCGTCAAATATCGCAATGTCGGTACC
GTCGAATATATCTACGATATCGATACGCAGGAGTACTACTTGCTCGAGGTCAATACGCGTCTCCAGGTCGAGCAC
CCCGTCACGGAGTCCGTCACGGGTCTCGACCTTGTGGAGTGCATGTTGAAGGTCGCTCGGGGTGACTGCGGCCAG
CTGTTCGACGGCGAAACTGGCACCATCTCTCAGCAGGGGGCATCCATCGAGGTTAGAGTTTACGCTGAGAGCCCG
CTGGAAAACTTCAGGCCGTGCGCCGGAAGCATCACCTCCTTGTCGCTTCCTTCTAGCCTGCGGGTTGATGCCTGG
GTCGACGTTGGCACAGAGGTATCGACTCGCTATGATCCCCTGCTGGCGAAGCTCATTGCTACCGGTCGCGATCGG
CGGGAAGCCCTGCAGCGGCTCGCAGCAGGTCTCAGGGAAACGCGGATCGAGGGCGTTCAGACCAATCTCGAATAC
CTCCGTCAGATTGTCTCGTGGTCGCTGTTCCAAACTGGCAGCTACACCACCAAGTCACTGGACTTCTTCTTGTTT
CAGGACTCGTCGTTCAATGTGATCGAGTCAGGGGCTATGACCACGATTCAGGATTATCCCGGGCGGACTGGACTT
TGGAGCATAGGCATCCCGCCTTCGGGGCCTATGGACCATCTTTCTTTCCGCCTGGCGAACCGCCTCGTCGGCAAT
GACCAAGGCGCCGCGGCGCTCGAGTGTACTTTCCAAGGCCCGACTCTCAAGTTTCACTGCGACACGATTGTCGCT
GTCGTGGGAGCCGAGGCACCCGTCACGGTGGACGGAGAGCCCAGGCCGTCCAACGAGTCATTTCCGTTGCAGGCT
GGCCAGGTACTCGCCGTCGGCTCGGTCGAAAACGGGTATCGGATGTATATCGCCGTCGCAGGAGGGATCAATACC
CCCATGGTGATGGGCAGCCGGGCCACGTTCGAGGTCGGGAATTTGGGGGGCAAGAACGGCAGCAAGCTTCAACCC
GGCGACATCATTCCGATTGGTGCATCGCCTCCCCCGAGCAAAGCTTCCGAACATCTTCCGGTCTGCCCGGATATA
CCAATTCCTTCCCAGCCCAACGCCTGCTGGACGATTGGGGTAGTGCCAGGCCCCCATGGCGCTCCGGACTACTTC
ACCCAAGATGGCCTCGCCACCCTTTTTGCCGGAGAGTGGCGTGTCCACCACAACAGCAACAGGCTGGGCGTCCGT
TTAACAGGGCCACGGCCGCAGTGGGCGCGTGAGACCGGCGGCGAAGCAGGTCTACATCCGTCCAATATCCACGAT
AGCCCGTACTCGATCGGCAGCGTCAGCTTCACCGGTGACGAGGCGGTCGTGTTGACTTGTGATGGCCCAAGTCTA
GGCGGCTTTGTCGTCTTCTGCGTCGTTGCCTCGTCAGAGATGTGGAAGCTGGGCCAAGCCCGACCGGGAGACACC
ATTCGACTGCGGGCAATGAGCACGGAATCTGCCTCTCGGCTGGATAGAGAACTGAGCGCTTCCATCCAAGGTCTC
TCCGAGCTGCCCAAGTTGGAGAACTTACTCCCGGAAGACAATAAAGGCGCCGGCGTGGGCACGCCCATGGTGGGT
GCCATTGAGTGTGGCGGTGATAAGGTGCTGGTTCGCCAGGCCGGAGACCGGTCCATGTTGCTCGAGTTTGGCGAA
GACGAGATATTCGACCTCGAGCAAAGCTTCAAGATCCAGGCCTTCTGCCAGAACCACGCCAGCACACCGATCGAG
GGCATCCACGAGGTCACGCCCGGCGTGCGCACCGTCCACCTCATCTACGCCAGCGGCCTGTCTCCCGACACCGTC
CTCGCTCGTCTCTCCCGCCACATGTGCTCGTACGTCGTTCCCACCCGAATGCTATCACGCACGCTCCACCTCCCA
CTCGCGTTCGACGACTCGGTCAGCCAGGCTGCCGTGGAGCGCTACGCCGCAAGCATCCGGTCCGAGGCGCCGTGG
CTTCCGAGCAACGTGGCTTTCCTGGAGAAGCTGAACGGCTTGGACGATTTACCAAGTATCCTGTACAACGCAAGC
TACTTGGTCCTGGGGCTCGGCGACGTGTTCCTCGGCTCCCCGTGCGCCGTTCCTCTGGACCCGCGCCATCGGCTG
TTCGGGACCAAGTACAACCCTTCCCGCTCATTCACCCCCCGCCGCTCGGTGGGCATAGGAGGCAACTATTGTTGC
ATATATGCGACCGACTCTCCGGGCGGGTACCAGCTTGTCGGGCGAACGGTGGACATCTGGGACGCGAAATCAGTT
CAGGCGGACCAGGTGCAGCTGATGGCGAAGGGGTCTGGCAAAGCCGACGTCCCATGGATGTTCCGCCCCTTCGAC
GTCATCAAGTTCTATGCCGTGGCGGAGTCGGAGCTCGACGCCGCACCCGCTTCGAAACTGATTAAAGTCACGGAG
GGAGAGCTAGATCTTGAAGAATACCAAGCATGGCTCGCGTCACAAAAGGACTCGATCGACGCGATGGCGGCCCAC
CGAGAAGACTCCATGTCCAAATCGCCGTTCCTTCCCGAGCTCCGCCAGCCGTACAAACCGAAGACGGCCAGTGCT
GATGTCGCCGACGTCGCCTCGAGTTCGGGACTCAATTTGGCGGGCGAAAAGGTCAAGGCCATGATGCCGGGACGG
TGCTACAACTTCCAGGTCAAGGACGGCGGCATGGTCAAGAAGGGCGAGATTCTGGTAAGCCAGCTGGTGGCACTC
CCTGACGCGTGTTCAGAGCTGACAGTGTGTGTCCAGATGTGGGTAGAGTCGAGCAAGATGGAAATCGAGATTCGC
AGCCCGGTCAGCGGCCGATGCGTCGCTCTCGGCGTCCGAGAGGGCGGGCTGGTGGATGCCGGCCAGACGCTGCTC
ACGATTGATCCGGCGCACGAGAATGGCGGGAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail