Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11176
Gene name
LocationContig_979:6534..7507
Strand+
Gene length (bp)973
Transcript length (bp)870
Coding sequence length (bp)870
Protein length (aa) 290

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10337 ArAE_2_N Putative ER transporter, 6TM, N-terminal 6.6E-06 84 161

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q07660|BRE4_YEAST Protein BRE4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BRE4 PE=1 SV=1 8 226 3.0E-26
sp|Q75E41|BRE4_ASHGO Protein BRE4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BRE4 PE=3 SV=2 8 249 4.0E-14

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

Domain # Start End Length
1 81 103 22
2 161 183 22
3 185 207 22
4 222 241 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11176
MISDDKIDTETYGVSELRDGFFDALFVKPSTSSPEELLQHVEDTLPPEFDRVSPLAPSRILPRQWHSLRSIFRRV
TRTRAGVLLLKSFTAFFVAYVLCLVPAIRDWLGRYHYIMVVSVILNHPARAFGSQLDGAALTTLGTACGLGWGAV
GMLLSTATTPARAGYGGLLAMMLALFMASLALIRAFFIRFYQAIMAAGIAIVFTTLAETSGVEITWIKLFDYGIP
WLFGQAIALVINCLISPDAGSRAIAYSLHASFAVMQEALVVPSQQDRRLRRRLARSFVELSQAG*
Coding >Hirsu2|11176
ATGATCTCAGATGACAAGATTGACACGGAAACGTATGGCGTGTCCGAACTTCGCGACGGCTTTTTCGATGCCCTT
TTCGTCAAGCCGTCGACTTCGTCTCCTGAAGAGCTGCTACAACATGTCGAGGATACGCTGCCGCCCGAGTTTGAC
AGGGTCTCGCCTCTTGCCCCCAGCCGAATCCTCCCCAGGCAATGGCACTCGCTGCGGTCCATCTTCCGGCGCGTC
ACGAGGACTAGGGCTGGCGTTCTGCTCCTCAAGTCCTTCACTGCCTTCTTCGTAGCCTACGTCCTATGCCTCGTC
CCGGCCATCCGCGATTGGCTTGGTCGCTATCATTACATCATGGTCGTTTCTGTCATCCTCAACCACCCAGCCAGA
GCATTCGGATCTCAGCTGGACGGAGCTGCCCTTACTACCCTCGGCACTGCGTGTGGACTCGGCTGGGGTGCCGTG
GGCATGCTGTTGTCCACGGCGACAACCCCTGCGCGGGCCGGGTACGGAGGTTTGTTGGCCATGATGCTTGCGCTG
TTCATGGCCTCGCTGGCCCTGATACGTGCCTTTTTCATCAGGTTTTATCAGGCCATCATGGCTGCCGGCATTGCC
ATCGTCTTCACGACCCTGGCTGAGACTAGCGGTGTCGAGATTACTTGGATAAAGCTGTTCGACTATGGCATCCCT
TGGCTTTTCGGACAGGCCATCGCTTTGGTCATCAATTGCCTCATCTCCCCCGATGCCGGATCGAGAGCCATAGCC
TACTCATTGCACGCCTCTTTTGCTGTCATGCAGGAAGCCCTCGTCGTCCCCAGCCAACAGGACAGGAGGCTGCGG
CGGCGTCTGGCGCGATCTTTCGTGGAGCTGTCGCAAGCCGGATGA
Transcript >Hirsu2|11176
ATGATCTCAGATGACAAGATTGACACGGAAACGTATGGCGTGTCCGAACTTCGCGACGGCTTTTTCGATGCCCTT
TTCGTCAAGCCGTCGACTTCGTCTCCTGAAGAGCTGCTACAACATGTCGAGGATACGCTGCCGCCCGAGTTTGAC
AGGGTCTCGCCTCTTGCCCCCAGCCGAATCCTCCCCAGGCAATGGCACTCGCTGCGGTCCATCTTCCGGCGCGTC
ACGAGGACTAGGGCTGGCGTTCTGCTCCTCAAGTCCTTCACTGCCTTCTTCGTAGCCTACGTCCTATGCCTCGTC
CCGGCCATCCGCGATTGGCTTGGTCGCTATCATTACATCATGGTCGTTTCTGTCATCCTCAACCACCCAGCCAGA
GCATTCGGATCTCAGCTGGACGGAGCTGCCCTTACTACCCTCGGCACTGCGTGTGGACTCGGCTGGGGTGCCGTG
GGCATGCTGTTGTCCACGGCGACAACCCCTGCGCGGGCCGGGTACGGAGGTTTGTTGGCCATGATGCTTGCGCTG
TTCATGGCCTCGCTGGCCCTGATACGTGCCTTTTTCATCAGGTTTTATCAGGCCATCATGGCTGCCGGCATTGCC
ATCGTCTTCACGACCCTGGCTGAGACTAGCGGTGTCGAGATTACTTGGATAAAGCTGTTCGACTATGGCATCCCT
TGGCTTTTCGGACAGGCCATCGCTTTGGTCATCAATTGCCTCATCTCCCCCGATGCCGGATCGAGAGCCATAGCC
TACTCATTGCACGCCTCTTTTGCTGTCATGCAGGAAGCCCTCGTCGTCCCCAGCCAACAGGACAGGAGGCTGCGG
CGGCGTCTGGCGCGATCTTTCGTGGAGCTGTCGCAAGCCGGATGA
Gene >Hirsu2|11176
ATGATCTCAGATGACAAGATTGACACGGAAACGTATGGCGTGTCCGAACTTCGCGACGGCTTTTTCGATGCCCTT
TTCGTCAAGCCGTCGACTTCGTCTCCTGAAGAGCTGCTACAACATGTCGAGGATACGCTGCCGCCCGAGTTTGAC
AGGGTCTCGCCTCTTGCCCCCAGCCGAATCCTCCCCAGGCAATGGCACTCGCTGCGGTCCATCTTCCGGCGCGTC
ACGAGGACTAGGGCTGGCGTTCTGCTCCTCAAGTCCTTCACTGCCTTCTTCGTAGCCTACGTCCTATGCCTCGTC
CCGGCCATCCGCGATTGGCTTGGTCGCTATCATTACATCATGGTCGTTTCTGTCATCCTCAACCACCCAGCCAGA
GCATTCGGATCTCAGCTGGACGGAGCTGCCCTTACTACCCTCGGCACTGCGTGTGGACTCGGCTGGGGTGCCGTG
GGCATGCTGTTGTCCACGGCGACAACCCCTGCGCGGGCCGGGTACGGAGGTTTGTTGGCCATGATGCTTGCGCTG
TTCATGGCCTCGCTGGCCCTGATACGTGCCTTTTTCATCAGGTTTTATCAGGCCATCATGGCTGCCGGCATTGCC
ATCGTCTTCACGACCCTGGCTGAGACTAGCGGTGTCGAGATTACTTGGATAAAGCTGTTCGACTATGGCATCCCT
TGGCTTTTCGGACAGGCCATCGCTTTGGTCATCAATTGCCTCATCTCCCCCGATGCCGGATCGAGAGCCATAGCC
TACTCATTGCACGCCTCTTTTGCTGTCATGCAGGTTTGTACTGTGACCTTTCCACTCGCGAGTGTCTGACGTCGC
TGATTCAGCGCCATCAGGAAGCCCTCGTCGTCCCCAGCCAACAGGACAGGAGGCTGCGGCGGCGTCTGGCGCGAT
CTTTCGTGGAGCTGTCGCAAGTATGTCGTGACATGAGAATCGATATCACGATAACACGATTCAGGCCGGATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail