Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1118
Gene name
LocationContig_1235:6151..7876
Strand+
Gene length (bp)1725
Transcript length (bp)1485
Coding sequence length (bp)1485
Protein length (aa) 495

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 8.7E-21 245 421
PF07714 Pkinase_Tyr Protein tyrosine kinase 2.8E-15 63 331

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 249 333 2.0E-10
sp|F4JY37|RUK_ARATH Serine/threonine-protein kinase RUNKEL OS=Arabidopsis thaliana GN=RUK PE=1 SV=1 235 333 2.0E-10
sp|P9WI83|PKNA_MYCTU Serine/threonine-protein kinase PknA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknA PE=1 SV=1 242 332 1.0E-09
sp|P9WI82|PKNA_MYCTO Serine/threonine-protein kinase PknA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknA PE=3 SV=1 242 332 1.0E-09
sp|A5TY85|PKNA_MYCTA Serine/threonine-protein kinase PknA OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pknA PE=1 SV=1 242 332 1.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 249 333 2.0E-10
sp|F4JY37|RUK_ARATH Serine/threonine-protein kinase RUNKEL OS=Arabidopsis thaliana GN=RUK PE=1 SV=1 235 333 2.0E-10
sp|P9WI83|PKNA_MYCTU Serine/threonine-protein kinase PknA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknA PE=1 SV=1 242 332 1.0E-09
sp|P9WI82|PKNA_MYCTO Serine/threonine-protein kinase PknA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknA PE=3 SV=1 242 332 1.0E-09
sp|A5TY85|PKNA_MYCTA Serine/threonine-protein kinase PknA OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pknA PE=1 SV=1 242 332 1.0E-09
sp|P65727|PKNA_MYCBO Serine/threonine-protein kinase PknA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknA PE=3 SV=1 242 332 1.0E-09
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 242 361 2.0E-09
sp|P54743|PKNA_MYCLE Serine/threonine-protein kinase PknA OS=Mycobacterium leprae (strain TN) GN=pknA PE=3 SV=3 242 333 7.0E-09
sp|Q99640|PMYT1_HUMAN Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Homo sapiens GN=PKMYT1 PE=1 SV=1 249 332 8.0E-09
sp|Q8DNS0|STKP_STRR6 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=stkP PE=1 SV=1 242 333 1.0E-08
sp|Q04J43|STKP_STRP2 Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=stkP PE=1 SV=1 242 333 1.0E-08
sp|Q97PA9|STKP2_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 242 333 1.0E-08
sp|Q9HGN1|GCN2_SCHPO Serine/threonine-protein kinase gcn2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gcn2 PE=2 SV=2 42 355 1.0E-08
sp|Q54E34|Y6398_DICDI Probable protein kinase DDB_G0291842 OS=Dictyostelium discoideum GN=DDB_G0291842 PE=3 SV=1 226 333 2.0E-08
sp|Q2MHE4|HT1_ARATH Serine/threonine-protein kinase HT1 OS=Arabidopsis thaliana GN=HT1 PE=1 SV=1 246 335 2.0E-08
sp|Q9ESG9|PMYT1_MOUSE Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Mus musculus GN=Pkmyt1 PE=2 SV=3 213 332 3.0E-08
sp|O34507|PRKC_BACSU Serine/threonine-protein kinase PrkC OS=Bacillus subtilis (strain 168) GN=prkC PE=1 SV=1 223 333 4.0E-08
sp|P34556|CDK1_CAEEL Cyclin-dependent kinase 1 OS=Caenorhabditis elegans GN=cdk-1 PE=1 SV=1 220 333 4.0E-08
sp|P9WI67|PKNJ_MYCTU Serine/threonine-protein kinase PknJ OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknJ PE=1 SV=1 242 325 4.0E-08
sp|P9WI66|PKNJ_MYCTO Serine/threonine-protein kinase PknJ OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknJ PE=1 SV=1 242 325 4.0E-08
sp|P65733|PKNJ_MYCBO Serine/threonine-protein kinase PknJ OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknJ PE=3 SV=1 242 325 4.0E-08
sp|Q8W4J2|MPK16_ARATH Mitogen-activated protein kinase 16 OS=Arabidopsis thaliana GN=MPK16 PE=2 SV=2 208 420 4.0E-08
sp|Q9UQ07|MOK_HUMAN MAPK/MAK/MRK overlapping kinase OS=Homo sapiens GN=MOK PE=2 SV=1 246 462 5.0E-08
sp|Q8KY50|STKP1_STRPN Serine/threonine-protein kinase StkP OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=stkP PE=1 SV=1 249 333 1.0E-07
sp|O61122|SVKA_DICDI Serine/threonine-protein kinase svkA OS=Dictyostelium discoideum GN=svkA PE=1 SV=1 235 332 1.0E-07
sp|P06242|KIN28_YEAST Serine/threonine-protein kinase KIN28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN28 PE=1 SV=1 248 328 1.0E-07
sp|Q9GRC0|MOS_PATPE Serine/threonine-protein kinase mos OS=Patiria pectinifera GN=mos PE=1 SV=1 211 333 1.0E-07
sp|Q9C9U4|MPK15_ARATH Mitogen-activated protein kinase 15 OS=Arabidopsis thaliana GN=MPK15 PE=1 SV=3 208 420 1.0E-07
sp|Q00526|CDK3_HUMAN Cyclin-dependent kinase 3 OS=Homo sapiens GN=CDK3 PE=1 SV=1 220 356 1.0E-07
sp|P42818|KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6 OS=Arabidopsis thaliana GN=ATPK1 PE=1 SV=1 246 333 1.0E-07
sp|Q55CA6|Y0146_DICDI Probable serine/threonine-protein kinase DDB_G0270146 OS=Dictyostelium discoideum GN=DDB_G0270146 PE=3 SV=1 235 333 1.0E-07
sp|Q9Y572|RIPK3_HUMAN Receptor-interacting serine/threonine-protein kinase 3 OS=Homo sapiens GN=RIPK3 PE=1 SV=2 234 331 1.0E-07
sp|Q9CEF5|PKNB_LACLA Probable serine/threonine-protein kinase PknB OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=pknB PE=3 SV=1 242 333 1.0E-07
sp|Q04735|CDK16_MOUSE Cyclin-dependent kinase 16 OS=Mus musculus GN=Cdk16 PE=1 SV=1 238 333 1.0E-07
sp|Q00536|CDK16_HUMAN Cyclin-dependent kinase 16 OS=Homo sapiens GN=CDK16 PE=1 SV=1 238 333 1.0E-07
sp|P32490|MKK1_YEAST MAP kinase kinase MKK1/SSP32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKK1 PE=1 SV=1 246 333 1.0E-07
sp|Q5SN53|MPK8_ORYSJ Mitogen-activated protein kinase 8 OS=Oryza sativa subsp. japonica GN=MPK8 PE=2 SV=2 242 420 1.0E-07
sp|Q39030|KPK2_ARATH Serine/threonine-protein kinase AtPK2/AtPK19 OS=Arabidopsis thaliana GN=ATPK2 PE=1 SV=2 246 333 2.0E-07
sp|P48963|CDK2_MESAU Cyclin-dependent kinase 2 OS=Mesocricetus auratus GN=CDK2 PE=2 SV=1 213 333 2.0E-07
sp|Q76MJ5|ERN2_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE2 OS=Homo sapiens GN=ERN2 PE=1 SV=4 242 421 2.0E-07
sp|P54741|AFSK_STRCO Serine/threonine-protein kinase AfsK OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=afsK PE=1 SV=2 218 333 2.0E-07
sp|Q8G4G1|PKNA2_BIFLO Probable serine/threonine-protein kinase pknA2 OS=Bifidobacterium longum (strain NCC 2705) GN=pknA2 PE=3 SV=1 250 327 2.0E-07
sp|Q6TJY3|KS6B1_BOVIN Ribosomal protein S6 kinase beta-1 OS=Bos taurus GN=RPS6KB1 PE=2 SV=1 237 328 2.0E-07
sp|Q63699|CDK2_RAT Cyclin-dependent kinase 2 OS=Rattus norvegicus GN=Cdk2 PE=1 SV=1 221 333 2.0E-07
sp|Q8BSK8|KS6B1_MOUSE Ribosomal protein S6 kinase beta-1 OS=Mus musculus GN=Rps6kb1 PE=1 SV=2 237 328 2.0E-07
sp|P67999|KS6B1_RAT Ribosomal protein S6 kinase beta-1 OS=Rattus norvegicus GN=Rps6kb1 PE=1 SV=1 237 328 2.0E-07
sp|O55076|CDK2_CRIGR Cyclin-dependent kinase 2 OS=Cricetulus griseus GN=CDK2 PE=2 SV=1 221 333 3.0E-07
sp|P67998|KS6B1_RABIT Ribosomal protein S6 kinase beta-1 OS=Oryctolagus cuniculus GN=RPS6KB1 PE=2 SV=1 237 328 3.0E-07
sp|Q9Z2P5|RIPK3_RAT Receptor-interacting serine/threonine-protein kinase 3 OS=Rattus norvegicus GN=Ripk3 PE=1 SV=3 234 346 3.0E-07
sp|Q5E9Y0|CDK2_BOVIN Cyclin-dependent kinase 2 OS=Bos taurus GN=CDK2 PE=2 SV=1 221 333 3.0E-07
sp|P23443|KS6B1_HUMAN Ribosomal protein S6 kinase beta-1 OS=Homo sapiens GN=RPS6KB1 PE=1 SV=2 237 328 3.0E-07
sp|Q8NU98|PKN1_CORGL Probable serine/threonine-protein kinase PknB OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=pknB PE=3 SV=1 217 333 3.0E-07
sp|P9WI63|PKNL_MYCTU Serine/threonine-protein kinase PknL OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknL PE=1 SV=1 235 328 3.0E-07
sp|P9WI62|PKNL_MYCTO Serine/threonine-protein kinase PknL OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknL PE=3 SV=1 235 328 3.0E-07
sp|Q7TYY6|PKNL_MYCBO Serine/threonine-protein kinase PknL OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknL PE=3 SV=1 235 328 3.0E-07
sp|Q8W490|PEPK2_ARATH Serine/threonine-protein kinase PEPKR2 OS=Arabidopsis thaliana GN=PEPKR2 PE=2 SV=1 249 335 3.0E-07
sp|P54742|AFSK_STRGR Serine/threonine-protein kinase AfsK OS=Streptomyces griseus GN=afsK PE=3 SV=1 218 333 3.0E-07
sp|P24941|CDK2_HUMAN Cyclin-dependent kinase 2 OS=Homo sapiens GN=CDK2 PE=1 SV=2 221 333 3.0E-07
sp|O14047|PPK11_SCHPO Serine/threonine-protein kinase ppk11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk11 PE=3 SV=1 246 333 3.0E-07
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 246 331 4.0E-07
sp|Q5ZCI1|MPK10_ORYSJ Mitogen-activated protein kinase 10 OS=Oryza sativa subsp. japonica GN=MPK10 PE=2 SV=2 238 375 4.0E-07
sp|Q8R9T6|PKN1_CALS4 Probable serine/threonine-protein kinase Sps1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=sps1 PE=3 SV=1 246 333 4.0E-07
sp|Q2V452|CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana GN=CIPK3 PE=1 SV=2 249 335 4.0E-07
sp|Q5R8Z4|PAK6_PONAB Serine/threonine-protein kinase PAK 6 OS=Pongo abelii GN=PAK6 PE=2 SV=1 246 332 4.0E-07
sp|Q9WVS4|MOK_MOUSE MAPK/MAK/MRK overlapping kinase OS=Mus musculus GN=Mok PE=1 SV=1 246 435 4.0E-07
sp|Q9NQU5|PAK6_HUMAN Serine/threonine-protein kinase PAK 6 OS=Homo sapiens GN=PAK6 PE=1 SV=1 246 332 4.0E-07
sp|Q5E9X2|MP2K6_BOVIN Dual specificity mitogen-activated protein kinase kinase 6 OS=Bos taurus GN=MAP2K6 PE=2 SV=1 231 382 5.0E-07
sp|Q3ULB5|PAK6_MOUSE Serine/threonine-protein kinase PAK 6 OS=Mus musculus GN=Pak6 PE=2 SV=1 246 332 5.0E-07
sp|O60145|PPK23_SCHPO Serine/threonine-protein kinase ppk23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk23 PE=3 SV=1 232 333 5.0E-07
sp|P70236|MP2K6_MOUSE Dual specificity mitogen-activated protein kinase kinase 6 OS=Mus musculus GN=Map2k6 PE=1 SV=1 231 382 6.0E-07
sp|P52564|MP2K6_HUMAN Dual specificity mitogen-activated protein kinase kinase 6 OS=Homo sapiens GN=MAP2K6 PE=1 SV=1 231 382 6.0E-07
sp|Q61410|KGP2_MOUSE cGMP-dependent protein kinase 2 OS=Mus musculus GN=Prkg2 PE=1 SV=1 235 370 6.0E-07
sp|Q00537|CDK17_HUMAN Cyclin-dependent kinase 17 OS=Homo sapiens GN=CDK17 PE=1 SV=2 221 333 7.0E-07
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 246 331 7.0E-07
sp|Q8K0D0|CDK17_MOUSE Cyclin-dependent kinase 17 OS=Mus musculus GN=Cdk17 PE=1 SV=2 221 333 7.0E-07
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 246 331 7.0E-07
sp|Q9FJ54|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana GN=CIPK20 PE=1 SV=1 249 429 8.0E-07
sp|O35831|CDK17_RAT Cyclin-dependent kinase 17 OS=Rattus norvegicus GN=Cdk17 PE=1 SV=1 242 333 8.0E-07
sp|P43450|CDK2_CARAU Cyclin-dependent kinase 2 OS=Carassius auratus GN=cdk2 PE=2 SV=1 221 356 8.0E-07
sp|Q64595|KGP2_RAT cGMP-dependent protein kinase 2 OS=Rattus norvegicus GN=Prkg2 PE=1 SV=1 235 370 8.0E-07
sp|Q6L5D4|MPK9_ORYSJ Mitogen-activated protein kinase 9 OS=Oryza sativa subsp. japonica GN=MPK9 PE=3 SV=2 238 375 8.0E-07
sp|Q13237|KGP2_HUMAN cGMP-dependent protein kinase 2 OS=Homo sapiens GN=PRKG2 PE=1 SV=1 235 370 9.0E-07
sp|Q556S2|PAKH_DICDI Serine/threonine-protein kinase pakH OS=Dictyostelium discoideum GN=pakH-1 PE=3 SV=1 241 332 1.0E-06
sp|Q9LX30|GCN2_ARATH Probable serine/threonine-protein kinase GCN2 OS=Arabidopsis thaliana GN=GCN2 PE=2 SV=2 237 331 1.0E-06
sp|Q84UI5|MPK1_ORYSJ Mitogen-activated protein kinase 1 OS=Oryza sativa subsp. japonica GN=MPK1 PE=1 SV=1 242 438 1.0E-06
sp|Q5VN19|MPK11_ORYSJ Mitogen-activated protein kinase 11 OS=Oryza sativa subsp. japonica GN=MPK11 PE=2 SV=2 208 454 1.0E-06
sp|Q03042|KGP1_DROME cGMP-dependent protein kinase, isozyme 1 OS=Drosophila melanogaster GN=Pkg21D PE=1 SV=2 242 327 1.0E-06
sp|O80902|CIPKM_ARATH CBL-interacting serine/threonine-protein kinase 22 OS=Arabidopsis thaliana GN=CIPK22 PE=2 SV=1 249 329 1.0E-06
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 243 333 1.0E-06
sp|O22932|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana GN=CIPK11 PE=1 SV=1 249 335 1.0E-06
sp|A0AUV4|SMKY_MOUSE Sperm motility kinase Y OS=Mus musculus GN=Gm7168 PE=2 SV=1 246 407 1.0E-06
sp|Q9CAH1|Y1725_ARATH Putative receptor-like protein kinase At1g72540 OS=Arabidopsis thaliana GN=At1g72540 PE=2 SV=1 242 434 1.0E-06
sp|P08631|HCK_HUMAN Tyrosine-protein kinase HCK OS=Homo sapiens GN=HCK PE=1 SV=5 223 333 1.0E-06
sp|Q9DG02|KCC2D_XENLA Calcium/calmodulin-dependent protein kinase type II delta chain OS=Xenopus laevis GN=camk2d PE=2 SV=1 246 353 2.0E-06
sp|Q67C40|MPK7_ORYSJ Mitogen-activated protein kinase 7 OS=Oryza sativa subsp. japonica GN=MPK7 PE=2 SV=1 242 375 2.0E-06
sp|Q84SN3|CDKF3_ORYSJ Cyclin-dependent kinase F-3 OS=Oryza sativa subsp. japonica GN=CDKF-3 PE=2 SV=1 246 334 2.0E-06
sp|Q6DGS3|KC2D2_DANRE Calcium/calmodulin-dependent protein kinase type II delta 2 chain OS=Danio rerio GN=camk2d2 PE=2 SV=2 246 353 2.0E-06
sp|Q6DEH3|KC2D1_DANRE Calcium/calmodulin-dependent protein kinase type II delta 1 chain OS=Danio rerio GN=camk2d1 PE=2 SV=2 246 353 2.0E-06
sp|Q2HJF7|KCC2D_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Bos taurus GN=CAMK2D PE=2 SV=1 246 353 2.0E-06
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 249 331 2.0E-06
sp|Q6PHZ2|KCC2D_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Mus musculus GN=Camk2d PE=1 SV=1 246 353 2.0E-06
sp|Q13557|KCC2D_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Homo sapiens GN=CAMK2D PE=1 SV=3 246 353 2.0E-06
sp|Q95266|KCC2D_PIG Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Sus scrofa GN=CAMK2D PE=2 SV=1 246 353 2.0E-06
sp|Q84VQ3|CIPKQ_ARATH CBL-interacting serine/threonine-protein kinase 26 OS=Arabidopsis thaliana GN=CIPK26 PE=1 SV=2 246 331 2.0E-06
sp|Q5RCC4|KCC2A_PONAB Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Pongo abelii GN=CAMK2A PE=2 SV=2 246 353 2.0E-06
sp|Q9UQM7|KCC2A_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Homo sapiens GN=CAMK2A PE=1 SV=2 246 353 2.0E-06
sp|Q0D4B2|CIPKL_ORYSJ CBL-interacting protein kinase 21 OS=Oryza sativa subsp. japonica GN=CIPK21 PE=2 SV=2 249 373 2.0E-06
sp|Q7XIW5|CIPKT_ORYSJ CBL-interacting protein kinase 29 OS=Oryza sativa subsp. japonica GN=CIPK29 PE=2 SV=1 249 333 2.0E-06
sp|P11275|KCC2A_RAT Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Rattus norvegicus GN=Camk2a PE=1 SV=1 246 353 2.0E-06
sp|P11798|KCC2A_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit alpha OS=Mus musculus GN=Camk2a PE=1 SV=2 246 353 2.0E-06
sp|P23437|CDK2_XENLA Cyclin-dependent kinase 2 OS=Xenopus laevis GN=cdk2 PE=1 SV=3 220 333 2.0E-06
sp|Q9STV4|CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 8 OS=Arabidopsis thaliana GN=CIPK8 PE=1 SV=1 252 335 2.0E-06
sp|P15791|KCC2D_RAT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Rattus norvegicus GN=Camk2d PE=1 SV=1 246 353 2.0E-06
sp|Q9LUC3|MPK19_ARATH Mitogen-activated protein kinase 19 OS=Arabidopsis thaliana GN=MPK19 PE=2 SV=2 238 387 3.0E-06
sp|O77708|KCC2D_RABIT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Oryctolagus cuniculus GN=CAMK2D PE=2 SV=2 246 353 3.0E-06
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 243 333 3.0E-06
sp|Q9LDI3|CIPKO_ARATH CBL-interacting serine/threonine-protein kinase 24 OS=Arabidopsis thaliana GN=CIPK24 PE=1 SV=1 249 331 3.0E-06
sp|Q5ZKI0|KCC2D_CHICK Calcium/calmodulin-dependent protein kinase type II delta chain OS=Gallus gallus GN=CAMK2D PE=2 SV=1 246 353 3.0E-06
sp|Q9Z2E3|ERN2_MOUSE Serine/threonine-protein kinase/endoribonuclease IRE2 OS=Mus musculus GN=Ern2 PE=2 SV=2 242 333 3.0E-06
sp|Q3Y416|KKCC_CAEEL Calcium/calmodulin-dependent protein kinase kinase OS=Caenorhabditis elegans GN=ckk-1 PE=1 SV=2 237 332 3.0E-06
sp|Q9SJG9|MPK20_ARATH Mitogen-activated protein kinase 20 OS=Arabidopsis thaliana GN=MPK20 PE=1 SV=2 238 375 3.0E-06
sp|Q92918|M4K1_HUMAN Mitogen-activated protein kinase kinase kinase kinase 1 OS=Homo sapiens GN=MAP4K1 PE=1 SV=1 246 332 4.0E-06
sp|A8XA58|CDK1_CAEBR Cyclin-dependent kinase 1 OS=Caenorhabditis briggsae GN=cdk-1 PE=3 SV=1 246 333 4.0E-06
sp|Q9XA16|PKNX_STRCO Probable serine/threonine-protein kinase SCO3848 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3848 PE=3 SV=1 234 334 4.0E-06
sp|G5EFM9|NEKL3_CAEEL Serine/threonine-protein kinase nekl-3 OS=Caenorhabditis elegans GN=nekl-3 PE=1 SV=1 246 334 4.0E-06
sp|Q9UBS0|KS6B2_HUMAN Ribosomal protein S6 kinase beta-2 OS=Homo sapiens GN=RPS6KB2 PE=1 SV=2 237 328 5.0E-06
sp|Q7U095|PKNH_MYCBO Serine/threonine-protein kinase PknH OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknH PE=3 SV=1 240 327 5.0E-06
sp|Q54XJ4|Y8901_DICDI Probable serine/threonine-protein kinase DDB_G0278901 OS=Dictyostelium discoideum GN=DDB_G0278901 PE=3 SV=1 246 333 5.0E-06
sp|Q55A09|Y9963_DICDI Probable serine/threonine-protein kinase DDB_G0272254 OS=Dictyostelium discoideum GN=DDB_G0272254 PE=3 SV=1 246 333 6.0E-06
sp|Q3MHJ9|KCC2B_BOVIN Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Bos taurus GN=CAMK2B PE=2 SV=1 246 353 7.0E-06
sp|O65479|CRK20_ARATH Putative cysteine-rich receptor-like protein kinase 20 OS=Arabidopsis thaliana GN=CRK20 PE=2 SV=2 242 348 7.0E-06
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 243 404 7.0E-06
sp|P9WI70|PKNH_MYCTO Serine/threonine-protein kinase PknH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknH PE=3 SV=1 240 327 7.0E-06
sp|P9WI71|PKNH_MYCTU Serine/threonine-protein kinase PknH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknH PE=1 SV=1 240 327 7.0E-06
sp|Q8N5S9|KKCC1_HUMAN Calcium/calmodulin-dependent protein kinase kinase 1 OS=Homo sapiens GN=CAMKK1 PE=1 SV=2 246 327 8.0E-06
sp|P28652|KCC2B_MOUSE Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Mus musculus GN=Camk2b PE=1 SV=2 246 353 8.0E-06
sp|P08413|KCC2B_RAT Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Rattus norvegicus GN=Camk2b PE=1 SV=1 246 353 8.0E-06
sp|P9WI65|PKNK_MYCTU Serine/threonine-protein kinase PknK OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknK PE=1 SV=1 246 333 8.0E-06
sp|P9WI64|PKNK_MYCTO Serine/threonine-protein kinase PknK OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknK PE=3 SV=1 246 333 8.0E-06
sp|Q8G6P9|PKNB_BIFLO Probable serine/threonine-protein kinase PknB OS=Bifidobacterium longum (strain NCC 2705) GN=pknB PE=3 SV=1 242 333 8.0E-06
sp|Q8VBY2|KKCC1_MOUSE Calcium/calmodulin-dependent protein kinase kinase 1 OS=Mus musculus GN=Camkk1 PE=1 SV=1 250 327 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0044238 primary metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0006793 phosphorus metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0044267 cellular protein metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0016301 kinase activity No
GO:0044260 cellular macromolecule metabolic process No
GO:0008144 drug binding No
GO:0036211 protein modification process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0003824 catalytic activity No
GO:0016310 phosphorylation No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006464 cellular protein modification process No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0043170 macromolecule metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0019538 protein metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0006796 phosphate-containing compound metabolic process No
GO:0043412 macromolecule modification No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1118
MADRGWTTVGHRIPAAQRHGREQEQREREAIAGWDKDDHWPGINKPLFQTSDAKRFDGSLEKIGDLGHGAFGRVD
MVKHGGVALARKRIARRRGITIDDLRQEGLTMAKLDHCHVVRLVATYAPKSHELCLLIWPAAVCSLSVLLDDIDS
LRLGDGGADETAERLDRLDALHLLGGADDDDMGGDTTRDSAGEDADWRHVAGNKTAPPPPGAHFRLRLPSRDLQR
IQSGDGDGRPFDFLCGLLGCVARAMAHCHAQGVRHLDIKPSNILLNPGRVYLADFGISRDVSGQDQTTTDGMPGT
ERWRAPELYGDDGSSMQLSDMYSLGLVYLAVATVLYNARLADLDKALAYPGPSSLDLDGRLRGREDRLRRHLDKL
TAHALVTRRFRFTYEGQETVRARPVLSLIASMVSAAPRARPSARKVDERLSVLGGLQQIYHAGCCRRGLPWLEDR
LDRKLRDLAGHRDRSEQQLATLRDGHEQQRARIQALEGMDETPS*
Coding >Hirsu2|1118
ATGGCCGACCGAGGCTGGACCACCGTTGGCCACAGGATTCCGGCCGCTCAGCGCCACGGCCGCGAGCAGGAGCAG
AGGGAGCGTGAGGCCATCGCCGGCTGGGACAAGGACGACCATTGGCCGGGCATAAACAAGCCACTGTTCCAGACC
TCTGACGCGAAGCGCTTCGACGGCAGCTTGGAGAAGATTGGCGATCTCGGCCATGGCGCCTTCGGCCGGGTCGAC
ATGGTCAAGCACGGCGGCGTCGCCCTGGCCCGCAAGCGCATCGCCCGCCGGCGCGGCATCACCATCGACGACCTT
CGCCAGGAGGGCCTGACCATGGCCAAGCTCGACCACTGCCACGTCGTCCGCCTCGTCGCCACCTACGCGCCCAAG
TCGCACGAGCTGTGCCTGCTCATCTGGCCCGCCGCCGTCTGCAGCCTCAGCGTCCTGCTCGACGACATCGACAGC
CTGCGCCTGGGCGACGGCGGCGCCGACGAGACAGCCGAGCGGCTCGACCGGCTCGACGCGCTGCACCTCCTGGGT
GGCGCCGACGATGACGACATGGGCGGCGATACCACCAGAGACAGCGCGGGCGAGGACGCCGACTGGCGGCACGTC
GCCGGCAATAAGACGGCGCCGCCGCCGCCGGGAGCTCACTTCCGGCTCCGGCTGCCGTCCCGAGACCTGCAGCGC
ATCCAGTCCGGCGACGGCGACGGGCGCCCCTTCGACTTCCTCTGCGGCCTGCTCGGCTGCGTCGCCCGCGCCATG
GCCCACTGCCACGCCCAGGGCGTGCGCCACCTCGACATCAAGCCCTCCAACATCCTCCTCAACCCCGGCCGCGTC
TACCTGGCCGACTTCGGCATCTCGCGCGACGTCAGCGGCCAGGACCAGACGACGACGGACGGCATGCCCGGCACC
GAGAGGTGGCGGGCCCCCGAGCTGTACGGCGACGACGGCTCGAGCATGCAGCTATCCGACATGTACTCGCTCGGC
CTCGTCTACCTCGCCGTCGCCACCGTGCTCTACAACGCCCGCCTAGCCGACCTAGACAAGGCCCTCGCCTACCCG
GGCCCGTCGTCGCTCGACCTAGACGGCCGGCTGCGCGGTCGCGAGGACCGGCTCCGGCGCCACCTCGACAAGCTG
ACGGCCCACGCCCTCGTCACCCGCCGCTTCCGCTTCACCTACGAGGGCCAGGAGACGGTCCGGGCCCGGCCCGTC
CTCAGCCTCATCGCCAGCATGGTCTCGGCCGCGCCGCGCGCCCGCCCGTCCGCCAGGAAGGTCGACGAGAGGCTG
TCTGTCCTGGGCGGCCTGCAGCAGATCTACCACGCCGGCTGCTGCCGCCGCGGCCTCCCCTGGCTCGAGGACCGC
CTCGACCGCAAGCTGCGCGACCTGGCCGGCCACCGCGACCGGAGCGAGCAGCAGCTGGCCACCCTGCGCGACGGC
CACGAGCAGCAGCGCGCCCGCATCCAGGCGCTCGAGGGCATGGACGAGACGCCCAGCTGA
Transcript >Hirsu2|1118
ATGGCCGACCGAGGCTGGACCACCGTTGGCCACAGGATTCCGGCCGCTCAGCGCCACGGCCGCGAGCAGGAGCAG
AGGGAGCGTGAGGCCATCGCCGGCTGGGACAAGGACGACCATTGGCCGGGCATAAACAAGCCACTGTTCCAGACC
TCTGACGCGAAGCGCTTCGACGGCAGCTTGGAGAAGATTGGCGATCTCGGCCATGGCGCCTTCGGCCGGGTCGAC
ATGGTCAAGCACGGCGGCGTCGCCCTGGCCCGCAAGCGCATCGCCCGCCGGCGCGGCATCACCATCGACGACCTT
CGCCAGGAGGGCCTGACCATGGCCAAGCTCGACCACTGCCACGTCGTCCGCCTCGTCGCCACCTACGCGCCCAAG
TCGCACGAGCTGTGCCTGCTCATCTGGCCCGCCGCCGTCTGCAGCCTCAGCGTCCTGCTCGACGACATCGACAGC
CTGCGCCTGGGCGACGGCGGCGCCGACGAGACAGCCGAGCGGCTCGACCGGCTCGACGCGCTGCACCTCCTGGGT
GGCGCCGACGATGACGACATGGGCGGCGATACCACCAGAGACAGCGCGGGCGAGGACGCCGACTGGCGGCACGTC
GCCGGCAATAAGACGGCGCCGCCGCCGCCGGGAGCTCACTTCCGGCTCCGGCTGCCGTCCCGAGACCTGCAGCGC
ATCCAGTCCGGCGACGGCGACGGGCGCCCCTTCGACTTCCTCTGCGGCCTGCTCGGCTGCGTCGCCCGCGCCATG
GCCCACTGCCACGCCCAGGGCGTGCGCCACCTCGACATCAAGCCCTCCAACATCCTCCTCAACCCCGGCCGCGTC
TACCTGGCCGACTTCGGCATCTCGCGCGACGTCAGCGGCCAGGACCAGACGACGACGGACGGCATGCCCGGCACC
GAGAGGTGGCGGGCCCCCGAGCTGTACGGCGACGACGGCTCGAGCATGCAGCTATCCGACATGTACTCGCTCGGC
CTCGTCTACCTCGCCGTCGCCACCGTGCTCTACAACGCCCGCCTAGCCGACCTAGACAAGGCCCTCGCCTACCCG
GGCCCGTCGTCGCTCGACCTAGACGGCCGGCTGCGCGGTCGCGAGGACCGGCTCCGGCGCCACCTCGACAAGCTG
ACGGCCCACGCCCTCGTCACCCGCCGCTTCCGCTTCACCTACGAGGGCCAGGAGACGGTCCGGGCCCGGCCCGTC
CTCAGCCTCATCGCCAGCATGGTCTCGGCCGCGCCGCGCGCCCGCCCGTCCGCCAGGAAGGTCGACGAGAGGCTG
TCTGTCCTGGGCGGCCTGCAGCAGATCTACCACGCCGGCTGCTGCCGCCGCGGCCTCCCCTGGCTCGAGGACCGC
CTCGACCGCAAGCTGCGCGACCTGGCCGGCCACCGCGACCGGAGCGAGCAGCAGCTGGCCACCCTGCGCGACGGC
CACGAGCAGCAGCGCGCCCGCATCCAGGCGCTCGAGGGCATGGACGAGACGCCCAGCTGA
Gene >Hirsu2|1118
ATGGCCGACCGAGGCTGGACCACCGTTGGCCACAGGATTCCGGCCGCTCAGCGCCACGGCCGCGAGCAGGAGCAG
AGGGAGCGTGAGGCCATCGCCGGCTGGGACAAGGACGACCATTGGCCGGGCATGTGAGTCGCCGCGCCTCCTTTC
ATTGCTGGCAAGGGTCGATGTTGTTGTGGTGGTTGTGGTGGTGGTGGTAGTAGTGGTGGTGCGCGCCCACGACCG
CCTCCCAACCACTGTCTCTCTCTCGTTGTCCGCCGCAGTCCTGCTGGCGGGCCAATGCTGACGGCCAGCTCCCCA
ACGGCAGAAACAAGCCACTGTTCCAGACCTCTGACGCGAAGCGCTTCGACGGCAGCTTGGAGAAGATTGGCGATC
TCGGCCATGGCGCCTTCGGCCGGGTCGACATGGTCAAGCACGGCGGCGTCGCCCTGGCCCGCAAGCGCATCGCCC
GCCGGCGCGGCATCACCATCGACGACCTTCGCCAGGAGGGCCTGACCATGGCCAAGCTCGACCACTGCCACGTCG
TCCGCCTCGTCGCCACCTACGCGCCCAAGTCGCACGAGCTGTGCCTGCTCATCTGGCCCGCCGCCGTCTGCAGCC
TCAGCGTCCTGCTCGACGACATCGACAGCCTGCGCCTGGGCGACGGCGGCGCCGACGAGACAGCCGAGCGGCTCG
ACCGGCTCGACGCGCTGCACCTCCTGGGTGGCGCCGACGATGACGACATGGGCGGCGATACCACCAGAGACAGCG
CGGGCGAGGACGCCGACTGGCGGCACGTCGCCGGCAATAAGACGGCGCCGCCGCCGCCGGGAGCTCACTTCCGGC
TCCGGCTGCCGTCCCGAGACCTGCAGCGCATCCAGTCCGGCGACGGCGACGGGCGCCCCTTCGACTTCCTCTGCG
GCCTGCTCGGCTGCGTCGCCCGCGCCATGGCCCACTGCCACGCCCAGGGCGTGCGCCACCTCGACATCAAGCCCT
CCAACATCCTCCTCAACCCCGGCCGCGTCTACCTGGCCGACTTCGGCATCTCGCGCGACGTCAGCGGCCAGGACC
AGACGACGACGGACGGCATGCCCGGCACCGAGAGGTGGCGGGCCCCCGAGCTGTACGGCGACGACGGCTCGAGCA
TGCAGCTATCCGACATGTACTCGCTCGGCCTCGTCTACCTCGCCGTCGCCACCGTGCTCTACAACGCCCGCCTAG
CCGACCTAGACAAGGCCCTCGCCTACCCGGGCCCGTCGTCGCTCGACCTAGACGGCCGGCTGCGCGGTCGCGAGG
ACCGGCTCCGGCGCCACCTCGACAAGCTGACGGCCCACGCCCTCGTCACCCGCCGCTTCCGCTTCACCTACGAGG
GCCAGGAGACGGTCCGGGCCCGGCCCGTCCTCAGCCTCATCGCCAGCATGGTCTCGGCCGCGCCGCGCGCCCGCC
CGTCCGCCAGGAAGGTCGACGAGAGGCTGTCTGTCCTGGGCGGCCTGCAGCAGATCTACCACGCCGGCTGCTGCC
GCCGCGGCCTCCCCTGGCTCGAGGACCGCCTCGACCGCAAGCTGCGCGACCTGGCCGGCCACCGCGACCGGAGCG
AGCAGCAGCTGGCCACCCTGCGCGACGGCCACGAGCAGCAGCGCGCCCGCATCCAGGCGCTCGAGGGCATGGACG
AGACGTACCAGACCCGCATCCAGAACGCCCAGCGGACGCACCAGGGCGACATCGCCCGCCTGCAGGCCCAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail