Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11160
Gene name
LocationContig_976:2332..3187
Strand+
Gene length (bp)855
Transcript length (bp)693
Coding sequence length (bp)693
Protein length (aa) 231

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00472 RF-1 RF-1 domain 3.9E-34 75 179

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B0SQV0|RF1_LEPBP Peptide chain release factor 1 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=prfA PE=3 SV=1 7 203 8.0E-38
sp|B0SH84|RF1_LEPBA Peptide chain release factor 1 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=prfA PE=3 SV=1 7 203 8.0E-38
sp|Q09691|RF1M_SCHPO Putative peptide chain release factor 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2F7.17 PE=3 SV=1 54 205 2.0E-37
sp|Q67TD5|RF1_SYMTH Peptide chain release factor 1 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=prfA PE=3 SV=1 77 222 2.0E-35
sp|C5BSZ6|RF1_TERTT Peptide chain release factor 1 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=prfA PE=3 SV=1 74 202 1.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B0SQV0|RF1_LEPBP Peptide chain release factor 1 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=prfA PE=3 SV=1 7 203 8.0E-38
sp|B0SH84|RF1_LEPBA Peptide chain release factor 1 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=prfA PE=3 SV=1 7 203 8.0E-38
sp|Q09691|RF1M_SCHPO Putative peptide chain release factor 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2F7.17 PE=3 SV=1 54 205 2.0E-37
sp|Q67TD5|RF1_SYMTH Peptide chain release factor 1 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=prfA PE=3 SV=1 77 222 2.0E-35
sp|C5BSZ6|RF1_TERTT Peptide chain release factor 1 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=prfA PE=3 SV=1 74 202 1.0E-34
sp|B1GZI5|RF1_UNCTG Peptide chain release factor 1 OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=prfA PE=3 SV=1 77 203 2.0E-34
sp|B3QCF6|RF1_RHOPT Peptide chain release factor 1 OS=Rhodopseudomonas palustris (strain TIE-1) GN=prfA PE=3 SV=1 77 198 3.0E-34
sp|Q6NC66|RF1_RHOPA Peptide chain release factor 1 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=prfA PE=3 SV=1 77 198 3.0E-34
sp|Q3SVP7|RF1_NITWN Peptide chain release factor 1 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=prfA PE=3 SV=1 72 203 3.0E-34
sp|Q9PL16|RF1_CHLMU Peptide chain release factor 1 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=prfA PE=3 SV=1 47 221 5.0E-34
sp|Q9Z968|RF1_CHLPN Peptide chain release factor 1 OS=Chlamydia pneumoniae GN=prfA PE=3 SV=1 47 193 1.0E-33
sp|B9L5Z9|RF1_NAUPA Peptide chain release factor 1 OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=prfA PE=3 SV=1 77 229 1.0E-33
sp|Q822M2|RF1_CHLCV Peptide chain release factor 1 OS=Chlamydophila caviae (strain GPIC) GN=prfA PE=3 SV=1 47 193 1.0E-33
sp|C4LBL5|RF1_TOLAT Peptide chain release factor 1 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=prfA PE=3 SV=1 47 202 2.0E-33
sp|C6DHY1|RF1_PECCP Peptide chain release factor 1 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=prfA PE=3 SV=1 7 202 2.0E-33
sp|Q1QQY7|RF1_NITHX Peptide chain release factor 1 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=prfA PE=3 SV=1 77 203 2.0E-33
sp|Q89XT9|RF1_BRADU Peptide chain release factor 1 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=prfA PE=3 SV=1 77 198 2.0E-33
sp|Q13F02|RF1_RHOPS Peptide chain release factor 1 OS=Rhodopseudomonas palustris (strain BisB5) GN=prfA PE=3 SV=1 73 198 4.0E-33
sp|Q255B5|RF1_CHLFF Peptide chain release factor 1 OS=Chlamydophila felis (strain Fe/C-56) GN=prfA PE=3 SV=1 47 193 4.0E-33
sp|Q5NIA8|RF1_FRATT Peptide chain release factor 1 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=prfA PE=3 SV=1 76 202 4.0E-33
sp|Q14JR1|RF1_FRAT1 Peptide chain release factor 1 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=prfA PE=3 SV=1 76 202 4.0E-33
sp|B2SFF6|RF1_FRATM Peptide chain release factor 1 OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=prfA PE=3 SV=1 76 202 4.0E-33
sp|A4IWC1|RF1_FRATW Peptide chain release factor 1 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=prfA PE=3 SV=1 76 202 4.0E-33
sp|Q0BKE8|RF1_FRATO Peptide chain release factor 1 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=prfA PE=3 SV=1 76 202 4.0E-33
sp|Q2A1Q0|RF1_FRATH Peptide chain release factor 1 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=prfA PE=3 SV=1 76 202 4.0E-33
sp|A7NE96|RF1_FRATF Peptide chain release factor 1 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=prfA PE=3 SV=1 76 202 4.0E-33
sp|A9BP60|RF1_DELAS Peptide chain release factor 1 OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=prfA PE=3 SV=1 47 214 5.0E-33
sp|B2IHL7|RF1_BEII9 Peptide chain release factor 1 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=prfA PE=3 SV=1 74 222 5.0E-33
sp|Q07VB3|RF1_RHOP5 Peptide chain release factor 1 OS=Rhodopseudomonas palustris (strain BisA53) GN=prfA PE=3 SV=1 77 193 6.0E-33
sp|A0Q844|RF1_FRATN Peptide chain release factor 1 OS=Francisella tularensis subsp. novicida (strain U112) GN=prfA PE=3 SV=1 76 202 7.0E-33
sp|Q5L5L4|RF1_CHLAB Peptide chain release factor 1 OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=prfA PE=3 SV=1 47 193 1.0E-32
sp|Q3A928|RF1_CARHZ Peptide chain release factor 1 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=prfA PE=3 SV=1 54 211 1.0E-32
sp|B6JA06|RF1_OLICO Peptide chain release factor 1 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=prfA PE=3 SV=1 77 203 1.0E-32
sp|Q1WUD6|RF1_LACS1 Peptide chain release factor 1 OS=Lactobacillus salivarius (strain UCC118) GN=prfA PE=3 SV=1 77 224 1.0E-32
sp|Q2J423|RF1_RHOP2 Peptide chain release factor 1 OS=Rhodopseudomonas palustris (strain HaA2) GN=prfA PE=3 SV=2 72 198 1.0E-32
sp|B0BB09|RF1_CHLTB Peptide chain release factor 1 OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=prfA PE=3 SV=1 47 221 1.0E-32
sp|B0B9D0|RF1_CHLT2 Peptide chain release factor 1 OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=prfA PE=3 SV=1 47 221 1.0E-32
sp|O84026|RF1_CHLTR Peptide chain release factor 1 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=prfA PE=3 SV=1 47 221 1.0E-32
sp|Q3KMZ9|RF1_CHLTA Peptide chain release factor 1 OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=prfA PE=3 SV=1 47 221 1.0E-32
sp|B0TX37|RF1_FRAP2 Peptide chain release factor 1 OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=prfA PE=3 SV=1 74 202 2.0E-32
sp|Q6D551|RF1_PECAS Peptide chain release factor 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=prfA PE=3 SV=1 7 202 2.0E-32
sp|Q15SQ9|RF1_PSEA6 Peptide chain release factor 1 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=prfA PE=3 SV=1 16 205 2.0E-32
sp|Q3A129|RF1_PELCD Peptide chain release factor 1 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=prfA PE=3 SV=1 47 193 2.0E-32
sp|B4EVR7|RF1_PROMH Peptide chain release factor 1 OS=Proteus mirabilis (strain HI4320) GN=prfA PE=3 SV=1 7 202 2.0E-32
sp|B8I562|RF1_CLOCE Peptide chain release factor 1 OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=prfA PE=3 SV=1 74 203 3.0E-32
sp|Q6LNB4|RF1_PHOPR Peptide chain release factor 1 OS=Photobacterium profundum GN=prfA PE=3 SV=1 7 203 3.0E-32
sp|C5CXW3|RF1_VARPS Peptide chain release factor 1 OS=Variovorax paradoxus (strain S110) GN=prfA PE=3 SV=1 47 206 3.0E-32
sp|A4XJN1|RF1_CALS8 Peptide chain release factor 1 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=prfA PE=3 SV=1 77 203 5.0E-32
sp|B8EI32|RF1_METSB Peptide chain release factor 1 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=prfA PE=3 SV=1 74 222 5.0E-32
sp|B5ZAH6|RF1_UREU1 Peptide chain release factor 1 OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=prfA PE=3 SV=1 74 218 5.0E-32
sp|Q2SL95|RF1_HAHCH Peptide chain release factor 1 OS=Hahella chejuensis (strain KCTC 2396) GN=prfA PE=3 SV=1 74 203 7.0E-32
sp|Q3SG10|RF1_THIDA Peptide chain release factor 1 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=prfA PE=3 SV=1 47 212 8.0E-32
sp|Q21BZ9|RF1_RHOPB Peptide chain release factor 1 OS=Rhodopseudomonas palustris (strain BisB18) GN=prfA PE=3 SV=1 72 198 8.0E-32
sp|B8E003|RF1_DICTD Peptide chain release factor 1 OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=prfA PE=3 SV=1 77 206 8.0E-32
sp|Q5WUB1|RF1_LEGPL Peptide chain release factor 1 OS=Legionella pneumophila (strain Lens) GN=prfA PE=3 SV=1 71 197 8.0E-32
sp|Q5ZT29|RF1_LEGPH Peptide chain release factor 1 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=prfA PE=3 SV=1 71 197 8.0E-32
sp|Q5X2V3|RF1_LEGPA Peptide chain release factor 1 OS=Legionella pneumophila (strain Paris) GN=prfA PE=3 SV=1 71 197 8.0E-32
sp|Q21FM3|RF1_SACD2 Peptide chain release factor 1 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=prfA PE=3 SV=1 74 197 9.0E-32
sp|A5IED7|RF1_LEGPC Peptide chain release factor 1 OS=Legionella pneumophila (strain Corby) GN=prfA PE=3 SV=1 71 197 9.0E-32
sp|Q1GPK3|RF1_SPHAL Peptide chain release factor 1 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=prfA PE=3 SV=1 76 223 9.0E-32
sp|B5YDB2|RF1_DICT6 Peptide chain release factor 1 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=prfA PE=3 SV=1 77 206 9.0E-32
sp|Q4QKS1|RF1_HAEI8 Peptide chain release factor 1 OS=Haemophilus influenzae (strain 86-028NP) GN=prfA PE=3 SV=2 40 203 1.0E-31
sp|Q9X183|RF1_THEMA Peptide chain release factor 1 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=prfA PE=1 SV=1 77 193 1.0E-31
sp|P43917|RF1_HAEIN Peptide chain release factor 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=prfA PE=3 SV=2 40 203 1.0E-31
sp|B1KDU3|RF1_SHEWM Peptide chain release factor 1 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=prfA PE=3 SV=1 47 202 2.0E-31
sp|Q65TB1|RF1_MANSM Peptide chain release factor 1 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=prfA PE=3 SV=1 42 203 2.0E-31
sp|Q2KZZ3|RF1_BORA1 Peptide chain release factor 1 OS=Bordetella avium (strain 197N) GN=prfA PE=3 SV=2 74 193 2.0E-31
sp|A7MY68|RF1_VIBCB Peptide chain release factor 1 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=prfA PE=3 SV=1 7 193 2.0E-31
sp|Q87RN4|RF1_VIBPA Peptide chain release factor 1 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=prfA PE=3 SV=1 7 193 3.0E-31
sp|Q9PRE0|RF1_UREPA Peptide chain release factor 1 OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=prfA PE=3 SV=1 74 221 3.0E-31
sp|B1AHY9|RF1_UREP2 Peptide chain release factor 1 OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=prfA PE=3 SV=1 74 221 3.0E-31
sp|P71496|RF1_MYCCT Peptide chain release factor 1 OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=prfA PE=3 SV=2 77 220 3.0E-31
sp|Q6MU89|RF1_MYCMS Peptide chain release factor 1 OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=prfA PE=3 SV=1 77 220 3.0E-31
sp|O75570|RF1M_HUMAN Peptide chain release factor 1, mitochondrial OS=Homo sapiens GN=MTRF1 PE=1 SV=2 77 202 3.0E-31
sp|A8YUJ1|RF1_LACH4 Peptide chain release factor 1 OS=Lactobacillus helveticus (strain DPC 4571) GN=prfA PE=3 SV=1 77 213 3.0E-31
sp|O67032|RF1_AQUAE Peptide chain release factor 1 OS=Aquifex aeolicus (strain VF5) GN=prfA PE=3 SV=1 77 205 3.0E-31
sp|Q8F9S6|RF1_LEPIN Peptide chain release factor 1 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=prfA PE=3 SV=1 18 203 3.0E-31
sp|Q72W38|RF1_LEPIC Peptide chain release factor 1 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=prfA PE=3 SV=1 18 203 3.0E-31
sp|C3LPI4|RF1_VIBCM Peptide chain release factor 1 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=prfA PE=3 SV=1 68 193 4.0E-31
sp|Q9KQ25|RF1_VIBCH Peptide chain release factor 1 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=prfA PE=3 SV=1 68 193 4.0E-31
sp|A5F696|RF1_VIBC3 Peptide chain release factor 1 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=prfA PE=3 SV=1 68 193 4.0E-31
sp|A1SV89|RF1_PSYIN Peptide chain release factor 1 OS=Psychromonas ingrahamii (strain 37) GN=prfA PE=3 SV=1 74 193 4.0E-31
sp|Q8BJU9|RF1ML_MOUSE Peptide chain release factor 1-like, mitochondrial OS=Mus musculus GN=Mtrf1l PE=2 SV=1 45 207 5.0E-31
sp|Q31IN8|RF1_THICR Peptide chain release factor 1 OS=Thiomicrospira crunogena (strain XCL-2) GN=prfA PE=3 SV=1 74 210 5.0E-31
sp|Q5HB80|RF1_EHRRW Peptide chain release factor 1 OS=Ehrlichia ruminantium (strain Welgevonden) GN=prfA PE=3 SV=1 77 222 5.0E-31
sp|Q5FGZ2|RF1_EHRRG Peptide chain release factor 1 OS=Ehrlichia ruminantium (strain Gardel) GN=prfA PE=3 SV=1 77 222 5.0E-31
sp|B8IUB4|RF1_METNO Peptide chain release factor 1 OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=prfA PE=3 SV=1 74 220 5.0E-31
sp|Q5FKZ0|RF1_LACAC Peptide chain release factor 1 OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=prfA PE=3 SV=1 77 213 5.0E-31
sp|Q38WJ4|RF1_LACSS Peptide chain release factor 1 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=prfA PE=3 SV=1 77 201 5.0E-31
sp|Q831F6|RF1_ENTFA Peptide chain release factor 1 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=prfA PE=3 SV=1 77 203 5.0E-31
sp|P30775|RF1M_YEAST Peptide chain release factor 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRF1 PE=1 SV=1 76 203 5.0E-31
sp|B8F526|RF1_HAEPS Peptide chain release factor 1 OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=prfA PE=3 SV=1 40 203 5.0E-31
sp|Q6F0I3|RF1_MESFL Peptide chain release factor 1 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=prfA PE=3 SV=1 16 193 6.0E-31
sp|B3GZJ0|RF1_ACTP7 Peptide chain release factor 1 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=prfA PE=3 SV=1 40 203 6.0E-31
sp|B2JHK8|RF1_BURP8 Peptide chain release factor 1 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=prfA PE=3 SV=1 74 223 7.0E-31
sp|B1Z914|RF1_METPB Peptide chain release factor 1 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=prfA PE=3 SV=1 74 203 7.0E-31
sp|B7VKH3|RF1_VIBTL Peptide chain release factor 1 OS=Vibrio tasmaniensis (strain LGP32) GN=prfA PE=3 SV=1 47 202 7.0E-31
sp|Q5P7G7|RF1_AROAE Peptide chain release factor 1 OS=Aromatoleum aromaticum (strain EbN1) GN=prfA PE=3 SV=1 74 193 9.0E-31
sp|P75420|RF1_MYCPN Peptide chain release factor 1 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=prfA PE=1 SV=1 74 203 1.0E-30
sp|A5FX99|RF1_ACICJ Peptide chain release factor 1 OS=Acidiphilium cryptum (strain JF-5) GN=prfA PE=3 SV=1 47 210 1.0E-30
sp|Q7W023|RF1_BORPE Peptide chain release factor 1 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=prfA PE=3 SV=1 74 193 1.0E-30
sp|Q7WQE9|RF1_BORBR Peptide chain release factor 1 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=prfA PE=3 SV=1 74 193 1.0E-30
sp|A9IER8|RF1_BORPD Peptide chain release factor 1 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=prfA PE=3 SV=1 74 193 1.0E-30
sp|A7HTY3|RF1_PARL1 Peptide chain release factor 1 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=prfA PE=3 SV=1 77 205 1.0E-30
sp|Q7WCE3|RF1_BORPA Peptide chain release factor 1 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=prfA PE=3 SV=1 74 193 1.0E-30
sp|P57852|RF1_PASMU Peptide chain release factor 1 OS=Pasteurella multocida (strain Pm70) GN=prfA PE=3 SV=1 40 203 1.0E-30
sp|B9MR68|RF1_CALBD Peptide chain release factor 1 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=prfA PE=3 SV=1 77 203 1.0E-30
sp|P41767|RF1M_KLULA Peptide chain release factor 1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MRF1 PE=3 SV=1 3 203 1.0E-30
sp|B1XSY0|RF1_POLNS Peptide chain release factor 1 OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=prfA PE=3 SV=1 74 193 2.0E-30
sp|A1U367|RF1_MARHV Peptide chain release factor 1 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=prfA PE=3 SV=1 74 193 2.0E-30
sp|Q7MMY6|RF1_VIBVY Peptide chain release factor 1 OS=Vibrio vulnificus (strain YJ016) GN=prfA PE=3 SV=2 47 202 2.0E-30
sp|Q8DFF9|RF1_VIBVU Peptide chain release factor 1 OS=Vibrio vulnificus (strain CMCP6) GN=prfA PE=3 SV=2 47 202 2.0E-30
sp|A8GNQ4|RF1_RICAH Peptide chain release factor 1 OS=Rickettsia akari (strain Hartford) GN=prfA PE=3 SV=1 77 223 2.0E-30
sp|Q2NRS4|RF1_SODGM Peptide chain release factor 1 OS=Sodalis glossinidius (strain morsitans) GN=prfA PE=3 SV=1 47 203 2.0E-30
sp|Q1GYE8|RF1_METFK Peptide chain release factor 1 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=prfA PE=3 SV=1 74 193 2.0E-30
sp|B0UAV4|RF1_METS4 Peptide chain release factor 1 OS=Methylobacterium sp. (strain 4-46) GN=prfA PE=3 SV=1 74 220 2.0E-30
sp|Q12F86|RF1_POLSJ Peptide chain release factor 1 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=prfA PE=3 SV=1 74 205 3.0E-30
sp|B3ES89|RF1_AMOA5 Peptide chain release factor 1 OS=Amoebophilus asiaticus (strain 5a2) GN=prfA PE=3 SV=1 77 203 3.0E-30
sp|Q1LIF3|RF1_CUPMC Peptide chain release factor 1 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=prfA PE=3 SV=2 74 203 3.0E-30
sp|A4SV43|RF1_POLSQ Peptide chain release factor 1 OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=prfA PE=3 SV=1 74 193 3.0E-30
sp|A9W1A4|RF1_METEP Peptide chain release factor 1 OS=Methylobacterium extorquens (strain PA1) GN=prfA PE=3 SV=1 74 203 3.0E-30
sp|B7L246|RF1_METC4 Peptide chain release factor 1 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=prfA PE=3 SV=1 74 203 3.0E-30
sp|Q1LTH5|RF1_BAUCH Peptide chain release factor 1 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=prfA PE=3 SV=1 74 193 3.0E-30
sp|B4U955|RF1_HYDS0 Peptide chain release factor 1 OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=prfA PE=3 SV=1 77 193 3.0E-30
sp|Q3IK95|RF1_PSEHT Peptide chain release factor 1 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=prfA PE=3 SV=1 47 193 3.0E-30
sp|A1TTC4|RF1_ACIAC Peptide chain release factor 1 OS=Acidovorax citrulli (strain AAC00-1) GN=prfA PE=3 SV=1 7 205 3.0E-30
sp|A6W1C2|RF1_MARMS Peptide chain release factor 1 OS=Marinomonas sp. (strain MWYL1) GN=prfA PE=3 SV=1 74 193 3.0E-30
sp|B1I069|RF1_LYSSC Peptide chain release factor 1 OS=Lysinibacillus sphaericus (strain C3-41) GN=prfA PE=3 SV=1 77 193 4.0E-30
sp|Q2N5U6|RF1_ERYLH Peptide chain release factor 1 OS=Erythrobacter litoralis (strain HTCC2594) GN=prfA PE=3 SV=1 77 230 4.0E-30
sp|Q46WS9|RF1_CUPPJ Peptide chain release factor 1 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=prfA PE=3 SV=1 74 193 4.0E-30
sp|Q2GGM5|RF1_EHRCR Peptide chain release factor 1 OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=prfA PE=3 SV=1 77 222 4.0E-30
sp|Q21YY9|RF1_RHOFT Peptide chain release factor 1 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=prfA PE=3 SV=1 47 203 4.0E-30
sp|Q0I3B5|RF1_HAES1 Peptide chain release factor 1 OS=Haemophilus somnus (strain 129Pt) GN=prfA PE=3 SV=1 40 203 4.0E-30
sp|B2G676|RF1_LACRJ Peptide chain release factor 1 OS=Lactobacillus reuteri (strain JCM 1112) GN=prfA PE=3 SV=1 7 203 4.0E-30
sp|Q74K25|RF1_LACJO Peptide chain release factor 1 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=prfA PE=3 SV=1 77 203 5.0E-30
sp|C5B814|RF1_EDWI9 Peptide chain release factor 1 OS=Edwardsiella ictaluri (strain 93-146) GN=prfA PE=3 SV=1 74 202 5.0E-30
sp|B0UUE6|RF1_HISS2 Peptide chain release factor 1 OS=Histophilus somni (strain 2336) GN=prfA PE=3 SV=1 40 203 5.0E-30
sp|B8CQV2|RF1_SHEPW Peptide chain release factor 1 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=prfA PE=3 SV=1 47 193 5.0E-30
sp|B2SZ27|RF1_BURPP Peptide chain release factor 1 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=prfA PE=3 SV=1 74 223 5.0E-30
sp|Q4V7E5|RF1ML_RAT Peptide chain release factor 1-like, mitochondrial OS=Rattus norvegicus GN=Mtrf1l PE=2 SV=1 77 206 5.0E-30
sp|Q3Z776|RF1_DEHM1 Peptide chain release factor 1 OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=prfA PE=3 SV=1 77 201 5.0E-30
sp|Q3ZYA9|RF1_DEHMC Peptide chain release factor 1 OS=Dehalococcoides mccartyi (strain CBDB1) GN=prfA PE=3 SV=1 77 201 5.0E-30
sp|A5FQC5|RF1_DEHMB Peptide chain release factor 1 OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=prfA PE=3 SV=1 77 201 5.0E-30
sp|Q88UT2|RF1_LACPL Peptide chain release factor 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=prfA PE=3 SV=1 62 219 5.0E-30
sp|Q5NMC7|RF1_ZYMMO Peptide chain release factor 1 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=prfA PE=3 SV=1 77 223 6.0E-30
sp|B9ME05|RF1_ACIET Peptide chain release factor 1 OS=Acidovorax ebreus (strain TPSY) GN=prfA PE=3 SV=1 47 213 6.0E-30
sp|A1W4B8|RF1_ACISJ Peptide chain release factor 1 OS=Acidovorax sp. (strain JS42) GN=prfA PE=3 SV=1 47 213 6.0E-30
sp|Q7VMV9|RF1_HAEDU Peptide chain release factor 1 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=prfA PE=3 SV=1 45 203 6.0E-30
sp|Q13TU2|RF1_BURXL Peptide chain release factor 1 OS=Burkholderia xenovorans (strain LB400) GN=prfA PE=3 SV=1 74 223 6.0E-30
sp|A3DIL4|RF1_CLOTH Peptide chain release factor 1 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=prfA PE=3 SV=1 77 185 6.0E-30
sp|P47500|RF1_MYCGE Peptide chain release factor 1 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=prfA PE=3 SV=1 76 205 6.0E-30
sp|Q2SUG2|RF1_BURTA Peptide chain release factor 1 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=prfA PE=3 SV=1 74 223 6.0E-30
sp|C0Z828|RF1_BREBN Peptide chain release factor 1 OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=prfA PE=3 SV=1 65 193 6.0E-30
sp|Q63QF0|RF1_BURPS Peptide chain release factor 1 OS=Burkholderia pseudomallei (strain K96243) GN=prfA PE=3 SV=1 74 223 7.0E-30
sp|A3NE24|RF1_BURP6 Peptide chain release factor 1 OS=Burkholderia pseudomallei (strain 668) GN=prfA PE=3 SV=1 74 223 7.0E-30
sp|Q3JN85|RF1_BURP1 Peptide chain release factor 1 OS=Burkholderia pseudomallei (strain 1710b) GN=prfA PE=3 SV=1 74 223 7.0E-30
sp|A3NZS4|RF1_BURP0 Peptide chain release factor 1 OS=Burkholderia pseudomallei (strain 1106a) GN=prfA PE=3 SV=1 74 223 7.0E-30
sp|A1UWC9|RF1_BURMS Peptide chain release factor 1 OS=Burkholderia mallei (strain SAVP1) GN=prfA PE=3 SV=1 74 223 7.0E-30
sp|Q62DF3|RF1_BURMA Peptide chain release factor 1 OS=Burkholderia mallei (strain ATCC 23344) GN=prfA PE=3 SV=1 74 223 7.0E-30
sp|A2RYL2|RF1_BURM9 Peptide chain release factor 1 OS=Burkholderia mallei (strain NCTC 10229) GN=prfA PE=3 SV=1 74 223 7.0E-30
sp|A3MFT4|RF1_BURM7 Peptide chain release factor 1 OS=Burkholderia mallei (strain NCTC 10247) GN=prfA PE=3 SV=1 74 223 7.0E-30
sp|Q5QUZ8|RF1_IDILO Peptide chain release factor 1 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=prfA PE=3 SV=1 47 193 8.0E-30
sp|Q7VR74|RF1_BLOFL Peptide chain release factor 1 OS=Blochmannia floridanus GN=prfA PE=3 SV=1 77 203 9.0E-30
sp|Q7N586|RF1_PHOLL Peptide chain release factor 1 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=prfA PE=3 SV=1 7 203 9.0E-30
sp|B4RSV6|RF1_ALTMD Peptide chain release factor 1 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=prfA1 PE=3 SV=1 7 193 9.0E-30
sp|Q3MHI7|RF1M_BOVIN Peptide chain release factor 1, mitochondrial OS=Bos taurus GN=MTRF1 PE=2 SV=1 77 202 1.0E-29
sp|B6J390|RF1_COXB2 Peptide chain release factor 1 OS=Coxiella burnetii (strain CbuG_Q212) GN=prfA PE=3 SV=1 74 212 1.0E-29
sp|Q03QX7|RF1_LACBA Peptide chain release factor 1 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=prfA PE=3 SV=1 77 222 1.0E-29
sp|B8DLL6|RF1_DESVM Peptide chain release factor 1 OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=prfA PE=3 SV=1 7 193 1.0E-29
sp|C0QTI3|RF1_PERMH Peptide chain release factor 1 OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=prfA PE=3 SV=1 54 193 1.0E-29
sp|Q057W1|RF1_BUCCC Peptide chain release factor 1 OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=prfA PE=3 SV=1 71 193 1.0E-29
sp|Q042K5|RF1_LACGA Peptide chain release factor 1 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=prfA PE=3 SV=1 77 203 1.0E-29
sp|Q8D2K9|RF1_WIGBR Peptide chain release factor 1 OS=Wigglesworthia glossinidia brevipalpis GN=prfA PE=3 SV=1 68 194 1.0E-29
sp|P47849|RF1_COXBU Peptide chain release factor 1 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=prfA PE=3 SV=2 74 212 1.0E-29
sp|A9N9K2|RF1_COXBR Peptide chain release factor 1 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=prfA PE=3 SV=1 74 212 1.0E-29
sp|A9KGY3|RF1_COXBN Peptide chain release factor 1 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=prfA PE=3 SV=1 74 212 1.0E-29
sp|B6J625|RF1_COXB1 Peptide chain release factor 1 OS=Coxiella burnetii (strain CbuK_Q154) GN=prfA PE=3 SV=1 74 212 1.0E-29
sp|A9AJ68|RF1_BURM1 Peptide chain release factor 1 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=prfA PE=3 SV=1 76 193 1.0E-29
sp|B7UQ99|RF1_ECO27 Peptide chain release factor 1 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=prfA PE=3 SV=1 47 193 1.0E-29
sp|P45872|RF1_BACSU Peptide chain release factor 1 OS=Bacillus subtilis (strain 168) GN=prfA PE=3 SV=1 77 203 1.0E-29
sp|A6SUF6|RF1_JANMA Peptide chain release factor 1 OS=Janthinobacterium sp. (strain Marseille) GN=prfA PE=3 SV=1 74 193 1.0E-29
sp|Q3YS23|RF1_EHRCJ Peptide chain release factor 1 OS=Ehrlichia canis (strain Jake) GN=prfA PE=3 SV=1 77 222 1.0E-29
sp|B0TR27|RF1_SHEHH Peptide chain release factor 1 OS=Shewanella halifaxensis (strain HAW-EB4) GN=prfA PE=3 SV=1 47 193 1.0E-29
sp|A0K437|RF1_BURCH Peptide chain release factor 1 OS=Burkholderia cenocepacia (strain HI2424) GN=prfA PE=3 SV=1 74 193 1.0E-29
sp|B1JUS4|RF1_BURCC Peptide chain release factor 1 OS=Burkholderia cenocepacia (strain MC0-3) GN=prfA PE=3 SV=1 74 193 1.0E-29
sp|Q1BSB1|RF1_BURCA Peptide chain release factor 1 OS=Burkholderia cenocepacia (strain AU 1054) GN=prfA PE=3 SV=1 74 193 1.0E-29
sp|B3QYI4|RF1_CHLT3 Peptide chain release factor 1 OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=prfA PE=3 SV=1 47 205 1.0E-29
sp|B1M766|RF1_METRJ Peptide chain release factor 1 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=prfA PE=3 SV=1 76 203 2.0E-29
sp|Q39K18|RF1_BURL3 Peptide chain release factor 1 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=prfA PE=3 SV=1 74 223 2.0E-29
sp|Q11NS4|RF1_CYTH3 Peptide chain release factor 1 OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=prfA PE=3 SV=1 77 193 2.0E-29
sp|A8GSC7|RF1_RICRS Peptide chain release factor 1 OS=Rickettsia rickettsii (strain Sheila Smith) GN=prfA PE=3 SV=1 77 223 2.0E-29
sp|B0BXT9|RF1_RICRO Peptide chain release factor 1 OS=Rickettsia rickettsii (strain Iowa) GN=prfA PE=3 SV=1 77 223 2.0E-29
sp|Q87A17|RF1_XYLFT Peptide chain release factor 1 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=prfA PE=3 SV=1 74 202 2.0E-29
sp|B2IA85|RF1_XYLF2 Peptide chain release factor 1 OS=Xylella fastidiosa (strain M23) GN=prfA PE=3 SV=1 74 202 2.0E-29
sp|B4E6U6|RF1_BURCJ Peptide chain release factor 1 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=prfA PE=3 SV=1 74 193 2.0E-29
sp|Q31ZQ4|RF1_SHIBS Peptide chain release factor 1 OS=Shigella boydii serotype 4 (strain Sb227) GN=prfA PE=3 SV=1 47 193 2.0E-29
sp|B2TZV9|RF1_SHIB3 Peptide chain release factor 1 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=prfA PE=3 SV=1 47 193 2.0E-29
sp|Q3Z0S9|RF1_SHISS Peptide chain release factor 1 OS=Shigella sonnei (strain Ss046) GN=prfA PE=3 SV=1 47 193 2.0E-29
sp|P0A7I3|RF1_SHIFL Peptide chain release factor 1 OS=Shigella flexneri GN=prfA PE=3 SV=1 47 193 2.0E-29
sp|Q0T5I4|RF1_SHIF8 Peptide chain release factor 1 OS=Shigella flexneri serotype 5b (strain 8401) GN=prfA PE=3 SV=1 47 193 2.0E-29
sp|Q32GZ6|RF1_SHIDS Peptide chain release factor 1 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=prfA PE=3 SV=1 47 193 2.0E-29
sp|B7LSH9|RF1_ESCF3 Peptide chain release factor 1 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=prfA PE=3 SV=1 47 193 2.0E-29
sp|Q1RCM7|RF1_ECOUT Peptide chain release factor 1 OS=Escherichia coli (strain UTI89 / UPEC) GN=prfA PE=3 SV=1 47 193 2.0E-29
sp|B1LH89|RF1_ECOSM Peptide chain release factor 1 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=prfA PE=3 SV=1 47 193 2.0E-29
sp|B6I9S6|RF1_ECOSE Peptide chain release factor 1 OS=Escherichia coli (strain SE11) GN=prfA PE=3 SV=1 47 193 2.0E-29
sp|B7N422|RF1_ECOLU Peptide chain release factor 1 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=prfA PE=3 SV=1 47 193 2.0E-29
sp|P0A7I0|RF1_ECOLI Peptide chain release factor 1 OS=Escherichia coli (strain K12) GN=prfA PE=1 SV=1 47 193 2.0E-29
sp|B1IU82|RF1_ECOLC Peptide chain release factor 1 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=prfA PE=3 SV=1 47 193 2.0E-29
sp|P0A7I1|RF1_ECOL6 Peptide chain release factor 1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=prfA PE=3 SV=1 47 193 2.0E-29
sp|Q0TIF9|RF1_ECOL5 Peptide chain release factor 1 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=prfA PE=3 SV=1 47 193 2.0E-29
sp|A1AAD8|RF1_ECOK1 Peptide chain release factor 1 OS=Escherichia coli O1:K1 / APEC GN=prfA PE=3 SV=1 47 193 2.0E-29
sp|A7ZZE7|RF1_ECOHS Peptide chain release factor 1 OS=Escherichia coli O9:H4 (strain HS) GN=prfA PE=3 SV=1 47 193 2.0E-29
sp|B1XAQ2|RF1_ECODH Peptide chain release factor 1 OS=Escherichia coli (strain K12 / DH10B) GN=prfA PE=3 SV=1 47 193 2.0E-29
sp|C4ZTQ2|RF1_ECOBW Peptide chain release factor 1 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=prfA PE=3 SV=1 47 193 2.0E-29
sp|B7LXC6|RF1_ECO8A Peptide chain release factor 1 OS=Escherichia coli O8 (strain IAI1) GN=prfA PE=3 SV=1 47 193 2.0E-29
sp|B7NUX7|RF1_ECO7I Peptide chain release factor 1 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=prfA PE=3 SV=1 47 193 2.0E-29
sp|B5YXM9|RF1_ECO5E Peptide chain release factor 1 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=prfA PE=3 SV=1 47 193 2.0E-29
sp|P0A7I2|RF1_ECO57 Peptide chain release factor 1 OS=Escherichia coli O157:H7 GN=prfA PE=3 SV=1 47 193 2.0E-29
sp|B7LGX2|RF1_ECO55 Peptide chain release factor 1 OS=Escherichia coli (strain 55989 / EAEC) GN=prfA PE=3 SV=1 47 193 2.0E-29
sp|B7MKB3|RF1_ECO45 Peptide chain release factor 1 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=prfA PE=3 SV=1 47 193 2.0E-29
sp|A7ZKY5|RF1_ECO24 Peptide chain release factor 1 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=prfA PE=3 SV=1 47 193 2.0E-29
sp|Q8EWY5|RF1_MYCPE Peptide chain release factor 1 OS=Mycoplasma penetrans (strain HF-2) GN=prfA PE=3 SV=1 76 193 2.0E-29
sp|B2GAT1|RF1_LACF3 Peptide chain release factor 1 OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=prfA PE=3 SV=1 54 193 2.0E-29
sp|B7MTZ5|RF1_ECO81 Peptide chain release factor 1 OS=Escherichia coli O81 (strain ED1a) GN=prfA PE=3 SV=1 47 193 2.0E-29
sp|Q8K126|RF1M_MOUSE Peptide chain release factor 1, mitochondrial OS=Mus musculus GN=Mtrf1 PE=2 SV=1 77 202 2.0E-29
sp|Q8KG45|RF1_CHLTE Peptide chain release factor 1 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=prfA PE=3 SV=1 75 205 2.0E-29
sp|A4WBC6|RF1_ENT38 Peptide chain release factor 1 OS=Enterobacter sp. (strain 638) GN=prfA PE=3 SV=1 47 193 2.0E-29
sp|Q056R9|RF1_LEPBL Peptide chain release factor 1 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=prfA PE=3 SV=1 7 193 2.0E-29
sp|Q04W81|RF1_LEPBJ Peptide chain release factor 1 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=prfA PE=3 SV=1 7 193 2.0E-29
sp|Q82TH4|RF1_NITEU Peptide chain release factor 1 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=prfA PE=3 SV=1 74 193 2.0E-29
sp|B8D775|RF1_BUCAT Peptide chain release factor 1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=prfA PE=3 SV=1 76 230 2.0E-29
sp|P57268|RF1_BUCAI Peptide chain release factor 1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=prfA PE=3 SV=1 76 230 2.0E-29
sp|B8D8X1|RF1_BUCA5 Peptide chain release factor 1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=prfA PE=3 SV=1 76 230 2.0E-29
sp|B0TI71|RF1_HELMI Peptide chain release factor 1 OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=prfA PE=3 SV=1 47 190 2.0E-29
sp|A1AX02|RF1_RUTMC Peptide chain release factor 1 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=prfA PE=3 SV=1 76 193 2.0E-29
sp|A7MKC1|RF1_CROS8 Peptide chain release factor 1 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=prfA PE=3 SV=1 47 193 2.0E-29
sp|B3R722|RF1_CUPTR Peptide chain release factor 1 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=prfA PE=3 SV=1 74 193 2.0E-29
sp|B4S385|RF1_PROA2 Peptide chain release factor 1 OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=prfA PE=3 SV=1 75 205 2.0E-29
sp|B4SAR5|RF1_PELPB Peptide chain release factor 1 OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=prfA PE=3 SV=1 47 193 3.0E-29
sp|B4SKS8|RF1_STRM5 Peptide chain release factor 1 OS=Stenotrophomonas maltophilia (strain R551-3) GN=prfA PE=3 SV=1 74 202 3.0E-29
sp|A2SD46|RF1_METPP Peptide chain release factor 1 OS=Methylibium petroleiphilum (strain PM1) GN=prfA PE=3 SV=1 47 213 3.0E-29
sp|Q9ZD21|RF1_RICPR Peptide chain release factor 1 OS=Rickettsia prowazekii (strain Madrid E) GN=prfA PE=3 SV=1 77 223 3.0E-29
sp|Q0BIQ0|RF1_BURCM Peptide chain release factor 1 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=prfA PE=3 SV=1 74 193 3.0E-29
sp|B1YSD5|RF1_BURA4 Peptide chain release factor 1 OS=Burkholderia ambifaria (strain MC40-6) GN=prfA PE=3 SV=1 74 193 3.0E-29
sp|A4JB50|RF1_BURVG Peptide chain release factor 1 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=prfA PE=3 SV=1 74 193 3.0E-29
sp|A1KV95|RF1_NEIMF Peptide chain release factor 1 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=prfA PE=3 SV=1 74 193 3.0E-29
sp|Q9JY93|RF1_NEIMB Peptide chain release factor 1 OS=Neisseria meningitidis serogroup B (strain MC58) GN=prfA PE=3 SV=1 74 193 3.0E-29
sp|Q9JT75|RF1_NEIMA Peptide chain release factor 1 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=prfA PE=3 SV=1 74 193 3.0E-29
sp|B8J4R4|RF1_DESDA Peptide chain release factor 1 OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=prfA PE=3 SV=1 77 193 4.0E-29
sp|A8H7A5|RF1_SHEPA Peptide chain release factor 1 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=prfA PE=3 SV=1 47 193 4.0E-29
sp|A1VAK8|RF1_DESVV Peptide chain release factor 1 OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=prfA PE=3 SV=1 72 193 4.0E-29
sp|Q727E1|RF1_DESVH Peptide chain release factor 1 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=prfA PE=3 SV=1 72 193 4.0E-29
sp|Q6F9S2|RF1_ACIAD Peptide chain release factor 1 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=prfA PE=3 SV=2 47 203 4.0E-29
sp|Q12QR8|RF1_SHEDO Peptide chain release factor 1 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=prfA PE=3 SV=1 47 193 4.0E-29
sp|Q087I4|RF1_SHEFN Peptide chain release factor 1 OS=Shewanella frigidimarina (strain NCIMB 400) GN=prfA PE=3 SV=1 47 201 5.0E-29
sp|Q2KI15|RF1ML_BOVIN Peptide chain release factor 1-like, mitochondrial OS=Bos taurus GN=MTRF1L PE=2 SV=1 45 206 5.0E-29
sp|B2UDM7|RF1_RALPJ Peptide chain release factor 1 OS=Ralstonia pickettii (strain 12J) GN=prfA PE=3 SV=1 74 193 5.0E-29
sp|Q2GBN7|RF1_NOVAD Peptide chain release factor 1 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=prfA PE=3 SV=1 77 223 5.0E-29
sp|Q1RJT5|RF1_RICBR Peptide chain release factor 1 OS=Rickettsia bellii (strain RML369-C) GN=prfA PE=3 SV=1 77 223 5.0E-29
sp|A9KHD4|RF1_CLOPH Peptide chain release factor 1 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=prfA PE=3 SV=1 77 193 5.0E-29
sp|A8GXI1|RF1_RICB8 Peptide chain release factor 1 OS=Rickettsia bellii (strain OSU 85-389) GN=prfA PE=3 SV=1 77 223 5.0E-29
sp|B0U5Z3|RF1_XYLFM Peptide chain release factor 1 OS=Xylella fastidiosa (strain M12) GN=prfA PE=3 SV=1 74 202 6.0E-29
sp|A1WVQ8|RF1_HALHL Peptide chain release factor 1 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=prfA PE=3 SV=1 47 202 6.0E-29
sp|A5VYG5|RF1_PSEP1 Peptide chain release factor 1 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=prfA PE=3 SV=1 47 222 6.0E-29
sp|Q9PA71|RF1_XYLFA Peptide chain release factor 1 OS=Xylella fastidiosa (strain 9a5c) GN=prfA PE=3 SV=1 74 202 6.0E-29
sp|Q88PW5|RF1_PSEPK Peptide chain release factor 1 OS=Pseudomonas putida (strain KT2440) GN=prfA PE=3 SV=1 47 222 6.0E-29
sp|B3WDK7|RF1_LACCB Peptide chain release factor 1 OS=Lactobacillus casei (strain BL23) GN=prfA PE=3 SV=1 77 223 6.0E-29
sp|Q03A29|RF1_LACC3 Peptide chain release factor 1 OS=Lactobacillus casei (strain ATCC 334) GN=prfA PE=3 SV=1 77 223 6.0E-29
sp|A1K443|RF1_AZOSB Peptide chain release factor 1 OS=Azoarcus sp. (strain BH72) GN=prfA PE=3 SV=1 74 203 6.0E-29
sp|B2FQ14|RF1_STRMK Peptide chain release factor 1 OS=Stenotrophomonas maltophilia (strain K279a) GN=prfA PE=3 SV=1 74 202 7.0E-29
sp|A6Q162|RF1_NITSB Peptide chain release factor 1 OS=Nitratiruptor sp. (strain SB155-2) GN=prfA PE=3 SV=1 43 203 7.0E-29
sp|A8FID1|RF1_BACP2 Peptide chain release factor 1 OS=Bacillus pumilus (strain SAFR-032) GN=prfA PE=3 SV=1 77 203 8.0E-29
sp|A7IIM2|RF1_XANP2 Peptide chain release factor 1 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=prfA PE=3 SV=1 47 201 8.0E-29
sp|Q3JDR4|RF1_NITOC Peptide chain release factor 1 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=prfA PE=3 SV=1 74 229 8.0E-29
sp|Q65DV1|RF1_BACLD Peptide chain release factor 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=prfA PE=3 SV=1 77 203 8.0E-29
sp|P96077|RF1_THET8 Peptide chain release factor 1 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=prfA PE=1 SV=1 77 193 8.0E-29
sp|Q72HB8|RF1_THET2 Peptide chain release factor 1 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=prfA PE=1 SV=1 77 193 8.0E-29
sp|Q39YQ1|RF1_GEOMG Peptide chain release factor 1 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=prfA PE=3 SV=1 47 193 8.0E-29
sp|B5FBX0|RF1_VIBFM Peptide chain release factor 1 OS=Vibrio fischeri (strain MJ11) GN=prfA PE=3 SV=1 47 193 8.0E-29
sp|Q5E6T3|RF1_VIBF1 Peptide chain release factor 1 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=prfA PE=3 SV=1 47 193 8.0E-29
sp|B5XW51|RF1_KLEP3 Peptide chain release factor 1 OS=Klebsiella pneumoniae (strain 342) GN=prfA PE=3 SV=1 47 193 8.0E-29
sp|Q2Y5P3|RF1_NITMU Peptide chain release factor 1 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=prfA PE=3 SV=1 74 193 9.0E-29
sp|A8FYZ0|RF1_SHESH Peptide chain release factor 1 OS=Shewanella sediminis (strain HAW-EB3) GN=prfA PE=3 SV=1 47 203 9.0E-29
sp|B9KE98|RF1_CAMLR Peptide chain release factor 1 OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=prfA PE=3 SV=1 43 224 9.0E-29
sp|Q8EM60|RF1_OCEIH Peptide chain release factor 1 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=prfA PE=3 SV=1 77 221 9.0E-29
sp|Q30NW2|RF1_SULDN Peptide chain release factor 1 OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=prfA PE=3 SV=1 47 228 1.0E-28
sp|A6TAN9|RF1_KLEP7 Peptide chain release factor 1 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=prfA PE=3 SV=1 47 193 1.0E-28
sp|A9M1Q8|RF1_NEIM0 Peptide chain release factor 1 OS=Neisseria meningitidis serogroup C (strain 053442) GN=prfA PE=3 SV=1 74 193 1.0E-28
sp|B1YEH9|RF1_EXIS2 Peptide chain release factor 1 OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=prfA PE=3 SV=1 77 229 1.0E-28
sp|A3QH30|RF1_SHELP Peptide chain release factor 1 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=prfA PE=3 SV=1 74 193 1.0E-28
sp|B3CQD1|RF1_ORITI Peptide chain release factor 1 OS=Orientia tsutsugamushi (strain Ikeda) GN=prfA PE=3 SV=1 77 223 1.0E-28
sp|Q0SQY1|RF1_CLOPS Peptide chain release factor 1 OS=Clostridium perfringens (strain SM101 / Type A) GN=prfA PE=3 SV=1 77 203 1.0E-28
sp|Q8XIB9|RF1_CLOPE Peptide chain release factor 1 OS=Clostridium perfringens (strain 13 / Type A) GN=prfA PE=3 SV=1 77 203 1.0E-28
sp|Q0TNB0|RF1_CLOP1 Peptide chain release factor 1 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=prfA PE=3 SV=1 77 203 1.0E-28
sp|Q5F750|RF1_NEIG1 Peptide chain release factor 1 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=prfA PE=3 SV=1 74 193 1.0E-28
sp|B4RN52|RF1_NEIG2 Peptide chain release factor 1 OS=Neisseria gonorrhoeae (strain NCCP11945) GN=prfA PE=3 SV=1 74 193 1.0E-28
sp|Q2RWE1|RF1_RHORT Peptide chain release factor 1 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=prfA PE=3 SV=1 77 202 1.0E-28
sp|A3D0G1|RF1_SHEB5 Peptide chain release factor 1 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=prfA PE=3 SV=1 47 193 1.0E-28
sp|B8E815|RF1_SHEB2 Peptide chain release factor 1 OS=Shewanella baltica (strain OS223) GN=prfA PE=3 SV=1 47 193 1.0E-28
sp|Q7VFA0|RF1_HELHP Peptide chain release factor 1 OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=prfA PE=3 SV=1 43 224 1.0E-28
sp|Q47Y94|RF1_COLP3 Peptide chain release factor 1 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=prfA PE=3 SV=1 74 202 1.0E-28
sp|Q7NBX3|RF1_MYCGA Peptide chain release factor 1 OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=prfA PE=3 SV=2 74 223 1.0E-28
sp|B6EHH5|RF1_ALISL Peptide chain release factor 1 OS=Aliivibrio salmonicida (strain LFI1238) GN=prfA PE=3 SV=1 7 193 1.0E-28
sp|Q6MRK9|RF1_BDEBA Peptide chain release factor 1 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=prfA PE=3 SV=1 65 219 1.0E-28
sp|A9L2D4|RF1_SHEB9 Peptide chain release factor 1 OS=Shewanella baltica (strain OS195) GN=prfA PE=3 SV=1 47 193 1.0E-28
sp|A6WSF0|RF1_SHEB8 Peptide chain release factor 1 OS=Shewanella baltica (strain OS185) GN=prfA PE=3 SV=1 47 193 1.0E-28
sp|A5CW65|RF1_VESOH Peptide chain release factor 1 OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=prfA PE=3 SV=1 47 193 2.0E-28
sp|B7J1C9|RF1_BORBZ Peptide chain release factor 1 OS=Borrelia burgdorferi (strain ZS7) GN=prfA PE=3 SV=1 74 215 2.0E-28
sp|O51214|RF1_BORBU Peptide chain release factor 1 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=prfA PE=3 SV=1 74 215 2.0E-28
sp|B0KNE4|RF1_PSEPG Peptide chain release factor 1 OS=Pseudomonas putida (strain GB-1) GN=prfA PE=3 SV=1 47 194 2.0E-28
sp|A7GV79|RF1_BACCN Peptide chain release factor 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=prfA PE=3 SV=1 77 228 2.0E-28
sp|Q8XVD0|RF1_RALSO Peptide chain release factor 1 OS=Ralstonia solanacearum (strain GMI1000) GN=prfA PE=3 SV=1 74 193 2.0E-28
sp|A5CCS8|RF1_ORITB Peptide chain release factor 1 OS=Orientia tsutsugamushi (strain Boryong) GN=prfA PE=3 SV=1 77 223 2.0E-28
sp|B2RZQ6|RF1_BORHD Peptide chain release factor 1 OS=Borrelia hermsii (strain HS1 / DAH) GN=prfA PE=3 SV=1 47 193 2.0E-28
sp|Q8K9X0|RF1_BUCAP Peptide chain release factor 1 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=prfA PE=3 SV=1 76 202 2.0E-28
sp|A8GDA3|RF1_SERP5 Peptide chain release factor 1 OS=Serratia proteamaculans (strain 568) GN=prfA PE=3 SV=1 47 221 2.0E-28
sp|C1F2J1|RF1_ACIC5 Peptide chain release factor 1 OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=prfA PE=3 SV=1 47 193 2.0E-28
sp|Q1IEX1|RF1_PSEE4 Peptide chain release factor 1 OS=Pseudomonas entomophila (strain L48) GN=prfA PE=3 SV=1 47 222 2.0E-28
sp|A1VKB6|RF1_POLNA Peptide chain release factor 1 OS=Polaromonas naphthalenivorans (strain CJ2) GN=prfA PE=3 SV=1 47 205 3.0E-28
sp|Q60A21|RF1_METCA Peptide chain release factor 1 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=prfA PE=3 SV=1 34 193 3.0E-28
sp|Q748B1|RF1_GEOSL Peptide chain release factor 1 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=prfA PE=3 SV=1 47 193 3.0E-28
sp|B2VEH7|RF1_ERWT9 Peptide chain release factor 1 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=prfA PE=3 SV=1 47 193 3.0E-28
sp|Q0HYK8|RF1_SHESR Peptide chain release factor 1 OS=Shewanella sp. (strain MR-7) GN=prfA PE=3 SV=1 47 193 3.0E-28
sp|Q0HFC8|RF1_SHESM Peptide chain release factor 1 OS=Shewanella sp. (strain MR-4) GN=prfA PE=3 SV=1 47 193 3.0E-28
sp|A0KT88|RF1_SHESA Peptide chain release factor 1 OS=Shewanella sp. (strain ANA-3) GN=prfA PE=3 SV=1 47 193 3.0E-28
sp|B8FEA2|RF1_DESAA Peptide chain release factor 1 OS=Desulfatibacillum alkenivorans (strain AK-01) GN=prfA PE=3 SV=1 76 193 3.0E-28
sp|Q479R5|RF1_DECAR Peptide chain release factor 1 OS=Dechloromonas aromatica (strain RCB) GN=prfA PE=3 SV=1 74 193 3.0E-28
sp|A1JRU0|RF1_YERE8 Peptide chain release factor 1 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=prfA PE=3 SV=1 67 202 3.0E-28
sp|B2GLX4|RF1_KOCRD Peptide chain release factor 1 OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=prfA PE=3 SV=1 74 204 3.0E-28
sp|Q73JU6|RF1_TREDE Peptide chain release factor 1 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=prfA PE=3 SV=1 47 206 3.0E-28
sp|B1JEP6|RF1_PSEPW Peptide chain release factor 1 OS=Pseudomonas putida (strain W619) GN=prfA PE=3 SV=1 47 222 3.0E-28
sp|A5CYC3|RF1_PELTS Peptide chain release factor 1 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=prfA PE=3 SV=1 72 193 3.0E-28
sp|Q66AX5|RF1_YERPS Peptide chain release factor 1 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=prfA PE=3 SV=1 68 202 3.0E-28
sp|A1RNE1|RF1_SHESW Peptide chain release factor 1 OS=Shewanella sp. (strain W3-18-1) GN=prfA PE=3 SV=1 47 193 3.0E-28
sp|A4Y3J8|RF1_SHEPC Peptide chain release factor 1 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=prfA PE=3 SV=1 47 193 3.0E-28
sp|Q8EAR3|RF1_SHEON Peptide chain release factor 1 OS=Shewanella oneidensis (strain MR-1) GN=prfA PE=3 SV=1 47 193 3.0E-28
sp|B4TXU2|RF1_SALSV Peptide chain release factor 1 OS=Salmonella schwarzengrund (strain CVM19633) GN=prfA PE=3 SV=1 47 193 3.0E-28
sp|B1JM85|RF1_YERPY Peptide chain release factor 1 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=prfA PE=3 SV=1 68 202 3.0E-28
sp|A4TJN7|RF1_YERPP Peptide chain release factor 1 OS=Yersinia pestis (strain Pestoides F) GN=prfA PE=3 SV=1 68 202 3.0E-28
sp|Q1CJK1|RF1_YERPN Peptide chain release factor 1 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=prfA PE=3 SV=1 68 202 3.0E-28
sp|A9QZ08|RF1_YERPG Peptide chain release factor 1 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=prfA PE=3 SV=1 68 202 3.0E-28
sp|Q8ZEX8|RF1_YERPE Peptide chain release factor 1 OS=Yersinia pestis GN=prfA PE=3 SV=1 68 202 3.0E-28
sp|B2K2Z0|RF1_YERPB Peptide chain release factor 1 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=prfA PE=3 SV=1 68 202 3.0E-28
sp|Q1C854|RF1_YERPA Peptide chain release factor 1 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=prfA PE=3 SV=1 68 202 3.0E-28
sp|A7FIG1|RF1_YERP3 Peptide chain release factor 1 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=prfA PE=3 SV=1 68 202 3.0E-28
sp|A6H0W3|RF1_FLAPJ Peptide chain release factor 1 OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=prfA PE=3 SV=1 77 193 3.0E-28
sp|B5R924|RF1_SALG2 Peptide chain release factor 1 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=prfA PE=3 SV=1 47 193 3.0E-28
sp|P0A287|RF1_SALTY Peptide chain release factor 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=prfA PE=3 SV=1 47 193 3.0E-28
sp|P0A288|RF1_SALTI Peptide chain release factor 1 OS=Salmonella typhi GN=prfA PE=3 SV=1 47 193 3.0E-28
sp|A9MW04|RF1_SALPB Peptide chain release factor 1 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=prfA PE=3 SV=1 47 193 3.0E-28
sp|B4SUG2|RF1_SALNS Peptide chain release factor 1 OS=Salmonella newport (strain SL254) GN=prfA PE=3 SV=1 47 193 3.0E-28
sp|B4TKA4|RF1_SALHS Peptide chain release factor 1 OS=Salmonella heidelberg (strain SL476) GN=prfA PE=3 SV=1 47 193 3.0E-28
sp|B5R3J9|RF1_SALEP Peptide chain release factor 1 OS=Salmonella enteritidis PT4 (strain P125109) GN=prfA PE=3 SV=1 47 193 3.0E-28
sp|B5FU19|RF1_SALDC Peptide chain release factor 1 OS=Salmonella dublin (strain CT_02021853) GN=prfA PE=3 SV=1 47 193 3.0E-28
sp|Q57NN5|RF1_SALCH Peptide chain release factor 1 OS=Salmonella choleraesuis (strain SC-B67) GN=prfA PE=3 SV=1 47 193 3.0E-28
sp|B5F4H6|RF1_SALA4 Peptide chain release factor 1 OS=Salmonella agona (strain SL483) GN=prfA PE=3 SV=1 47 193 3.0E-28
sp|B0K1F7|RF1_THEPX Peptide chain release factor 1 OS=Thermoanaerobacter sp. (strain X514) GN=prfA PE=3 SV=1 77 203 3.0E-28
sp|A9MPA1|RF1_SALAR Peptide chain release factor 1 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=prfA PE=3 SV=1 47 193 3.0E-28
sp|B2URQ8|RF1_HELPS Peptide chain release factor 1 OS=Helicobacter pylori (strain Shi470) GN=prfA PE=3 SV=1 43 201 3.0E-28
sp|Q1CV77|RF1_HELPH Peptide chain release factor 1 OS=Helicobacter pylori (strain HPAG1) GN=prfA PE=3 SV=1 43 201 3.0E-28
sp|A1SHH9|RF1_NOCSJ Peptide chain release factor 1 OS=Nocardioides sp. (strain BAA-499 / JS614) GN=prfA PE=3 SV=1 77 193 4.0E-28
sp|Q9ZMZ0|RF1_HELPJ Peptide chain release factor 1 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=prfA PE=3 SV=1 43 201 4.0E-28
sp|P55998|RF1_HELPY Peptide chain release factor 1 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=prfA PE=3 SV=1 43 201 4.0E-28
sp|Q17VT1|RF1_HELAH Peptide chain release factor 1 OS=Helicobacter acinonychis (strain Sheeba) GN=prfA PE=3 SV=1 43 201 4.0E-28
sp|Q0BUJ8|RF1_GRABC Peptide chain release factor 1 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=prfA PE=3 SV=1 47 230 4.0E-28
sp|A1BJT9|RF1_CHLPD Peptide chain release factor 1 OS=Chlorobium phaeobacteroides (strain DSM 266) GN=prfA PE=3 SV=1 75 193 4.0E-28
sp|A8EYR1|RF1_RICCK Peptide chain release factor 1 OS=Rickettsia canadensis (strain McKiel) GN=prfA PE=3 SV=1 77 223 4.0E-28
sp|Q04BB3|RF1_LACDB Peptide chain release factor 1 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=prfA PE=3 SV=1 77 203 4.0E-28
sp|B5Z680|RF1_HELPG Peptide chain release factor 1 OS=Helicobacter pylori (strain G27) GN=prfA PE=3 SV=1 43 201 4.0E-28
sp|B6JPI0|RF1_HELP2 Peptide chain release factor 1 OS=Helicobacter pylori (strain P12) GN=prfA PE=3 SV=1 43 201 4.0E-28
sp|A7I3Q0|RF1_CAMHC Peptide chain release factor 1 OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=prfA PE=3 SV=1 47 224 4.0E-28
sp|A8AG02|RF1_CITK8 Peptide chain release factor 1 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=prfA PE=3 SV=1 47 193 4.0E-28
sp|Q1GAX5|RF1_LACDA Peptide chain release factor 1 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=prfA PE=3 SV=1 77 203 4.0E-28
sp|Q2GKS8|RF1_ANAPZ Peptide chain release factor 1 OS=Anaplasma phagocytophilum (strain HZ) GN=prfA PE=3 SV=1 77 222 4.0E-28
sp|Q8RD98|RF1_CALS4 Peptide chain release factor 1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=prfA PE=3 SV=1 54 203 4.0E-28
sp|B0V7E0|RF1_ACIBY Peptide chain release factor 1 OS=Acinetobacter baumannii (strain AYE) GN=prfA PE=3 SV=1 47 203 4.0E-28
sp|B7IBA1|RF1_ACIB5 Peptide chain release factor 1 OS=Acinetobacter baumannii (strain AB0057) GN=prfA PE=3 SV=1 47 203 4.0E-28
sp|B7H0L9|RF1_ACIB3 Peptide chain release factor 1 OS=Acinetobacter baumannii (strain AB307-0294) GN=prfA PE=3 SV=1 47 203 4.0E-28
sp|A3M6N7|RF1_ACIBT Peptide chain release factor 1 OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=prfA PE=3 SV=2 47 203 5.0E-28
sp|B0VM26|RF1_ACIBS Peptide chain release factor 1 OS=Acinetobacter baumannii (strain SDF) GN=prfA PE=3 SV=1 47 203 5.0E-28
sp|B2HU82|RF1_ACIBC Peptide chain release factor 1 OS=Acinetobacter baumannii (strain ACICU) GN=prfA PE=3 SV=1 47 203 5.0E-28
sp|Q7P1Y2|RF1_CHRVO Peptide chain release factor 1 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=prfA PE=3 SV=1 74 193 5.0E-28
sp|A5N3J7|RF1_CLOK5 Peptide chain release factor 1 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=prfA PE=3 SV=1 77 223 5.0E-28
sp|Q662G9|RF1_BORBP Peptide chain release factor 1 OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=prfA PE=3 SV=1 74 193 5.0E-28
sp|A6LQG2|RF1_CLOB8 Peptide chain release factor 1 OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=prfA PE=3 SV=1 77 203 5.0E-28
sp|A7GW12|RF1_CAMC5 Peptide chain release factor 1 OS=Campylobacter curvus (strain 525.92) GN=prfA PE=3 SV=1 47 229 5.0E-28
sp|Q9K6F4|RF1_BACHD Peptide chain release factor 1 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=prfA PE=3 SV=1 77 203 5.0E-28
sp|Q01RX8|RF1_SOLUE Peptide chain release factor 1 OS=Solibacter usitatus (strain Ellin6076) GN=prfA PE=3 SV=1 47 205 5.0E-28
sp|A6TK43|RF1_ALKMQ Peptide chain release factor 1 OS=Alkaliphilus metalliredigens (strain QYMF) GN=prfA PE=3 SV=1 77 205 5.0E-28
sp|B3PJP4|RF1_CELJU Peptide chain release factor 1 OS=Cellvibrio japonicus (strain Ueda107) GN=prfA PE=3 SV=1 74 193 5.0E-28
sp|Q6G0R0|RF1_BARQU Peptide chain release factor 1 OS=Bartonella quintana (strain Toulouse) GN=prfA PE=3 SV=1 77 203 6.0E-28
sp|Q6KIA0|RF1_MYCMO Peptide chain release factor 1 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=prfA PE=3 SV=1 76 222 6.0E-28
sp|Q5FUR9|RF1_GLUOX Peptide chain release factor 1 OS=Gluconobacter oxydans (strain 621H) GN=prfA PE=3 SV=1 77 221 6.0E-28
sp|Q63SP0|RF2_BURPS Peptide chain release factor 2 OS=Burkholderia pseudomallei (strain K96243) GN=prfB PE=3 SV=1 74 193 7.0E-28
sp|A3NX26|RF2_BURP0 Peptide chain release factor 2 OS=Burkholderia pseudomallei (strain 1106a) GN=prfB PE=3 SV=3 74 193 7.0E-28
sp|Q62J00|RF2_BURMA Peptide chain release factor 2 OS=Burkholderia mallei (strain ATCC 23344) GN=prfB PE=3 SV=1 74 193 7.0E-28
sp|Q812I4|RF1_BACCR Peptide chain release factor 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=prfA PE=3 SV=2 77 228 7.0E-28
sp|A0JY78|RF1_ARTS2 Peptide chain release factor 1 OS=Arthrobacter sp. (strain FB24) GN=prfA PE=3 SV=1 77 204 7.0E-28
sp|B8GLA1|RF1_THISH Peptide chain release factor 1 OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=prfA PE=3 SV=1 74 202 7.0E-28
sp|Q492V8|RF1_BLOPB Peptide chain release factor 1 OS=Blochmannia pennsylvanicus (strain BPEN) GN=prfA PE=3 SV=1 77 203 7.0E-28
sp|B2S1Z9|RF1_TREPS Peptide chain release factor 1 OS=Treponema pallidum subsp. pallidum (strain SS14) GN=prfA PE=3 SV=1 47 209 8.0E-28
sp|O83090|RF1_TREPA Peptide chain release factor 1 OS=Treponema pallidum (strain Nichols) GN=prfA PE=3 SV=1 47 209 8.0E-28
sp|B5BI75|RF1_SALPK Peptide chain release factor 1 OS=Salmonella paratyphi A (strain AKU_12601) GN=prfA PE=3 SV=1 47 193 8.0E-28
sp|Q5PCQ9|RF1_SALPA Peptide chain release factor 1 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=prfA PE=3 SV=1 47 193 8.0E-28
sp|Q2J6M0|RF1_FRASC Peptide chain release factor 1 OS=Frankia sp. (strain CcI3) GN=prfA PE=3 SV=1 77 193 8.0E-28
sp|Q0SNW8|RF1_BORAP Peptide chain release factor 1 OS=Borrelia afzelii (strain PKo) GN=prfA PE=3 SV=1 74 201 8.0E-28
sp|A8MJX9|RF1_ALKOO Peptide chain release factor 1 OS=Alkaliphilus oremlandii (strain OhILAs) GN=prfA PE=3 SV=1 47 193 8.0E-28
sp|C0QWA1|RF1_BRAHW Peptide chain release factor 1 OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=prfA PE=3 SV=1 52 193 8.0E-28
sp|B9L0E3|RF2_THERP Peptide chain release factor 2 OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=prfB PE=3 SV=1 54 193 8.0E-28
sp|B8DBG6|RF1_LISMH Peptide chain release factor 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=prfA PE=3 SV=1 77 203 8.0E-28
sp|Q71WN5|RF1_LISMF Peptide chain release factor 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=prfA PE=3 SV=1 77 203 8.0E-28
sp|C1KYW0|RF1_LISMC Peptide chain release factor 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=prfA PE=3 SV=1 77 203 8.0E-28
sp|A9VSC7|RF1_BACWK Peptide chain release factor 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=prfA PE=3 SV=1 77 228 9.0E-28
sp|Q8Y4A8|RF1_LISMO Peptide chain release factor 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=prfA PE=3 SV=1 77 203 9.0E-28
sp|A0ALM8|RF1_LISW6 Peptide chain release factor 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=prfA PE=3 SV=1 77 203 9.0E-28
sp|Q927V0|RF1_LISIN Peptide chain release factor 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=prfA PE=3 SV=1 77 203 9.0E-28
sp|A4WRK0|RF1_RHOS5 Peptide chain release factor 1 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=prfA PE=3 SV=1 76 193 1.0E-27
sp|A5V9C3|RF1_SPHWW Peptide chain release factor 1 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=prfA PE=3 SV=1 77 223 1.0E-27
sp|A1S8R2|RF1_SHEAM Peptide chain release factor 1 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=prfA PE=3 SV=1 47 193 1.0E-27
sp|A7ZB10|RF1_CAMC1 Peptide chain release factor 1 OS=Campylobacter concisus (strain 13826) GN=prfA PE=3 SV=1 47 228 1.0E-27
sp|Q4ULG0|RF1_RICFE Peptide chain release factor 1 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=prfA PE=3 SV=1 77 223 1.0E-27
sp|Q0AHU1|RF1_NITEC Peptide chain release factor 1 OS=Nitrosomonas eutropha (strain C91) GN=prfA PE=3 SV=1 47 193 1.0E-27
sp|C4K7Y8|RF1_HAMD5 Peptide chain release factor 1 OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=prfA PE=3 SV=1 47 193 1.0E-27
sp|A4SCF1|RF1_CHLPM Peptide chain release factor 1 OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=prfA PE=3 SV=1 75 198 1.0E-27
sp|C4K0C9|RF1_RICPU Peptide chain release factor 1 OS=Rickettsia peacockii (strain Rustic) GN=prfA PE=3 SV=1 77 223 1.0E-27
sp|Q92HK9|RF1_RICCN Peptide chain release factor 1 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=prfA PE=3 SV=1 77 223 1.0E-27
sp|Q6HAV4|RF1_BACHK Peptide chain release factor 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=prfA PE=3 SV=2 77 228 1.0E-27
sp|Q630R9|RF1_BACCZ Peptide chain release factor 1 OS=Bacillus cereus (strain ZK / E33L) GN=prfA PE=3 SV=2 77 228 1.0E-27
sp|B9IRW2|RF1_BACCQ Peptide chain release factor 1 OS=Bacillus cereus (strain Q1) GN=prfA PE=3 SV=1 77 228 1.0E-27
sp|Q72XC2|RF1_BACC1 Peptide chain release factor 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=prfA PE=3 SV=1 77 228 1.0E-27
sp|Q81JX1|RF1_BACAN Peptide chain release factor 1 OS=Bacillus anthracis GN=prfA PE=3 SV=1 77 228 1.0E-27
sp|B0K7G6|RF1_THEP3 Peptide chain release factor 1 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=prfA PE=3 SV=1 77 203 1.0E-27
sp|B3PMD5|RF1_MYCA5 Peptide chain release factor 1 OS=Mycoplasma arthritidis (strain 158L3-1) GN=prfA PE=3 SV=1 77 228 1.0E-27
sp|A8F1S1|RF1_RICM5 Peptide chain release factor 1 OS=Rickettsia massiliae (strain Mtu5) GN=prfA PE=3 SV=1 77 223 1.0E-27
sp|B3QRH7|RF1_CHLP8 Peptide chain release factor 1 OS=Chlorobaculum parvum (strain NCIB 8327) GN=prfA PE=3 SV=1 75 205 1.0E-27
sp|Q2L224|RF2_BORA1 Peptide chain release factor 2 OS=Bordetella avium (strain 197N) GN=prfB PE=3 SV=1 74 204 1.0E-27
sp|C5D9N4|RF1_GEOSW Peptide chain release factor 1 OS=Geobacillus sp. (strain WCH70) GN=prfA PE=3 SV=1 74 203 1.0E-27
sp|Q73IC2|RF1_WOLPM Peptide chain release factor 1 OS=Wolbachia pipientis wMel GN=prfA PE=3 SV=1 77 203 2.0E-27
sp|Q68WK7|RF1_RICTY Peptide chain release factor 1 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=prfA PE=3 SV=1 77 223 2.0E-27
sp|Q8YJ95|RF1_BRUME Peptide chain release factor 1 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=prfA PE=3 SV=2 77 219 2.0E-27
sp|C0RFB5|RF1_BRUMB Peptide chain release factor 1 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=prfA PE=3 SV=1 77 219 2.0E-27
sp|B9E8G1|RF1_MACCJ Peptide chain release factor 1 OS=Macrococcus caseolyticus (strain JCSC5402) GN=prfA PE=3 SV=1 77 198 2.0E-27
sp|Q888C1|RF1_PSESM Peptide chain release factor 1 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=prfA PE=3 SV=1 40 222 2.0E-27
sp|Q8CNI7|RF1_STAES Peptide chain release factor 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=prfA PE=3 SV=1 77 203 2.0E-27
sp|Q5HMA4|RF1_STAEQ Peptide chain release factor 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=prfA PE=3 SV=1 77 203 2.0E-27
sp|B3CL87|RF1_WOLPP Peptide chain release factor 1 OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=prfA PE=3 SV=1 77 203 2.0E-27
sp|Q4URB6|RF1_XANC8 Peptide chain release factor 1 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=prfA PE=3 SV=1 74 193 2.0E-27
sp|Q2RFW0|RF1_MOOTA Peptide chain release factor 1 OS=Moorella thermoacetica (strain ATCC 39073) GN=prfA PE=3 SV=1 54 203 2.0E-27
sp|Q1QAW3|RF1_PSYCK Peptide chain release factor 1 OS=Psychrobacter cryohalolentis (strain K5) GN=prfA PE=3 SV=1 47 203 2.0E-27
sp|B3EE55|RF1_CHLL2 Peptide chain release factor 1 OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=prfA PE=3 SV=1 77 198 2.0E-27
sp|C3PNN0|RF1_RICAE Peptide chain release factor 1 OS=Rickettsia africae (strain ESF-5) GN=prfA PE=3 SV=1 77 223 2.0E-27
sp|A5FHI8|RF1_FLAJ1 Peptide chain release factor 1 OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=prfA PE=3 SV=1 77 193 2.0E-27
sp|B4EDB1|RF2_BURCJ Peptide chain release factor 2 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=prfB PE=3 SV=1 74 193 2.0E-27
sp|Q4FSV3|RF1_PSYA2 Peptide chain release factor 1 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=prfA PE=3 SV=1 47 203 2.0E-27
sp|B9DMD1|RF1_STACT Peptide chain release factor 1 OS=Staphylococcus carnosus (strain TM300) GN=prfA PE=3 SV=1 76 203 3.0E-27
sp|A7H5W3|RF1_CAMJD Peptide chain release factor 1 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=prfA PE=3 SV=1 43 224 3.0E-27
sp|Q8FYK3|RF1_BRUSU Peptide chain release factor 1 OS=Brucella suis biovar 1 (strain 1330) GN=prfA PE=3 SV=1 77 219 3.0E-27
sp|A9M8K5|RF1_BRUC2 Peptide chain release factor 1 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=prfA PE=3 SV=1 77 219 3.0E-27
sp|A5WFG1|RF1_PSYWF Peptide chain release factor 1 OS=Psychrobacter sp. (strain PRwf-1) GN=prfA PE=3 SV=1 47 203 3.0E-27
sp|B0CIC3|RF1_BRUSI Peptide chain release factor 1 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=prfA PE=3 SV=1 77 219 3.0E-27
sp|Q57B22|RF1_BRUAB Peptide chain release factor 1 OS=Brucella abortus biovar 1 (strain 9-941) GN=prfA PE=3 SV=1 77 219 3.0E-27
sp|Q2YLN8|RF1_BRUA2 Peptide chain release factor 1 OS=Brucella abortus (strain 2308) GN=prfA PE=3 SV=1 77 219 3.0E-27
sp|B2S825|RF1_BRUA1 Peptide chain release factor 1 OS=Brucella abortus (strain S19) GN=prfA PE=3 SV=1 77 219 3.0E-27
sp|A1W1L4|RF1_CAMJJ Peptide chain release factor 1 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=prfA PE=3 SV=1 43 224 3.0E-27
sp|A8FNS3|RF1_CAMJ8 Peptide chain release factor 1 OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=prfA PE=3 SV=1 43 224 3.0E-27
sp|A5CQ48|RF1_CLAM3 Peptide chain release factor 1 OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=prfA PE=3 SV=1 77 203 3.0E-27
sp|Q3AUE2|RF1_CHLCH Peptide chain release factor 1 OS=Chlorobium chlorochromatii (strain CaD3) GN=prfA PE=3 SV=1 47 193 3.0E-27
sp|Q7M9M4|RF1_WOLSU Peptide chain release factor 1 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=prfA PE=3 SV=1 47 201 3.0E-27
sp|Q1MSG7|RF1_LAWIP Peptide chain release factor 1 OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=prfA PE=3 SV=1 7 193 3.0E-27
sp|Q1QXC6|RF1_CHRSD Peptide chain release factor 1 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=prfA PE=3 SV=1 7 201 3.0E-27
sp|A8LLU7|RF1_DINSH Peptide chain release factor 1 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=prfA PE=3 SV=1 52 203 3.0E-27
sp|Q9PM63|RF1_CAMJE Peptide chain release factor 1 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=prfA PE=3 SV=1 43 224 3.0E-27
sp|Q5HSH9|RF1_CAMJR Peptide chain release factor 1 OS=Campylobacter jejuni (strain RM1221) GN=prfA PE=3 SV=1 43 224 3.0E-27
sp|C3KDC6|RF1_PSEFS Peptide chain release factor 1 OS=Pseudomonas fluorescens (strain SBW25) GN=prfA PE=3 SV=1 47 222 3.0E-27
sp|Q6MDH3|RF1_PARUW Peptide chain release factor 1 OS=Protochlamydia amoebophila (strain UWE25) GN=prfA PE=3 SV=1 47 193 3.0E-27
sp|B0RAQ5|RF1_CLAMS Peptide chain release factor 1 OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=prfA PE=3 SV=1 77 203 3.0E-27
sp|Q4ZXW7|RF1_PSEU2 Peptide chain release factor 1 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=prfA PE=3 SV=1 47 222 3.0E-27
sp|Q48MV4|RF1_PSE14 Peptide chain release factor 1 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=prfA PE=3 SV=1 47 222 4.0E-27
sp|A6Q6B4|RF1_SULNB Peptide chain release factor 1 OS=Sulfurovum sp. (strain NBC37-1) GN=prfA PE=3 SV=1 47 195 4.0E-27
sp|Q0AC04|RF1_ALKEH Peptide chain release factor 1 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=prfA PE=3 SV=1 47 205 4.0E-27
sp|Q5KUH3|RF1_GEOKA Peptide chain release factor 1 OS=Geobacillus kaustophilus (strain HTA426) GN=prfA PE=3 SV=1 74 203 4.0E-27
sp|Q9A9V5|RF1_CAUCR Peptide chain release factor 1 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=prfA PE=3 SV=2 47 223 4.0E-27
sp|B8HB03|RF1_ARTCA Peptide chain release factor 1 OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=prfA PE=3 SV=1 77 204 4.0E-27
sp|Q8PC68|RF1_XANCP Peptide chain release factor 1 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=prfA PE=3 SV=1 74 193 4.0E-27
sp|B0RUA5|RF1_XANCB Peptide chain release factor 1 OS=Xanthomonas campestris pv. campestris (strain B100) GN=prfA PE=3 SV=1 74 193 4.0E-27
sp|A9HJ50|RF1_GLUDA Peptide chain release factor 1 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=prfA PE=3 SV=1 47 222 4.0E-27
sp|A1URS5|RF1_BARBK Peptide chain release factor 1 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=prfA PE=3 SV=1 77 193 5.0E-27
sp|Q5PAH2|RF1_ANAMM Peptide chain release factor 1 OS=Anaplasma marginale (strain St. Maries) GN=prfA PE=3 SV=1 77 203 6.0E-27
sp|B9KIV2|RF1_ANAMF Peptide chain release factor 1 OS=Anaplasma marginale (strain Florida) GN=prfA PE=3 SV=1 77 203 6.0E-27
sp|Q5GWQ9|RF1_XANOR Peptide chain release factor 1 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=prfA PE=3 SV=1 74 193 6.0E-27
sp|B2SQN5|RF1_XANOP Peptide chain release factor 1 OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=prfA PE=3 SV=1 74 193 6.0E-27
sp|Q2NZW2|RF1_XANOM Peptide chain release factor 1 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=prfA PE=3 SV=1 74 193 6.0E-27
sp|Q73X48|RF1_MYCPA Peptide chain release factor 1 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=prfA PE=3 SV=1 75 193 6.0E-27
sp|A0QCW7|RF1_MYCA1 Peptide chain release factor 1 OS=Mycobacterium avium (strain 104) GN=prfA PE=3 SV=1 75 193 6.0E-27
sp|B2UZI5|RF1_CLOBA Peptide chain release factor 1 OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=prfA PE=3 SV=1 47 193 6.0E-27
sp|A4SK64|RF1_AERS4 Peptide chain release factor 1 OS=Aeromonas salmonicida (strain A449) GN=prfA PE=3 SV=1 47 193 6.0E-27
sp|A5G8T7|RF1_GEOUR Peptide chain release factor 1 OS=Geobacter uraniireducens (strain Rf4) GN=prfA PE=3 SV=1 7 193 6.0E-27
sp|Q6G5T7|RF1_BARHE Peptide chain release factor 1 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=prfA PE=3 SV=1 77 203 6.0E-27
sp|Q0VS77|RF1_ALCBS Peptide chain release factor 1 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=prfA PE=3 SV=1 77 203 6.0E-27
sp|Q3J2B6|RF1_RHOS4 Peptide chain release factor 1 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=prfA PE=3 SV=1 76 193 6.0E-27
[Show less]

GO

GO Term Description Terminal node
GO:0006415 translational termination Yes
GO:0003747 translation release factor activity Yes
GO:0008135 translation factor activity, RNA binding No
GO:0005488 binding No
GO:0045182 translation regulator activity No
GO:0016043 cellular component organization No
GO:0032984 protein-containing complex disassembly No
GO:0008079 translation termination factor activity No
GO:0003674 molecular_function No
GO:0043933 protein-containing complex subunit organization No
GO:0003676 nucleic acid binding No
GO:0090079 translation regulator activity, nucleic acid binding No
GO:0097159 organic cyclic compound binding No
GO:0003723 RNA binding No
GO:0071840 cellular component organization or biogenesis No
GO:0008150 biological_process No
GO:1901363 heterocyclic compound binding No
GO:0022411 cellular component disassembly No
GO:0009987 cellular process No
GO:0043624 cellular protein complex disassembly No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11160
MNSTTGRAEVIRARDDAGNMDKLAHSVLDDVLYNVLSDLLMKTHRDEKTAKAKTAAIRVEKLASDASDSSTPDSK
ADVRVETMRARGAGGQHVNKTESAIRITHMPTGVVVSMQDHRSQQRNREDAWKVLRSRIASQRVEQREAEAARLR
SSVLDQSQITRGDKIRTYNYGQDRCTDHRAAVDVHNLPDVLEGGDTLDRVMQAARDCLVDGEIRALVAEEEAKAR
TAASK*
Coding >Hirsu2|11160
ATGAATTCCACTACGGGGCGGGCCGAGGTAATCCGCGCTCGTGACGATGCCGGAAACATGGACAAGCTGGCCCAC
TCCGTGCTCGACGACGTGCTCTACAACGTCCTGTCCGACCTGTTAATGAAGACGCACCGCGACGAGAAGACGGCC
AAGGCCAAGACGGCCGCGATCCGAGTCGAGAAGCTGGCGTCGGACGCCTCGGACAGCTCGACGCCCGACTCCAAG
GCCGACGTGCGGGTCGAGACGATGCGCGCGCGCGGGGCCGGCGGCCAGCACGTCAACAAGACGGAGTCGGCAATC
CGCATCACGCATATGCCGACGGGCGTCGTCGTCTCGATGCAGGACCATCGGTCGCAGCAGCGCAACCGCGAGGAC
GCGTGGAAGGTGCTGCGGTCGCGCATCGCCAGCCAGCGCGTCGAGCAGCGCGAAGCCGAGGCCGCGCGCCTGCGC
TCGTCCGTCCTCGACCAGTCGCAGATAACGCGCGGCGACAAGATCCGCACCTACAACTACGGCCAGGACCGCTGC
ACCGACCACCGCGCCGCCGTCGACGTCCACAACCTGCCCGACGTGCTTGAGGGCGGCGACACCCTCGACCGCGTC
ATGCAGGCCGCCCGGGACTGCCTCGTCGATGGTGAGATCCGCGCCCTCGTCGCCGAGGAGGAGGCCAAGGCGAGA
ACCGCCGCCAGCAAATGA
Transcript >Hirsu2|11160
ATGAATTCCACTACGGGGCGGGCCGAGGTAATCCGCGCTCGTGACGATGCCGGAAACATGGACAAGCTGGCCCAC
TCCGTGCTCGACGACGTGCTCTACAACGTCCTGTCCGACCTGTTAATGAAGACGCACCGCGACGAGAAGACGGCC
AAGGCCAAGACGGCCGCGATCCGAGTCGAGAAGCTGGCGTCGGACGCCTCGGACAGCTCGACGCCCGACTCCAAG
GCCGACGTGCGGGTCGAGACGATGCGCGCGCGCGGGGCCGGCGGCCAGCACGTCAACAAGACGGAGTCGGCAATC
CGCATCACGCATATGCCGACGGGCGTCGTCGTCTCGATGCAGGACCATCGGTCGCAGCAGCGCAACCGCGAGGAC
GCGTGGAAGGTGCTGCGGTCGCGCATCGCCAGCCAGCGCGTCGAGCAGCGCGAAGCCGAGGCCGCGCGCCTGCGC
TCGTCCGTCCTCGACCAGTCGCAGATAACGCGCGGCGACAAGATCCGCACCTACAACTACGGCCAGGACCGCTGC
ACCGACCACCGCGCCGCCGTCGACGTCCACAACCTGCCCGACGTGCTTGAGGGCGGCGACACCCTCGACCGCGTC
ATGCAGGCCGCCCGGGACTGCCTCGTCGATGGTGAGATCCGCGCCCTCGTCGCCGAGGAGGAGGCCAAGGCGAGA
ACCGCCGCCAGCAAATGA
Gene >Hirsu2|11160
ATGAATTCCACTACGGGGCGGGCCGAGGTAATCCGCGCTCGTGACGATGCCGGAAACATGGACAAGCTGGTAAGT
CGAGAGAGAGCTTCCTCGCTGCCCCCCCCCATCCCCGTCCTGACGTCAAACGGCCGCGGCCTCGCTGCGTCGGGG
CGCGGCCGGGCGGCGGCGGCAACCGCCGTGCGGAAGCGTCGTGAACGAGGCCGCCCGCTGACGCCGTCTCGTGCT
GGCCAGGCCCACTCCGTGCTCGACGACGTGCTCTACAACGTCCTGTCCGACCTGTTAATGAAGACGCACCGCGAC
GAGAAGACGGCCAAGGCCAAGACGGCCGCGATCCGAGTCGAGAAGCTGGCGTCGGACGCCTCGGACAGCTCGACG
CCCGACTCCAAGGCCGACGTGCGGGTCGAGACGATGCGCGCGCGCGGGGCCGGCGGCCAGCACGTCAACAAGACG
GAGTCGGCAATCCGCATCACGCATATGCCGACGGGCGTCGTCGTCTCGATGCAGGACCATCGGTCGCAGCAGCGC
AACCGCGAGGACGCGTGGAAGGTGCTGCGGTCGCGCATCGCCAGCCAGCGCGTCGAGCAGCGCGAAGCCGAGGCC
GCGCGCCTGCGCTCGTCCGTCCTCGACCAGTCGCAGATAACGCGCGGCGACAAGATCCGCACCTACAACTACGGC
CAGGACCGCTGCACCGACCACCGCGCCGCCGTCGACGTCCACAACCTGCCCGACGTGCTTGAGGGCGGCGACACC
CTCGACCGCGTCATGCAGGCCGCCCGGGACTGCCTCGTCGATGGTGAGATCCGCGCCCTCGTCGCCGAGGAGGAG
GCCAAGGCGAGAACCGCCGCCAGCAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail