Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11177
Gene name
LocationContig_979:8495..9843
Strand+
Gene length (bp)1348
Transcript length (bp)1032
Coding sequence length (bp)1032
Protein length (aa) 344

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13515 FUSC_2 Fusaric acid resistance protein-like 3.1E-06 1 103

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q07660|BRE4_YEAST Protein BRE4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BRE4 PE=1 SV=1 2 314 5.0E-36
sp|Q75E41|BRE4_ASHGO Protein BRE4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BRE4 PE=3 SV=2 4 337 7.0E-31
sp|Q10495|YDG8_SCHPO Uncharacterized protein C26F1.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26F1.08c PE=4 SV=1 5 290 4.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.5

Transmembrane Domains

Domain # Start End Length
1 12 34 22
2 39 56 17
3 63 80 17
4 95 117 22
5 124 146 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11177
MHPRVGGNLQDLVIRGFMAILGATWSGAAHAAGGGSPYVMAVFAAVFMLPMLYRFTQSSHPRSGLIGCLSFTVIS
LGLQAEGGGSSPVKLAVFKGIAFFVGATAPVLINWVLWPFVARHELRYALSSMMFFMSVIYRSVVARYVYFYEGT
EPTPEDVERSEMLEGRLREGFVRIRQLLVLTQKEIRLRAPFDPLPYSALADACERFFEYLVAVRQSALFYNPDYI
RDNPVAAAQLLGFRRDAVATVLANLYILAGALRSQRKVPRYLPSAAAARKRLLVRNAEVDEEMSRSASGSDAAWH
RRWSDIYRYSYNESLTGCVAQLEELEKLTKLIVGEQGFDEDGG*
Coding >Hirsu2|11177
ATGCACCCTAGAGTGGGCGGCAATCTCCAGGATCTCGTCATCAGGGGCTTCATGGCCATCCTCGGCGCTACTTGG
AGCGGCGCTGCACATGCGGCCGGCGGTGGGAGCCCGTACGTGATGGCGGTCTTCGCTGCCGTGTTCATGCTACCC
ATGCTGTACCGCTTCACACAAAGCTCACATCCGCGATCCGGACTCATTGGCTGTCTGTCCTTCACGGTCATTTCG
CTCGGGCTACAAGCCGAGGGCGGCGGCTCCTCCCCAGTCAAGCTTGCGGTGTTCAAGGGCATCGCATTCTTCGTC
GGCGCGACGGCTCCCGTACTCATCAACTGGGTTCTCTGGCCGTTCGTGGCCAGGCACGAGCTGAGATACGCGCTG
TCTTCCATGATGTTTTTCATGAGCGTCATCTATCGCAGCGTCGTTGCCCGCTATGTGTATTTCTACGAGGGTACC
GAACCCACGCCCGAGGACGTGGAGAGATCGGAGATGCTGGAAGGACGCCTCCGAGAAGGGTTTGTTCGGATCAGG
CAGCTCCTGGTGCTCACGCAGAAGGAAATACGGCTCCGCGCCCCCTTCGACCCCCTGCCCTACTCGGCGCTGGCG
GACGCGTGCGAGCGCTTCTTCGAGTACCTGGTGGCCGTGCGGCAGTCGGCGCTCTTCTACAACCCGGACTACATC
CGCGACAACCCCGTCGCCGCGGCGCAGCTCCTGGGCTTCCGCCGGGACGCCGTGGCGACGGTCCTGGCCAACCTG
TACATCCTGGCCGGGGCGCTGCGGTCGCAGCGCAAGGTGCCGCGATACCTGCCGAGCGCCGCCGCGGCGCGCAAG
AGGCTGCTGGTGCGCAACGCCGAGGTGGACGAGGAGATGTCGCGGAGCGCGAGCGGCAGCGACGCGGCGTGGCAC
AGGCGCTGGAGCGACATCTACCGCTACTCATACAACGAGAGCCTGACGGGCTGCGTCGCCCAGCTGGAGGAGCTC
GAGAAGCTGACCAAGCTCATCGTGGGCGAGCAGGGTTTCGACGAGGACGGGGGGTAG
Transcript >Hirsu2|11177
ATGCACCCTAGAGTGGGCGGCAATCTCCAGGATCTCGTCATCAGGGGCTTCATGGCCATCCTCGGCGCTACTTGG
AGCGGCGCTGCACATGCGGCCGGCGGTGGGAGCCCGTACGTGATGGCGGTCTTCGCTGCCGTGTTCATGCTACCC
ATGCTGTACCGCTTCACACAAAGCTCACATCCGCGATCCGGACTCATTGGCTGTCTGTCCTTCACGGTCATTTCG
CTCGGGCTACAAGCCGAGGGCGGCGGCTCCTCCCCAGTCAAGCTTGCGGTGTTCAAGGGCATCGCATTCTTCGTC
GGCGCGACGGCTCCCGTACTCATCAACTGGGTTCTCTGGCCGTTCGTGGCCAGGCACGAGCTGAGATACGCGCTG
TCTTCCATGATGTTTTTCATGAGCGTCATCTATCGCAGCGTCGTTGCCCGCTATGTGTATTTCTACGAGGGTACC
GAACCCACGCCCGAGGACGTGGAGAGATCGGAGATGCTGGAAGGACGCCTCCGAGAAGGGTTTGTTCGGATCAGG
CAGCTCCTGGTGCTCACGCAGAAGGAAATACGGCTCCGCGCCCCCTTCGACCCCCTGCCCTACTCGGCGCTGGCG
GACGCGTGCGAGCGCTTCTTCGAGTACCTGGTGGCCGTGCGGCAGTCGGCGCTCTTCTACAACCCGGACTACATC
CGCGACAACCCCGTCGCCGCGGCGCAGCTCCTGGGCTTCCGCCGGGACGCCGTGGCGACGGTCCTGGCCAACCTG
TACATCCTGGCCGGGGCGCTGCGGTCGCAGCGCAAGGTGCCGCGATACCTGCCGAGCGCCGCCGCGGCGCGCAAG
AGGCTGCTGGTGCGCAACGCCGAGGTGGACGAGGAGATGTCGCGGAGCGCGAGCGGCAGCGACGCGGCGTGGCAC
AGGCGCTGGAGCGACATCTACCGCTACTCATACAACGAGAGCCTGACGGGCTGCGTCGCCCAGCTGGAGGAGCTC
GAGAAGCTGACCAAGCTCATCGTGGGCGAGCAGGGTTTCGACGAGGACGGGGGGTAG
Gene >Hirsu2|11177
ATGCACCCTAGAGTGGGCGGCAATCTCCAGGATCTCGTCATCAGGGGCTTCATGGCCATCCTCGGCGCTACTTGG
AGCGGCGCTGCACATGCGGCCGGCGGTGGGAGCCCGTACGTGATGGCGGTCTTCGCTGCCGTGTTCATGCTACCC
ATGCTGTACCGCTTCACACAAAGCTCACATCCGGTAGATTCCCTACCTGGGCCGAGAAAGGGTCTTCTGAGGAAT
AACGCGCTGACGAGTTCACTAGCGATCCGGACTCATTGGCTGTCTGTCCTTCACGGTCATTTCGCTCGGGCTACA
AGCCGAGGGCGGCGGCTCCTCCCCAGTCAAGCTTGCGGTGTTCAAGGGCATCGCATTCTTCGTCGGCGCGACGGC
TCCCGTACTCATCAACTGGGTTCTCTGGCCGTTCGTGGCCAGGCACGAGCTGAGATACGCGCTGTCTTCCATGAT
GTTTTTCATGAGCGTCATCTATCGCAGTAGGTTCCCGAGTCCGTCTCGCGAAGCAGGCCGCGGTTTCTTACTGGT
GATAGGCGTCGTTGCCCGCTATGTGTATTTCTACGAGGGTACCGAACCCACGCCCGAGGACGTGGAGAGATCGGA
GATGCTGGAAGGACGCCTCCGAGAAGGGTTTGTTCGGATCAGGCAGCTCCTGGTGAGTAGCTCTTCAAGCAGCGG
AGCATCGAGGCCGCGGCCGCCGCTGACGCGCGGCATCCAAAAGGTGCTCACGCAGAAGGAAATACGGCTCCGCGC
CCCCTTCGACCCCCTGCCCTACTCGGCGCTGGCGGACGCGTGCGAGCGCTTCTTCGAGTACCTGGTGGCCGTGCG
GCAGTCGGCGCTCTTCTACAACCCGGACTACATCCGCGACAACCCCGTCGCCGCGGCGCAGCTCCTGGGCTTCCG
CCGGGACGCCGTGGCGACGGTCCTGGCCAACCTGTACATCCTGGCCGGGGCGCTGCGGTCGCAGCGCAAGGTGCC
GGTGGGTGCAAGGGGATAAGAGAATCCCCCCCCTCCCTCCGAAGTCGCGCACACGCTGACGACCTCAGCGATACC
TGCCGAGCGCCGCCGCGGCGCGCAAGAGGCTGCTGGTGCGCAACGCCGAGGTGGACGAGGAGATGTCGCGGAGCG
CGAGCGGCAGCGACGCGGCGTGGCACAGGCGCTGGAGCGACATCTACCGCTACTCATACAACGAGAGCCTGACGG
GCTGCGTCGCCCAGCTGGAGGAGCTCGAGAAGCTGACCAAGCTCATCGTGGGCGAGCAGGGGTAAGGCACCGCCC
CTCACGAGGGCGGCTTTTGGCTGACGCGTCGGACGGACGCCCACGAGATAGTTTCGACGAGGACGGGGGGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail