Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11162
Gene name
LocationContig_976:6999..8644
Strand+
Gene length (bp)1645
Transcript length (bp)1341
Coding sequence length (bp)1341
Protein length (aa) 447

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01467 CTP_transf_like Cytidylyltransferase-like 9.6E-22 19 142

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q55BZ4|PCY2_DICDI Ethanolamine-phosphate cytidylyltransferase OS=Dictyostelium discoideum GN=pctA PE=1 SV=1 16 420 5.0E-82
sp|Q99447|PCY2_HUMAN Ethanolamine-phosphate cytidylyltransferase OS=Homo sapiens GN=PCYT2 PE=1 SV=1 16 429 1.0E-81
sp|O88637|PCY2_RAT Ethanolamine-phosphate cytidylyltransferase OS=Rattus norvegicus GN=Pcyt2 PE=1 SV=1 16 431 2.0E-81
sp|Q922E4|PCY2_MOUSE Ethanolamine-phosphate cytidylyltransferase OS=Mus musculus GN=Pcyt2 PE=1 SV=1 16 420 5.0E-81
sp|Q5EA75|PCY2_BOVIN Ethanolamine-phosphate cytidylyltransferase OS=Bos taurus GN=PCYT2 PE=2 SV=1 16 441 1.0E-80
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q55BZ4|PCY2_DICDI Ethanolamine-phosphate cytidylyltransferase OS=Dictyostelium discoideum GN=pctA PE=1 SV=1 16 420 5.0E-82
sp|Q99447|PCY2_HUMAN Ethanolamine-phosphate cytidylyltransferase OS=Homo sapiens GN=PCYT2 PE=1 SV=1 16 429 1.0E-81
sp|O88637|PCY2_RAT Ethanolamine-phosphate cytidylyltransferase OS=Rattus norvegicus GN=Pcyt2 PE=1 SV=1 16 431 2.0E-81
sp|Q922E4|PCY2_MOUSE Ethanolamine-phosphate cytidylyltransferase OS=Mus musculus GN=Pcyt2 PE=1 SV=1 16 420 5.0E-81
sp|Q5EA75|PCY2_BOVIN Ethanolamine-phosphate cytidylyltransferase OS=Bos taurus GN=PCYT2 PE=2 SV=1 16 441 1.0E-80
sp|Q9ZVI9|PECT1_ARATH Ethanolamine-phosphate cytidylyltransferase OS=Arabidopsis thaliana GN=PECT1 PE=1 SV=1 16 417 5.0E-72
sp|Q9UTI6|ECT1_SCHPO Probable ethanolamine-phosphate cytidylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC15E1.05c PE=2 SV=1 8 429 7.0E-67
sp|P33412|ECT1_YEAST Ethanolamine-phosphate cytidylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECT1 PE=1 SV=1 16 419 9.0E-53
sp|Q8SQW6|ECT1_ENCCU Probable ethanolamine-phosphate cytidylyltransferase OS=Encephalitozoon cuniculi (strain GB-M1) GN=MUQ1 PE=1 SV=1 16 417 4.0E-47
sp|F4JJE0|CCT2_ARATH Choline-phosphate cytidylyltransferase 2 OS=Arabidopsis thaliana GN=CCT2 PE=1 SV=1 16 194 1.0E-24
sp|P49585|PCY1A_HUMAN Choline-phosphate cytidylyltransferase A OS=Homo sapiens GN=PCYT1A PE=1 SV=2 16 165 6.0E-23
sp|P19836|PCY1A_RAT Choline-phosphate cytidylyltransferase A OS=Rattus norvegicus GN=Pcyt1a PE=1 SV=2 16 165 1.0E-22
sp|P49584|PCY1A_CRIGR Choline-phosphate cytidylyltransferase A OS=Cricetulus griseus GN=PCYT1A PE=2 SV=1 16 165 1.0E-22
sp|Q9ZV56|CCT1_ARATH Choline-phosphate cytidylyltransferase 1 OS=Arabidopsis thaliana GN=CCT1 PE=1 SV=1 16 165 2.0E-22
sp|P49586|PCY1A_MOUSE Choline-phosphate cytidylyltransferase A OS=Mus musculus GN=Pcyt1a PE=1 SV=1 16 165 4.0E-22
sp|Q9Y5K3|PCY1B_HUMAN Choline-phosphate cytidylyltransferase B OS=Homo sapiens GN=PCYT1B PE=1 SV=1 16 146 6.0E-21
sp|Q811Q9|PCY1B_MOUSE Choline-phosphate cytidylyltransferase B OS=Mus musculus GN=Pcyt1b PE=1 SV=2 16 146 6.0E-21
sp|Q9QZC4|PCY1B_RAT Choline-phosphate cytidylyltransferase B OS=Rattus norvegicus GN=Pcyt1b PE=1 SV=1 16 146 6.0E-21
sp|P49587|PCY1_PLAFK Choline-phosphate cytidylyltransferase OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CTP PE=2 SV=1 17 159 1.0E-19
sp|O74975|PCY1_SCHPO Probable choline-phosphate cytidylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.02c PE=1 SV=3 10 159 2.0E-19
sp|P13259|PCY1_YEAST Choline-phosphate cytidylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCT1 PE=1 SV=2 16 236 3.0E-19
sp|P49583|PCY1_CAEEL Putative choline-phosphate cytidylyltransferase OS=Caenorhabditis elegans GN=F08C6.2 PE=3 SV=2 16 208 2.0E-15
sp|Q99447|PCY2_HUMAN Ethanolamine-phosphate cytidylyltransferase OS=Homo sapiens GN=PCYT2 PE=1 SV=1 10 146 8.0E-15
sp|Q922E4|PCY2_MOUSE Ethanolamine-phosphate cytidylyltransferase OS=Mus musculus GN=Pcyt2 PE=1 SV=1 10 146 7.0E-14
sp|O88637|PCY2_RAT Ethanolamine-phosphate cytidylyltransferase OS=Rattus norvegicus GN=Pcyt2 PE=1 SV=1 10 146 1.0E-13
sp|Q5EA75|PCY2_BOVIN Ethanolamine-phosphate cytidylyltransferase OS=Bos taurus GN=PCYT2 PE=2 SV=1 10 146 9.0E-13
sp|Q9Y5K3|PCY1B_HUMAN Choline-phosphate cytidylyltransferase B OS=Homo sapiens GN=PCYT1B PE=1 SV=1 226 422 3.0E-10
sp|Q9QZC4|PCY1B_RAT Choline-phosphate cytidylyltransferase B OS=Rattus norvegicus GN=Pcyt1b PE=1 SV=1 226 422 7.0E-10
sp|Q811Q9|PCY1B_MOUSE Choline-phosphate cytidylyltransferase B OS=Mus musculus GN=Pcyt1b PE=1 SV=2 226 422 7.0E-10
sp|P49585|PCY1A_HUMAN Choline-phosphate cytidylyltransferase A OS=Homo sapiens GN=PCYT1A PE=1 SV=2 227 422 2.0E-09
sp|P19836|PCY1A_RAT Choline-phosphate cytidylyltransferase A OS=Rattus norvegicus GN=Pcyt1a PE=1 SV=2 227 422 2.0E-09
sp|Q0VM60|HLDE_ALCBS Bifunctional protein HldE OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=hldE PE=3 SV=1 17 145 2.0E-08
sp|B0TTF2|HLDE_SHEHH Bifunctional protein HldE OS=Shewanella halifaxensis (strain HAW-EB4) GN=hldE PE=3 SV=1 17 146 8.0E-08
sp|Q2SN34|HLDE_HAHCH Bifunctional protein HldE OS=Hahella chejuensis (strain KCTC 2396) GN=hldE PE=3 SV=1 14 79 8.0E-08
sp|Q3A526|HLDE_PELCD Bifunctional protein HldE OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=hldE PE=3 SV=1 17 146 2.0E-07
sp|Q07RN1|HLDE_RHOP5 Bifunctional protein HldE OS=Rhodopseudomonas palustris (strain BisA53) GN=hldE PE=3 SV=1 6 144 2.0E-07
sp|B3E5M9|HLDE_GEOLS Bifunctional protein HldE OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=hldE PE=3 SV=1 9 146 2.0E-07
sp|Q12RC7|HLDE_SHEDO Bifunctional protein HldE OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=hldE PE=3 SV=2 17 146 2.0E-07
sp|C6DDL3|HLDE_PECCP Bifunctional protein HldE OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=hldE PE=3 SV=1 14 145 2.0E-07
sp|B7VIX1|HLDE_VIBTL Bifunctional protein HldE OS=Vibrio tasmaniensis (strain LGP32) GN=hldE PE=3 SV=1 14 142 3.0E-07
sp|Q6D164|HLDE_PECAS Bifunctional protein HldE OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=hldE PE=3 SV=2 14 145 3.0E-07
sp|A8H086|HLDE_SHEPA Bifunctional protein HldE OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=hldE PE=3 SV=2 17 146 4.0E-07
sp|C3LQY0|HLDE_VIBCM Bifunctional protein HldE OS=Vibrio cholerae serotype O1 (strain M66-2) GN=hldE PE=3 SV=1 14 142 5.0E-07
sp|B0T663|HLDE_CAUSK Bifunctional protein HldE OS=Caulobacter sp. (strain K31) GN=hldE PE=3 SV=1 18 145 5.0E-07
sp|Q219E2|HLDE_RHOPB Bifunctional protein HldE OS=Rhodopseudomonas palustris (strain BisB18) GN=hldE PE=3 SV=1 6 144 6.0E-07
sp|A8FZZ3|HLDE_SHESH Bifunctional protein HldE OS=Shewanella sediminis (strain HAW-EB3) GN=hldE PE=3 SV=1 17 146 7.0E-07
sp|Q7MNY3|HLDE_VIBVY Bifunctional protein HldE OS=Vibrio vulnificus (strain YJ016) GN=hldE PE=3 SV=2 14 142 7.0E-07
sp|Q8DEH7|HLDE_VIBVU Bifunctional protein HldE OS=Vibrio vulnificus (strain CMCP6) GN=hldE PE=3 SV=1 14 142 7.0E-07
sp|Q07Y78|HLDE_SHEFN Bifunctional protein HldE OS=Shewanella frigidimarina (strain NCIMB 400) GN=hldE PE=3 SV=1 17 146 7.0E-07
sp|A1S3I3|HLDE_SHEAM Bifunctional protein HldE OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=hldE PE=3 SV=1 17 146 9.0E-07
sp|B4EW46|HLDE_PROMH Bifunctional protein HldE OS=Proteus mirabilis (strain HI4320) GN=hldE PE=3 SV=1 17 145 1.0E-06
sp|A5F5J2|HLDE_VIBC3 Bifunctional protein HldE OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=hldE PE=3 SV=1 14 142 1.0E-06
sp|Q1R1M6|HLDE_CHRSD Bifunctional protein HldE OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=hldE PE=3 SV=1 17 146 1.0E-06
sp|Q5E2L7|HLDE_VIBF1 Bifunctional protein HldE OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=hldE PE=3 SV=1 14 142 2.0E-06
sp|B5FB67|HLDE_VIBFM Bifunctional protein HldE OS=Vibrio fischeri (strain MJ11) GN=hldE PE=3 SV=1 14 142 2.0E-06
sp|A3QAN3|HLDE_SHELP Bifunctional protein HldE OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=hldE PE=3 SV=1 17 146 2.0E-06
sp|O58466|RIBL_PYRHO FAD synthase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=ribL PE=3 SV=1 16 140 2.0E-06
sp|A1TYR4|HLDE_MARHV Bifunctional protein HldE OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=hldE PE=3 SV=1 2 145 5.0E-06
sp|Q3IHX7|HLDE_PSEHT Bifunctional protein HldE OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=hldE PE=3 SV=1 14 145 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0003824 catalytic activity Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11162
MSALEGDAAPELLEGRIWVDGCFDFFHHGHAGAMVQARQLGDELYVGVHSDEDILANKGPTVMTLDERLAATNAC
RWVTRSVGHAPYVTQLPYITHYGCKYVVHGDDITSDSDGNDCYRFVKEAGRFKVVKRSPGISTTDLVGRMLLCTK
THFIHSLKRVLAGEEGYGSPEERLAEGRAMMERIELYATDQTAKAPGADVWFWDGPSDRQGDGESGGGGGSFSKL
LGGPGPRPGQRIVYVDGGFDLFSSGHIEFLRKVEEEEERELGRKAGWFDDSAVTRRRAHSTHGGDYGPAFVVVGV
HEDDVINEWKGVNYPIMNIYERGLCVLQCKYIDAVVFGAPFTPSKAYLTTLPWGVPDAIYHGPTSFMPLTHDPYT
APKAMGIYREIGEHAFSEVNAAQIVQRIMRSRDMYEARQRAKGVKAEVEAAARRRELMEEEQRKREAQRGE*
Coding >Hirsu2|11162
ATGAGTGCGCTCGAAGGCGATGCCGCCCCCGAGCTGCTCGAGGGCCGCATCTGGGTCGATGGCTGCTTCGATTTT
TTCCATCATGGCCACGCTGGAGCCATGGTCCAGGCCCGACAGCTGGGTGACGAGCTCTACGTCGGCGTTCATTCG
GATGAGGACATACTGGCCAACAAGGGCCCGACCGTCATGACTCTGGACGAGCGACTGGCAGCCACGAACGCATGT
CGCTGGGTCACACGATCCGTCGGTCACGCCCCCTACGTGACGCAGCTGCCGTACATCACCCACTACGGCTGCAAG
TACGTGGTGCACGGCGACGACATCACGTCGGACAGCGACGGCAACGACTGCTACCGCTTCGTCAAGGAGGCCGGG
CGCTTCAAAGTAGTTAAGCGCTCGCCCGGCATCTCGACGACGGACCTGGTCGGCCGCATGCTGCTCTGCACCAAG
ACGCACTTCATCCACTCCCTGAAGCGCGTGCTGGCGGGCGAAGAGGGCTATGGCTCGCCCGAAGAGCGCCTCGCC
GAAGGCCGCGCCATGATGGAGCGCATCGAACTCTACGCAACGGACCAGACGGCCAAGGCGCCAGGCGCCGACGTA
TGGTTCTGGGATGGGCCCTCGGATCGGCAGGGCGACGGGGAGAGTGGCGGCGGCGGCGGCTCCTTCAGCAAGCTG
CTGGGCGGGCCGGGCCCGCGCCCGGGACAACGCATCGTCTACGTCGACGGCGGCTTCGACCTTTTCTCGAGCGGG
CACATCGAGTTCCTGCGCAAGGTGGAGGAGGAGGAGGAGCGTGAGCTGGGCCGCAAGGCAGGTTGGTTTGACGAC
AGCGCCGTGACACGGCGGCGGGCGCACAGCACCCACGGCGGCGACTACGGGCCGGCGTTCGTGGTGGTGGGCGTG
CATGAGGACGACGTCATCAACGAGTGGAAGGGCGTCAACTACCCTATCATGAACATTTACGAGCGAGGGCTGTGC
GTGCTGCAGTGCAAGTACATCGACGCCGTCGTGTTTGGGGCGCCCTTCACGCCGAGCAAGGCGTACCTGACGACG
TTGCCGTGGGGGGTGCCGGACGCCATCTACCACGGGCCGACGTCGTTCATGCCGCTGACGCACGACCCGTACACG
GCGCCCAAGGCCATGGGCATCTACCGCGAGATTGGCGAGCACGCCTTCTCGGAGGTGAATGCGGCGCAGATTGTG
CAGCGCATCATGAGGAGCCGTGACATGTACGAGGCGCGGCAGCGGGCCAAGGGCGTCAAGGCCGAGGTCGAGGCG
GCGGCCAGGCGGCGGGAGCTGATGGAGGAGGAGCAGCGCAAGCGGGAGGCTCAGAGGGGGGAATGA
Transcript >Hirsu2|11162
ATGAGTGCGCTCGAAGGCGATGCCGCCCCCGAGCTGCTCGAGGGCCGCATCTGGGTCGATGGCTGCTTCGATTTT
TTCCATCATGGCCACGCTGGAGCCATGGTCCAGGCCCGACAGCTGGGTGACGAGCTCTACGTCGGCGTTCATTCG
GATGAGGACATACTGGCCAACAAGGGCCCGACCGTCATGACTCTGGACGAGCGACTGGCAGCCACGAACGCATGT
CGCTGGGTCACACGATCCGTCGGTCACGCCCCCTACGTGACGCAGCTGCCGTACATCACCCACTACGGCTGCAAG
TACGTGGTGCACGGCGACGACATCACGTCGGACAGCGACGGCAACGACTGCTACCGCTTCGTCAAGGAGGCCGGG
CGCTTCAAAGTAGTTAAGCGCTCGCCCGGCATCTCGACGACGGACCTGGTCGGCCGCATGCTGCTCTGCACCAAG
ACGCACTTCATCCACTCCCTGAAGCGCGTGCTGGCGGGCGAAGAGGGCTATGGCTCGCCCGAAGAGCGCCTCGCC
GAAGGCCGCGCCATGATGGAGCGCATCGAACTCTACGCAACGGACCAGACGGCCAAGGCGCCAGGCGCCGACGTA
TGGTTCTGGGATGGGCCCTCGGATCGGCAGGGCGACGGGGAGAGTGGCGGCGGCGGCGGCTCCTTCAGCAAGCTG
CTGGGCGGGCCGGGCCCGCGCCCGGGACAACGCATCGTCTACGTCGACGGCGGCTTCGACCTTTTCTCGAGCGGG
CACATCGAGTTCCTGCGCAAGGTGGAGGAGGAGGAGGAGCGTGAGCTGGGCCGCAAGGCAGGTTGGTTTGACGAC
AGCGCCGTGACACGGCGGCGGGCGCACAGCACCCACGGCGGCGACTACGGGCCGGCGTTCGTGGTGGTGGGCGTG
CATGAGGACGACGTCATCAACGAGTGGAAGGGCGTCAACTACCCTATCATGAACATTTACGAGCGAGGGCTGTGC
GTGCTGCAGTGCAAGTACATCGACGCCGTCGTGTTTGGGGCGCCCTTCACGCCGAGCAAGGCGTACCTGACGACG
TTGCCGTGGGGGGTGCCGGACGCCATCTACCACGGGCCGACGTCGTTCATGCCGCTGACGCACGACCCGTACACG
GCGCCCAAGGCCATGGGCATCTACCGCGAGATTGGCGAGCACGCCTTCTCGGAGGTGAATGCGGCGCAGATTGTG
CAGCGCATCATGAGGAGCCGTGACATGTACGAGGCGCGGCAGCGGGCCAAGGGCGTCAAGGCCGAGGTCGAGGCG
GCGGCCAGGCGGCGGGAGCTGATGGAGGAGGAGCAGCGCAAGCGGGAGGCTCAGAGGGGGGAATGA
Gene >Hirsu2|11162
ATGAGTGCGCTCGAAGGCGATGCCGCCCCCGAGCTGCTCGAGGGCCGCATCTGGGTCGATGGCTGCTTCGATTTT
TTCCATCATGGTACGTCTCTCGCCTCATGCTGTCTCCCCCATTGAACATTTGGCGCTGCCGTGCTCTGCGCCACA
AACGGCAACGATGGCAAGCTCGCTGACCCCGACAGGCCACGCTGGAGCCATGGTCCAGGCCCGACAGCTGGGTGA
CGAGCTCTACGTCGGCGTTCATTCGGATGAGGACATACTGGCCAACAAGGGCCCGACCGTCATGACTCTGGACGA
GCGGTCCGTCCCACCGCCGACAACCTTCCTCCCCTCTCCCTCGCCGACCGCGCCCCCGCCCCTCCGCGACGAGAA
GCACCTGACTGACGCCACGACGATCCGACCGAGGCATCTACATGGCGCAGACTGGCAGCCACGAACGCATGTCGC
TGGGTCACACGATCCGTCGGTCACGCCCCCTACGTGACGCAGCTGCCGTACATCACCCACTACGGCTGCAAGTAC
GTGGTGCACGGCGACGACATCACGTCGGACAGCGACGGCAACGACTGCTACCGCTTCGTCAAGGAGGCCGGGCGC
TTCAAAGTAGTTAAGCGCTCGCCCGGCATCTCGACGACGGACCTGGTCGGCCGCATGCTGCTCTGCACCAAGACG
CACTTCATCCACTCCCTGAAGCGCGTGCTGGCGGGCGAAGAGGGCTATGGCTCGCCCGAAGAGCGCCTCGCCGAA
GGCCGCGCCATGATGGAGCGCATCGAACTCTACGCAACGGACCAGACGGCCAAGGCGCCAGGCGCCGACGTATGG
TTCTGGGATGGGCCCTCGGATCGGCAGGGCGACGGGGAGAGTGGCGGCGGCGGCGGCTCCTTCAGCAAGCTGCTG
GGCGGGCCGGGCCCGCGCCCGGGACAACGCATCGTCTACGTCGACGGCGGCTTCGACCTTTTCTCGAGCGGGCAC
ATCGAGTTCCTGCGCAAGGTGGAGGAGGAGGAGGAGCGTGAGCTGGGCCGCAAGGCAGGTTGGTTTGACGACAGC
GCCGTGACACGGCGGCGGGCGCACAGCACCCACGGCGGCGACTACGGGCCGGCGTTCGTGGTGGTGGGCGTGCAT
GAGGACGACGTCATCAACGAGTGGAAGGGCGTCAACTACCCTATCATGAACATTTACGAGCGAGGGCTGTGCGTG
CTGCAGTGCAAGGTGTGTTGCTCGCCCCGTTGACCGAGGGAAGAGGCAAGAATGCGGGCGGCGAGATGCTGACGG
GCGGGCCGGCCATGACCAGTACATCGACGCCGTCGTGTTTGGGGCGCCCTTCACGCCGAGCAAGGCGTACCTGAC
GACGTTGCCGTGGGGGGTGCCGGACGCCATCTACCACGGGCCGACGTCGTTCATGCCGCTGACGCACGACCCGTA
CACGGCGCCCAAGGCCATGGGCATCTACCGCGAGATTGGCGAGCACGCCTTCTCGGAGGTGAATGCGGCGCAGAT
TGTGCAGCGCATCATGAGGAGCCGTGACATGTACGAGGCGCGGCAGCGGGCCAAGGGCGTCAAGGCCGAGGTCGA
GGCGGCGGCCAGGCGGCGGGAGCTGATGGAGGAGGAGCAGCGCAAGCGGGAGGCTCAGAGGGGGGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail