Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11157
Gene name
LocationContig_975:3808..6137
Strand-
Gene length (bp)2329
Transcript length (bp)2175
Coding sequence length (bp)2175
Protein length (aa) 725

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00009 GTP_EFTU Elongation factor Tu GTP binding domain 1.2E-42 290 509
PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain 5.8E-29 610 718
PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2 1.5E-07 534 602

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HGI7|ERF3_CANMA Eukaryotic peptide chain release factor GTP-binding subunit OS=Candida maltosa GN=SUP35 PE=3 SV=2 67 719 0.0E+00
sp|Q9HGI6|ERF3_DEBHA Eukaryotic peptide chain release factor GTP-binding subunit OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SUP35 PE=3 SV=4 84 719 0.0E+00
sp|O74718|ERF3_SCHPO Eukaryotic peptide chain release factor GTP-binding subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sup35 PE=1 SV=2 107 719 0.0E+00
sp|O13354|ERF3_CANAX Eukaryotic peptide chain release factor GTP-binding subunit OS=Candida albicans GN=SUP35 PE=3 SV=1 195 719 0.0E+00
sp|Q9HGI8|ERF3_KLULA Eukaryotic peptide chain release factor GTP-binding subunit OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SUP35 PE=3 SV=1 52 721 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HGI7|ERF3_CANMA Eukaryotic peptide chain release factor GTP-binding subunit OS=Candida maltosa GN=SUP35 PE=3 SV=2 67 719 0.0E+00
sp|Q9HGI6|ERF3_DEBHA Eukaryotic peptide chain release factor GTP-binding subunit OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SUP35 PE=3 SV=4 84 719 0.0E+00
sp|O74718|ERF3_SCHPO Eukaryotic peptide chain release factor GTP-binding subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sup35 PE=1 SV=2 107 719 0.0E+00
sp|O13354|ERF3_CANAX Eukaryotic peptide chain release factor GTP-binding subunit OS=Candida albicans GN=SUP35 PE=3 SV=1 195 719 0.0E+00
sp|Q9HGI8|ERF3_KLULA Eukaryotic peptide chain release factor GTP-binding subunit OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SUP35 PE=3 SV=1 52 721 0.0E+00
sp|P23637|ERF3_OGAPI Eukaryotic peptide chain release factor GTP-binding subunit OS=Ogataea pini GN=SUP2 PE=3 SV=1 196 719 0.0E+00
sp|Q9HGI4|ERF3_ZYGRO Eukaryotic peptide chain release factor GTP-binding subunit OS=Zygosaccharomyces rouxii GN=SUP35 PE=3 SV=2 268 719 0.0E+00
sp|P05453|ERF3_YEAST Eukaryotic peptide chain release factor GTP-binding subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUP35 PE=1 SV=1 68 718 0.0E+00
sp|P15170|ERF3A_HUMAN Eukaryotic peptide chain release factor GTP-binding subunit ERF3A OS=Homo sapiens GN=GSPT1 PE=1 SV=1 290 719 1.0E-179
sp|Q149F3|ERF3B_MOUSE Eukaryotic peptide chain release factor GTP-binding subunit ERF3B OS=Mus musculus GN=Gspt2 PE=1 SV=1 290 719 1.0E-177
sp|Q8IYD1|ERF3B_HUMAN Eukaryotic peptide chain release factor GTP-binding subunit ERF3B OS=Homo sapiens GN=GSPT2 PE=1 SV=2 290 719 1.0E-177
sp|Q5R4B3|ERF3B_PONAB Eukaryotic peptide chain release factor GTP-binding subunit ERF3B OS=Pongo abelii GN=GSPT2 PE=2 SV=1 290 719 2.0E-177
sp|Q8R050|ERF3A_MOUSE Eukaryotic peptide chain release factor GTP-binding subunit ERF3A OS=Mus musculus GN=Gspt1 PE=1 SV=2 290 719 3.0E-177
sp|Q7YZN9|ERF3_DICDI Eukaryotic peptide chain release factor GTP-binding subunit OS=Dictyostelium discoideum GN=erf3 PE=2 SV=1 290 718 4.0E-128
sp|A1RXW9|EF1A_THEPD Elongation factor 1-alpha OS=Thermofilum pendens (strain Hrk 5) GN=tuf PE=3 SV=1 290 718 5.0E-104
sp|P41203|EF1A_DESMO Elongation factor 1-alpha OS=Desulfurococcus mobilis GN=tuf PE=3 SV=1 290 724 9.0E-98
sp|A3DMQ1|EF1A_STAMF Elongation factor 1-alpha OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=tuf PE=3 SV=1 289 718 5.0E-97
sp|Q5R6Y0|HBS1L_PONAB HBS1-like protein OS=Pongo abelii GN=HBS1L PE=2 SV=1 275 718 8.0E-97
sp|Q9Y450|HBS1L_HUMAN HBS1-like protein OS=Homo sapiens GN=HBS1L PE=1 SV=1 275 718 1.0E-96
sp|Q69ZS7|HBS1L_MOUSE HBS1-like protein OS=Mus musculus GN=Hbs1l PE=1 SV=2 275 718 2.0E-95
sp|Q2KHZ2|HBS1L_BOVIN HBS1-like protein OS=Bos taurus GN=HBS1L PE=2 SV=1 275 718 4.0E-95
sp|Q6AXM7|HBS1L_RAT HBS1-like protein OS=Rattus norvegicus GN=Hbs1l PE=1 SV=1 289 718 1.0E-94
sp|Q04634|EF1A_TETPY Elongation factor 1-alpha OS=Tetrahymena pyriformis PE=2 SV=1 290 718 5.0E-94
sp|P35021|EF1A_SULSO Elongation factor 1-alpha OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=tuf PE=1 SV=3 290 718 3.0E-93
sp|Q8LPC4|EF1A_PYRYE Elongation factor 1-alpha OS=Pyropia yezoensis PE=2 SV=1 290 715 1.0E-92
sp|O93729|EF1A_PYRAE Elongation factor 1-alpha OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=tuf PE=3 SV=1 290 718 3.0E-92
sp|P50256|EF1AC_PORPU Elongation factor 1-alpha C OS=Porphyra purpurea GN=TEF-C PE=2 SV=1 290 715 6.0E-92
sp|A3MV69|EF1A_PYRCJ Elongation factor 1-alpha OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=tuf PE=3 SV=1 290 718 5.0E-91
sp|A8MAJ1|EF1A_CALMQ Elongation factor 1-alpha OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=tuf PE=3 SV=1 290 718 6.0E-91
sp|P86939|EF1A2_TRYB2 Elongation factor 1-alpha 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=Tb10.70.5670 PE=1 SV=1 290 720 7.0E-91
sp|P86934|EF1A1_TRYB2 Elongation factor 1-alpha 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=TEF1 PE=1 SV=1 290 720 7.0E-91
sp|P54959|EF1A_BLAHO Elongation factor 1-alpha OS=Blastocystis hominis PE=2 SV=1 290 715 8.0E-91
sp|Q9YAV0|EF1A_AERPE Elongation factor 1-alpha OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=tuf PE=1 SV=1 290 718 1.0E-90
sp|P86933|EF1A_TRYBB Elongation factor 1-alpha OS=Trypanosoma brucei brucei GN=TEF1 PE=2 SV=1 290 720 4.0E-90
sp|A4WKK8|EF1A_PYRAR Elongation factor 1-alpha OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=tuf PE=3 SV=1 290 718 5.0E-90
sp|A8ABM5|EF1A_IGNH4 Elongation factor 1-alpha OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=tuf PE=3 SV=1 290 718 7.0E-90
sp|A1RRJ3|EF1A_PYRIL Elongation factor 1-alpha OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=tuf PE=3 SV=1 290 718 9.0E-90
sp|Q27139|EF1A1_EUPCR Elongation factor 1-alpha 1 OS=Euplotes crassus GN=EFA1 PE=3 SV=1 290 718 1.0E-89
sp|P34825|EF1A_HYPJE Elongation factor 1-alpha OS=Hypocrea jecorina GN=tef1 PE=3 SV=1 290 715 1.0E-89
sp|P0CT55|EF1A3_SCHPO Elongation factor 1-alpha-B/C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef103 PE=1 SV=1 290 715 3.0E-89
sp|P0CT54|EF1A2_SCHPO Elongation factor 1-alpha-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef102 PE=1 SV=1 290 715 3.0E-89
sp|A0RUM4|EF1A_CENSY Elongation factor 1-alpha OS=Cenarchaeum symbiosum (strain A) GN=tuf PE=3 SV=1 290 722 3.0E-89
sp|Q01765|EF1A_PODCU Elongation factor 1-alpha OS=Podospora curvicolla GN=TEF PE=3 SV=1 290 718 3.0E-89
sp|P17196|EF1A_SULAC Elongation factor 1-alpha OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=tuf PE=3 SV=1 290 718 4.0E-89
sp|P0CT53|EF1A1_SCHPO Elongation factor 1-alpha-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef101 PE=1 SV=1 290 715 4.0E-89
sp|Q01372|EF1A_NEUCR Elongation factor 1-alpha OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tef-1 PE=3 SV=2 290 715 5.0E-89
sp|P28295|EF1A_ABSGL Elongation factor 1-alpha OS=Absidia glauca GN=TEF-1 PE=3 SV=1 290 715 8.0E-89
sp|Q01520|EF1A_PODAS Elongation factor 1-alpha OS=Podospora anserina GN=TEF PE=3 SV=1 290 718 8.0E-89
sp|P0CT32|EF1A2_DICDI Elongation factor 1-alpha OS=Dictyostelium discoideum GN=eef1a2 PE=1 SV=1 290 715 2.0E-88
sp|P0CT31|EF1A1_DICDI Elongation factor 1-alpha OS=Dictyostelium discoideum GN=eef1a1 PE=1 SV=1 290 715 2.0E-88
sp|Q09069|EF1A_SORMA Elongation factor 1-alpha OS=Sordaria macrospora GN=TEF PE=3 SV=1 290 715 4.0E-88
sp|A4YCR6|EF1A_METS5 Elongation factor 1-alpha OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=tuf PE=3 SV=1 290 718 4.0E-88
sp|P0CY35|EF1A1_CANAL Elongation factor 1-alpha 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TEF1 PE=3 SV=1 290 715 9.0E-88
sp|P41752|EF1A_ASHGO Elongation factor 1-alpha OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TEF PE=3 SV=1 290 719 1.0E-87
sp|A5DPE3|EF1A_PICGU Elongation factor 1-alpha OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TEF1 PE=3 SV=2 290 715 2.0E-87
sp|P14864|EF1A2_MUCCL Elongation factor 1-alpha OS=Mucor circinelloides f. lusitanicus GN=TEF-2 PE=3 SV=1 290 715 5.0E-87
sp|P29520|EF1A_BOMMO Elongation factor 1-alpha OS=Bombyx mori PE=2 SV=1 290 723 8.0E-87
sp|P13549|EF1A0_XENLA Elongation factor 1-alpha, somatic form OS=Xenopus laevis GN=eef1as PE=2 SV=1 290 715 9.0E-87
sp|A2BN41|EF1A_HYPBU Elongation factor 1-alpha OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=tuf PE=3 SV=1 290 718 1.0E-86
sp|Q59QD6|EF1A2_CANAL Elongation factor 1-alpha 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TEF2 PE=3 SV=1 290 715 1.0E-86
sp|B8GIQ3|EF1A_METPE Elongation factor 1-alpha OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=tuf PE=3 SV=1 290 713 1.0E-86
sp|Q90835|EF1A_CHICK Elongation factor 1-alpha 1 OS=Gallus gallus GN=EEF1A PE=2 SV=1 290 715 1.0E-86
sp|P62630|EF1A1_RAT Elongation factor 1-alpha 1 OS=Rattus norvegicus GN=Eef1a1 PE=2 SV=1 290 715 1.0E-86
sp|P10126|EF1A1_MOUSE Elongation factor 1-alpha 1 OS=Mus musculus GN=Eef1a1 PE=1 SV=3 290 715 1.0E-86
sp|P62629|EF1A1_CRIGR Elongation factor 1-alpha 1 OS=Cricetulus griseus GN=EEF1A1 PE=2 SV=1 290 715 1.0E-86
sp|P68105|EF1A1_RABIT Elongation factor 1-alpha 1 OS=Oryctolagus cuniculus GN=EEF1A1 PE=1 SV=1 290 715 2.0E-86
sp|Q5R4R8|EF1A1_PONAB Elongation factor 1-alpha 1 OS=Pongo abelii GN=EEF1A1 PE=2 SV=2 290 715 2.0E-86
sp|Q5R1X2|EF1A1_PANTR Elongation factor 1-alpha 1 OS=Pan troglodytes GN=EEF1A1 PE=2 SV=1 290 715 2.0E-86
sp|P68104|EF1A1_HUMAN Elongation factor 1-alpha 1 OS=Homo sapiens GN=EEF1A1 PE=1 SV=1 290 715 2.0E-86
sp|Q66RN5|EF1A1_FELCA Elongation factor 1-alpha 1 OS=Felis catus GN=EEF1A1 PE=2 SV=1 290 715 2.0E-86
sp|P68103|EF1A1_BOVIN Elongation factor 1-alpha 1 OS=Bos taurus GN=EEF1A1 PE=1 SV=1 290 715 2.0E-86
sp|Q2HJN8|EF1A2_OSCTI Elongation factor 1-alpha 2 OS=Oscheius tipulae GN=eft-2 PE=3 SV=1 290 724 2.0E-86
sp|P06805|EF1A1_MUCCL Elongation factor 1-alpha OS=Mucor circinelloides f. lusitanicus GN=TEF-1 PE=3 SV=1 290 715 2.0E-86
sp|P40911|EF1A_AJECG Elongation factor 1-alpha OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=TEF PE=2 SV=1 290 719 2.0E-86
sp|Q5VTE0|EF1A3_HUMAN Putative elongation factor 1-alpha-like 3 OS=Homo sapiens GN=EEF1A1P5 PE=5 SV=1 290 715 2.0E-86
sp|P31018|EF1A_ENTHI Elongation factor 1-alpha OS=Entamoeba histolytica PE=2 SV=1 290 720 2.0E-86
sp|Q9Y713|EF1A_ASPOR Elongation factor 1-alpha OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tef1 PE=3 SV=1 290 715 3.0E-86
sp|P90519|EF1A_CRYPV Elongation factor 1-alpha OS=Cryptosporidium parvum PE=2 SV=1 290 724 4.0E-86
sp|Q00251|EF1A_AURPU Elongation factor 1-alpha OS=Aureobasidium pullulans GN=TEF1 PE=3 SV=1 290 715 4.0E-86
sp|Q976B1|EF1A_SULTO Elongation factor 1-alpha OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=tuf PE=3 SV=1 290 715 6.0E-86
sp|P14865|EF1A3_MUCCL Elongation factor 1-alpha OS=Mucor circinelloides f. lusitanicus GN=TEF-3 PE=3 SV=1 290 715 6.0E-86
sp|P0CN30|EF1A_CRYNJ Elongation factor 1-alpha OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TEF1 PE=3 SV=1 290 715 6.0E-86
sp|P0CN31|EF1A_CRYNB Elongation factor 1-alpha OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TEF1 PE=2 SV=1 290 715 6.0E-86
sp|Q96WZ1|EF1A_COCIM Elongation factor 1-alpha OS=Coccidioides immitis (strain RS) GN=TEF PE=2 SV=2 290 715 8.0E-86
sp|P17508|EF1A3_XENLA Elongation factor 1-alpha, oocyte form OS=Xenopus laevis PE=1 SV=2 290 715 1.0E-85
sp|O42820|EF1A_SCHCO Elongation factor 1-alpha OS=Schizophyllum commune GN=TEF1 PE=3 SV=1 290 715 1.0E-85
sp|A2Q0Z0|EF1A1_HORSE Elongation factor 1-alpha 1 OS=Equus caballus GN=EEF1A1 PE=2 SV=1 290 715 3.0E-85
sp|P02994|EF1A_YEAST Elongation factor 1-alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TEF1 PE=1 SV=1 290 715 3.0E-85
sp|Q2HJN6|EF1A3_OSCTI Elongation factor 1-alpha 3 OS=Oscheius tipulae GN=eft-3 PE=3 SV=1 290 724 4.0E-85
sp|Q71V39|EF1A2_RABIT Elongation factor 1-alpha 2 OS=Oryctolagus cuniculus GN=EEF1A2 PE=1 SV=1 290 715 4.0E-85
sp|Q05639|EF1A2_HUMAN Elongation factor 1-alpha 2 OS=Homo sapiens GN=EEF1A2 PE=1 SV=1 290 715 4.0E-85
sp|Q32PH8|EF1A2_BOVIN Elongation factor 1-alpha 2 OS=Bos taurus GN=EEF1A2 PE=2 SV=1 290 715 4.0E-85
sp|P62632|EF1A2_RAT Elongation factor 1-alpha 2 OS=Rattus norvegicus GN=Eef1a2 PE=1 SV=1 290 715 5.0E-85
sp|P62631|EF1A2_MOUSE Elongation factor 1-alpha 2 OS=Mus musculus GN=Eef1a2 PE=1 SV=1 290 715 5.0E-85
sp|Q979T1|EF1A_THEVO Elongation factor 1-alpha OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=tuf PE=3 SV=2 290 718 6.0E-85
sp|P19486|EF1A_THEAC Elongation factor 1-alpha OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=tuf PE=3 SV=2 290 718 7.0E-85
sp|P27592|EF1A_ONCVO Elongation factor 1-alpha OS=Onchocerca volvulus PE=2 SV=1 290 715 2.0E-84
sp|Q9HDF6|EF1A_PIRIN Elongation factor 1-alpha OS=Piriformospora indica GN=TEF1 PE=2 SV=1 290 715 2.0E-84
sp|A7I656|EF1A_METB6 Elongation factor 1-alpha OS=Methanoregula boonei (strain 6A8) GN=tuf PE=3 SV=1 290 713 2.0E-84
sp|P53013|EF1A_CAEEL Elongation factor 1-alpha OS=Caenorhabditis elegans GN=eft-3 PE=3 SV=1 290 715 2.0E-84
sp|P25166|EF1A_STYLE Elongation factor 1-alpha OS=Stylonychia lemnae GN=EFAA PE=3 SV=1 290 722 2.0E-84
sp|Q2HJN9|EF1A4_OSCTI Elongation factor 1-alpha 4 OS=Oscheius tipulae GN=eft-4 PE=3 SV=1 290 724 3.0E-84
sp|P19039|EF1A_APIME Elongation factor 1-alpha OS=Apis mellifera PE=3 SV=1 289 715 3.0E-84
sp|P32186|EF1A_PUCGR Elongation factor 1-alpha OS=Puccinia graminis GN=TEF PE=3 SV=2 290 715 4.0E-84
sp|P17507|EF1A2_XENLA Elongation factor 1-alpha, oocyte form OS=Xenopus laevis GN=eef1ao PE=1 SV=1 290 715 5.0E-84
sp|Q2HJN4|EF1A1_OSCTI Elongation factor 1-alpha 1 OS=Oscheius tipulae GN=eft-1 PE=3 SV=1 290 724 6.0E-84
sp|Q03033|EF1A_WHEAT Elongation factor 1-alpha OS=Triticum aestivum GN=TEF1 PE=2 SV=1 290 715 9.0E-84
sp|P51554|EF1A_HYDVU Elongation factor 1-alpha OS=Hydra vulgaris PE=2 SV=1 290 718 1.0E-83
sp|P41745|EF1A_BLAAD Elongation factor 1-alpha OS=Blastobotrys adeninivorans GN=TEF PE=3 SV=1 290 715 1.0E-83
sp|P43643|EF1A_TOBAC Elongation factor 1-alpha OS=Nicotiana tabacum PE=2 SV=1 289 715 6.0E-83
sp|P02993|EF1A_ARTSA Elongation factor 1-alpha OS=Artemia salina PE=1 SV=2 289 715 8.0E-83
sp|O59949|EF1A_YARLI Elongation factor 1-alpha OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TEF PE=2 SV=2 290 715 1.0E-82
sp|O24534|EF1A_VICFA Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1 290 715 1.0E-82
sp|P08736|EF1A1_DROME Elongation factor 1-alpha 1 OS=Drosophila melanogaster GN=Ef1alpha48D PE=1 SV=2 289 715 2.0E-82
sp|Q41011|EF1A_PEA Elongation factor 1-alpha OS=Pisum sativum PE=2 SV=1 290 715 2.0E-82
sp|A2STF0|EF1A_METLZ Elongation factor 1-alpha OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=tuf PE=3 SV=1 289 715 2.0E-82
sp|P05303|EF1A2_DROME Elongation factor 1-alpha 2 OS=Drosophila melanogaster GN=Ef1alpha100E PE=2 SV=2 289 715 2.0E-82
sp|Q8GTY0|EF1A4_ARATH Elongation factor 1-alpha 4 OS=Arabidopsis thaliana GN=A4 PE=1 SV=2 289 715 3.0E-82
sp|Q0WL56|EF1A3_ARATH Elongation factor 1-alpha 3 OS=Arabidopsis thaliana GN=A3 PE=1 SV=2 289 715 3.0E-82
sp|Q8W4H7|EF1A2_ARATH Elongation factor 1-alpha 2 OS=Arabidopsis thaliana GN=A2 PE=1 SV=2 289 715 3.0E-82
sp|P0DH99|EF1A1_ARATH Elongation factor 1-alpha 1 OS=Arabidopsis thaliana GN=A1 PE=1 SV=1 289 715 3.0E-82
sp|O29325|EF1A_ARCFU Elongation factor 1-alpha OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=tuf PE=3 SV=1 290 718 4.0E-82
sp|Q41803|EF1A_MAIZE Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3 SV=1 290 715 4.0E-82
sp|O64937|EF1A_ORYSJ Elongation factor 1-alpha OS=Oryza sativa subsp. japonica GN=REFA1 PE=2 SV=2 290 715 6.0E-82
sp|A6UV43|EF1A_META3 Elongation factor 1-alpha OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=tuf PE=3 SV=1 293 713 9.0E-82
sp|Q92005|EF1A_DANRE Elongation factor 1-alpha OS=Danio rerio GN=eef1a PE=2 SV=1 290 715 1.0E-81
sp|P17786|EF1A_SOLLC Elongation factor 1-alpha OS=Solanum lycopersicum PE=2 SV=1 289 715 1.0E-81
sp|P34824|EF1A1_HORVU Elongation factor 1-alpha OS=Hordeum vulgare PE=1 SV=1 289 715 1.0E-81
sp|Q9YIC0|EF1A_ORYLA Elongation factor 1-alpha OS=Oryzias latipes GN=eef1a PE=2 SV=1 289 722 3.0E-81
sp|Q40034|EF1A2_HORVU Elongation factor 1-alpha OS=Hordeum vulgare GN=BLT63 PE=1 SV=1 289 715 3.0E-81
sp|Q00080|EF1A_PLAFK Elongation factor 1-alpha OS=Plasmodium falciparum (isolate K1 / Thailand) GN=MEF-1 PE=3 SV=1 290 718 4.0E-81
sp|Q6L202|EF1A_PICTO Elongation factor 1-alpha OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=tuf PE=3 SV=1 290 718 5.0E-81
sp|Q57770|EF1A_METJA Elongation factor 1-alpha OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=tuf PE=3 SV=1 293 713 5.0E-81
sp|O49169|EF1A_MANES Elongation factor 1-alpha OS=Manihot esculenta GN=EF1 PE=3 SV=1 290 715 5.0E-81
sp|P34823|EF1A2_DAUCA Elongation factor 1-alpha OS=Daucus carota PE=2 SV=1 289 715 5.0E-81
sp|P29521|EF1A1_DAUCA Elongation factor 1-alpha OS=Daucus carota PE=1 SV=1 290 715 9.0E-81
sp|P17506|EF1A1_XENLA Elongation factor 1-alpha OS=Xenopus laevis PE=1 SV=2 290 715 2.0E-80
sp|P25698|EF1A_SOYBN Elongation factor 1-alpha OS=Glycine max GN=TEFS1 PE=3 SV=2 290 715 2.0E-80
sp|A3CTG3|EF1A_METMJ Elongation factor 1-alpha OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=tuf PE=3 SV=1 290 713 3.0E-80
sp|Q8TRC4|EF1A_METAC Elongation factor 1-alpha OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=tuf PE=3 SV=1 290 713 4.0E-80
sp|P14963|EF1A_EUGGR Elongation factor 1-alpha OS=Euglena gracilis GN=TEF PE=2 SV=1 290 715 4.0E-80
sp|Q12WT3|EF1A_METBU Elongation factor 1-alpha OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=tuf PE=3 SV=1 290 713 8.0E-80
sp|Q27140|EF1A2_EUPCR Elongation factor 1-alpha 2 OS=Euplotes crassus GN=EFA2 PE=3 SV=1 290 719 3.0E-79
sp|Q2FRI3|EF1A_METHJ Elongation factor 1-alpha OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=tuf PE=3 SV=1 290 719 5.0E-79
sp|Q8TYP6|EF1A_METKA Elongation factor 1-alpha OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=tuf PE=3 SV=1 290 718 7.0E-79
sp|Q18EY5|EF1A_HALWD Elongation factor 1-alpha OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=tuf PE=3 SV=1 290 718 6.0E-78
sp|Q0W8G2|EF1A_METAR Elongation factor 1-alpha OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=tuf PE=3 SV=1 290 718 2.0E-77
sp|Q3IUD8|EF1A_NATPD Elongation factor 1-alpha OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=tuf PE=3 SV=1 290 718 2.0E-76
sp|A0B7D6|EF1A_METTP Elongation factor 1-alpha OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=tuf PE=3 SV=1 290 713 2.0E-76
sp|C6A4R7|EF1A_THESM Elongation factor 1-alpha OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=tuf PE=3 SV=1 290 718 3.0E-76
sp|Q8PUR8|EF1A_METMA Elongation factor 1-alpha OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=tuf PE=3 SV=1 290 713 3.0E-76
sp|Q9HM89|EF1A_HALSA Elongation factor 1-alpha OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=tuf PE=3 SV=1 292 723 8.0E-76
sp|B0R8C3|EF1A_HALS3 Elongation factor 1-alpha OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=tuf PE=3 SV=1 292 723 8.0E-76
sp|Q08046|EF1A_GIAIN Elongation factor 1-alpha (Fragment) OS=Giardia intestinalis GN=TEF1 PE=2 SV=1 306 704 2.0E-75
sp|A4FWE9|EF1A_METM5 Elongation factor 1-alpha OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=tuf PE=3 SV=1 290 713 5.0E-75
sp|A5ULM5|EF1A_METS3 Elongation factor 1-alpha OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=tuf PE=3 SV=2 290 713 1.0E-74
sp|A6VGV6|EF1A_METM7 Elongation factor 1-alpha OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=tuf PE=3 SV=1 290 713 2.0E-74
sp|Q464Z4|EF1A_METBF Elongation factor 1-alpha OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=tuf PE=3 SV=1 290 713 2.0E-74
sp|A9A9U3|EF1A_METM6 Elongation factor 1-alpha OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=tuf PE=3 SV=1 290 713 2.0E-74
sp|Q26487|EF1A_SPOFR Elongation factor 1-alpha (Fragment) OS=Spodoptera frugiperda PE=1 SV=1 300 704 7.0E-74
sp|P07810|EF1A_METVA Elongation factor 1-alpha OS=Methanococcus vannielii GN=tuf PE=3 SV=1 290 713 2.0E-73
sp|A6UQ14|EF1A_METVS Elongation factor 1-alpha OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=tuf PE=3 SV=1 290 713 4.0E-73
sp|Q6LXI1|EF1A_METMP Elongation factor 1-alpha OS=Methanococcus maripaludis (strain S2 / LL) GN=tuf PE=3 SV=1 290 713 5.0E-73
sp|P84316|EF1A_HELZE Elongation factor 1-alpha (Fragment) OS=Helicoverpa zea PE=3 SV=1 300 704 2.0E-72
sp|P84315|EF1A_HELVI Elongation factor 1-alpha (Fragment) OS=Heliothis virescens PE=3 SV=1 300 704 2.0E-72
sp|P84318|EF1A_HELGL Elongation factor 1-alpha (Fragment) OS=Helicoverpa gelotopoeon PE=3 SV=1 300 704 2.0E-72
sp|P84320|EF1A_HELDI Elongation factor 1-alpha (Fragment) OS=Heliocheilus discalis PE=3 SV=1 300 704 2.0E-72
sp|P84317|EF1A_HELAM Elongation factor 1-alpha (Fragment) OS=Helicoverpa armigera PE=3 SV=1 300 704 2.0E-72
sp|P84319|EF1A_HELAL Elongation factor 1-alpha (Fragment) OS=Heliocheilus albipunctella PE=3 SV=1 300 704 2.0E-72
sp|P84322|EF1A_ANIIF Elongation factor 1-alpha (Fragment) OS=Anicla infecta PE=3 SV=1 300 704 2.0E-72
sp|P84321|EF1A_ADIBE Elongation factor 1-alpha (Fragment) OS=Adisura bella PE=3 SV=1 300 704 2.0E-72
sp|P16018|EF1A_HALMA Elongation factor 1-alpha OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=tuf PE=1 SV=2 290 715 3.0E-72
sp|Q74MI6|EF1A_NANEQ Elongation factor 1-alpha OS=Nanoarchaeum equitans (strain Kin4-M) GN=tuf PE=3 SV=1 290 713 5.0E-72
sp|O74774|HBS1_SCHPO Elongation factor 1 alpha-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hbs1 PE=1 SV=4 293 718 1.0E-70
sp|Q8U152|EF1A_PYRFU Elongation factor 1-alpha OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=tuf PE=3 SV=1 290 718 2.0E-70
sp|P26751|EF1A_PYRWO Elongation factor 1-alpha OS=Pyrococcus woesei GN=tuf PE=3 SV=1 290 718 4.0E-70
sp|O27132|EF1A_METTH Elongation factor 1-alpha OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=tuf PE=1 SV=1 290 719 5.0E-70
sp|Q5JFZ4|EF1A_THEKO Elongation factor 1-alpha OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=tuf PE=3 SV=1 290 718 6.0E-69
sp|Q9V0V7|EF1A_PYRAB Elongation factor 1-alpha OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=tuf PE=3 SV=1 290 718 4.0E-68
sp|C5A5P4|EF1A_THEGJ Elongation factor 1-alpha OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=tuf PE=3 SV=1 290 718 8.0E-68
sp|B6YVG2|EF1A_THEON Elongation factor 1-alpha OS=Thermococcus onnurineus (strain NA1) GN=tuf PE=3 SV=1 290 718 1.0E-66
sp|O59153|EF1A_PYRHO Elongation factor 1-alpha OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=tuf PE=1 SV=1 290 718 2.0E-66
sp|P17197|EF1A_THECE Elongation factor 1-alpha OS=Thermococcus celer GN=tuf PE=3 SV=1 290 718 3.0E-66
sp|P50257|EF1AS_PORPU Elongation factor 1-alpha S OS=Porphyra purpurea GN=TEF-S PE=2 SV=1 290 715 9.0E-65
sp|Q2NEL1|EF1A_METST Elongation factor 1-alpha OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=tuf PE=3 SV=1 290 721 1.0E-63
sp|P32769|HBS1_YEAST Elongation factor 1 alpha-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HBS1 PE=1 SV=2 292 718 9.0E-61
sp|P27634|EF1A_RHYAM Elongation factor 1-alpha (Fragment) OS=Rhynchosciara americana PE=2 SV=1 338 723 3.0E-58
sp|Q07051|EF1A_EIMBO Elongation factor 1-alpha (Fragment) OS=Eimeria bovis PE=2 SV=1 390 723 1.0E-50
sp|Q8SS29|EF1A_ENCCU Elongation factor 1-alpha OS=Encephalitozoon cuniculi (strain GB-M1) GN=TEF1 PE=1 SV=2 290 720 4.0E-40
sp|Q7UMW2|CYSNC_RHOBA Bifunctional enzyme CysN/CysC OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=cysNC PE=3 SV=1 276 559 7.0E-37
sp|A8EWR6|CYSN_ARCB4 Sulfate adenylyltransferase subunit 1 OS=Arcobacter butzleri (strain RM4018) GN=cysN PE=3 SV=1 276 556 4.0E-36
sp|B2J5B1|EFTU_NOSP7 Elongation factor Tu OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=tuf PE=3 SV=1 290 719 5.0E-36
sp|Q8EB10|CYSN_SHEON Sulfate adenylyltransferase subunit 1 OS=Shewanella oneidensis (strain MR-1) GN=cysN PE=3 SV=2 272 604 7.0E-36
sp|A6QB12|CYSN_SULNB Sulfate adenylyltransferase subunit 1 OS=Sulfurovum sp. (strain NBC37-1) GN=cysN PE=3 SV=1 284 556 7.0E-35
sp|Q8AAP9|CYSN_BACTN Sulfate adenylyltransferase subunit 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=cysN PE=3 SV=1 290 618 8.0E-35
sp|Q5LES3|CYSN_BACFN Sulfate adenylyltransferase subunit 1 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=cysN PE=3 SV=1 290 715 1.0E-34
sp|Q64VQ9|CYSN_BACFR Sulfate adenylyltransferase subunit 1 OS=Bacteroides fragilis (strain YCH46) GN=cysN PE=3 SV=1 290 715 1.0E-34
sp|C1D890|CYSN_LARHH Sulfate adenylyltransferase subunit 1 OS=Laribacter hongkongensis (strain HLHK9) GN=cysN PE=3 SV=1 290 598 4.0E-34
sp|P74227|EFTU_SYNY3 Elongation factor Tu OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=tuf PE=1 SV=1 290 719 5.0E-34
sp|C4LAG3|CYSN_TOLAT Sulfate adenylyltransferase subunit 1 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=cysN PE=3 SV=1 284 604 5.0E-34
sp|B7VKY2|CYSN_VIBTL Sulfate adenylyltransferase subunit 1 OS=Vibrio tasmaniensis (strain LGP32) GN=cysN PE=3 SV=1 290 544 6.0E-34
sp|B1KMH4|CYSN_SHEWM Sulfate adenylyltransferase subunit 1 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=cysN PE=3 SV=1 281 618 6.0E-34
sp|Q482Z9|CYSN_COLP3 Sulfate adenylyltransferase subunit 1 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=cysN PE=3 SV=1 281 618 6.0E-34
sp|Q5E830|CYSN_VIBF1 Sulfate adenylyltransferase subunit 1 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=cysN PE=3 SV=1 286 618 1.0E-33
sp|B5FGJ9|CYSN_VIBFM Sulfate adenylyltransferase subunit 1 OS=Vibrio fischeri (strain MJ11) GN=cysN PE=3 SV=1 286 618 1.0E-33
sp|A4IXZ5|CYSN_FRATW Sulfate adenylyltransferase subunit 1 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=cysN PE=3 SV=1 281 556 1.0E-33
sp|B6ELP3|CYSN_ALISL Sulfate adenylyltransferase subunit 1 OS=Aliivibrio salmonicida (strain LFI1238) GN=cysN PE=3 SV=1 290 618 2.0E-33
sp|Q1QUF9|CYSN_CHRSD Sulfate adenylyltransferase subunit 1 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=cysN PE=3 SV=1 284 618 2.0E-33
sp|A5CCA0|EFTU1_ORITB Elongation factor Tu 1 OS=Orientia tsutsugamushi (strain Boryong) GN=tuf1 PE=3 SV=1 290 621 3.0E-33
sp|A7ZQJ5|CYSN_ECO24 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=cysN PE=3 SV=1 290 544 3.0E-33
sp|B7LXG3|CYSN_ECO8A Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O8 (strain IAI1) GN=cysN PE=3 SV=1 290 544 3.0E-33
sp|B7LEG9|CYSN_ECO55 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain 55989 / EAEC) GN=cysN PE=3 SV=1 290 544 3.0E-33
sp|A7MJ69|CYSN_CROS8 Sulfate adenylyltransferase subunit 1 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=cysN PE=3 SV=1 290 611 3.0E-33
sp|B6I6E1|CYSN_ECOSE Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain SE11) GN=cysN PE=3 SV=1 290 544 3.0E-33
sp|Q5NG10|CYSN_FRATT Sulfate adenylyltransferase subunit 1 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=cysN PE=3 SV=1 281 544 4.0E-33
sp|Q14HG2|CYSN_FRAT1 Sulfate adenylyltransferase subunit 1 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=cysN PE=3 SV=1 281 544 4.0E-33
sp|Q8DE73|CYSN_VIBVU Sulfate adenylyltransferase subunit 1 OS=Vibrio vulnificus (strain CMCP6) GN=cysN PE=3 SV=1 290 556 5.0E-33
sp|Q7N8L0|CYSN_PHOLL Sulfate adenylyltransferase subunit 1 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysN PE=3 SV=1 299 603 5.0E-33
sp|B5Z3B3|CYSN_ECO5E Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=cysN PE=3 SV=1 290 544 7.0E-33
sp|Q8X7X7|CYSN_ECO57 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O157:H7 GN=cysN PE=3 SV=1 290 544 7.0E-33
sp|Q1R7U0|CYSN_ECOUT Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain UTI89 / UPEC) GN=cysN PE=3 SV=1 290 544 7.0E-33
sp|Q8FEJ1|CYSN_ECOL6 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysN PE=3 SV=1 290 544 7.0E-33
sp|A1AEU5|CYSN_ECOK1 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O1:K1 / APEC GN=cysN PE=3 SV=1 290 544 7.0E-33
sp|B7MKM5|CYSN_ECO45 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=cysN PE=3 SV=1 290 544 7.0E-33
sp|A8A3N0|CYSN_ECOHS Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O9:H4 (strain HS) GN=cysN PE=3 SV=1 290 544 7.0E-33
sp|Q3YYB1|CYSN_SHISS Sulfate adenylyltransferase subunit 1 OS=Shigella sonnei (strain Ss046) GN=cysN PE=3 SV=1 290 544 7.0E-33
sp|B1LQ72|CYSN_ECOSM Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=cysN PE=3 SV=1 290 544 7.0E-33
sp|P23845|CYSN_ECOLI Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain K12) GN=cysN PE=1 SV=1 290 544 7.0E-33
sp|Q0TEA7|CYSN_ECOL5 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=cysN PE=3 SV=1 290 544 7.0E-33
sp|B1XCS7|CYSN_ECODH Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain K12 / DH10B) GN=cysN PE=3 SV=1 290 544 7.0E-33
sp|C4ZZQ5|CYSN_ECOBW Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=cysN PE=3 SV=1 290 544 7.0E-33
sp|B7MZ52|CYSN_ECO81 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O81 (strain ED1a) GN=cysN PE=3 SV=1 290 544 7.0E-33
sp|B7NT95|CYSN_ECO7I Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=cysN PE=3 SV=1 290 544 7.0E-33
sp|B1Z7C0|CYSN_METPB Sulfate adenylyltransferase subunit 1 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=cysN PE=3 SV=1 284 567 8.0E-33
sp|B4RTW4|CYSN_ALTMD Sulfate adenylyltransferase subunit 1 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=cysN PE=3 SV=1 290 544 9.0E-33
sp|B7UHH0|CYSN_ECO27 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=cysN PE=3 SV=1 290 544 1.0E-32
sp|B7JUP5|EFTU_CYAP8 Elongation factor Tu OS=Cyanothece sp. (strain PCC 8801) GN=tuf PE=3 SV=1 290 719 1.0E-32
sp|B7LWK4|CYSN_ESCF3 Sulfate adenylyltransferase subunit 1 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=cysN PE=3 SV=1 290 544 1.0E-32
sp|B0CCD0|EFTU_ACAM1 Elongation factor Tu OS=Acaryochloris marina (strain MBIC 11017) GN=tuf PE=3 SV=1 290 719 1.0E-32
sp|Q2JUX4|EFTU_SYNJA Elongation factor Tu OS=Synechococcus sp. (strain JA-3-3Ab) GN=tuf PE=3 SV=1 290 719 2.0E-32
sp|Q7V500|EFTU_PROMM Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9313) GN=tuf PE=3 SV=1 290 719 2.0E-32
sp|A5CCL4|EFTU2_ORITB Elongation factor Tu 2 OS=Orientia tsutsugamushi (strain Boryong) GN=tuf2 PE=3 SV=2 290 621 2.0E-32
sp|A1JJT0|CYSN_YERE8 Sulfate adenylyltransferase subunit 1 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=cysN PE=3 SV=1 290 556 2.0E-32
sp|Q32CH9|CYSN_SHIDS Sulfate adenylyltransferase subunit 1 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=cysN PE=3 SV=1 290 544 2.0E-32
sp|B0JSE0|EFTU_MICAN Elongation factor Tu OS=Microcystis aeruginosa (strain NIES-843) GN=tuf PE=3 SV=1 290 719 2.0E-32
sp|B7N6Y1|CYSN_ECOLU Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=cysN PE=3 SV=1 290 544 3.0E-32
sp|A0Q6F0|CYSN_FRATN Sulfate adenylyltransferase subunit 1 OS=Francisella tularensis subsp. novicida (strain U112) GN=cysN PE=3 SV=1 281 544 4.0E-32
sp|A7MWE9|CYSN_VIBCB Sulfate adenylyltransferase subunit 1 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=cysN PE=3 SV=1 284 556 4.0E-32
sp|B3QZH5|EFTU_PHYMT Elongation factor Tu OS=Phytoplasma mali (strain AT) GN=tuf PE=3 SV=1 290 621 4.0E-32
sp|Q9TMM9|EFTU_TOXGO Elongation factor Tu, apicoplast OS=Toxoplasma gondii GN=tufA PE=3 SV=1 285 719 5.0E-32
sp|A2CC87|EFTU_PROM3 Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9303) GN=tuf PE=3 SV=1 290 719 5.0E-32
sp|A6Q1L5|EFTU_NITSB Elongation factor Tu OS=Nitratiruptor sp. (strain SB155-2) GN=tuf PE=3 SV=1 290 719 5.0E-32
sp|P51287|EFTU_PORPU Elongation factor Tu, chloroplastic OS=Porphyra purpurea GN=tufA PE=3 SV=1 290 719 5.0E-32
sp|B2VG01|CYSN_ERWT9 Sulfate adenylyltransferase subunit 1 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=cysN PE=3 SV=1 290 544 5.0E-32
sp|B7K834|EFTU_CYAP7 Elongation factor Tu OS=Cyanothece sp. (strain PCC 7424) GN=tuf PE=3 SV=1 290 719 6.0E-32
sp|P18668|EFTU_SYNP6 Elongation factor Tu OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=tuf PE=3 SV=1 290 719 7.0E-32
sp|P33171|EFTU_SYNE7 Elongation factor Tu OS=Synechococcus elongatus (strain PCC 7942) GN=tuf PE=3 SV=2 290 719 7.0E-32
sp|Q7MPF2|CYSN_VIBVY Sulfate adenylyltransferase subunit 1 OS=Vibrio vulnificus (strain YJ016) GN=cysN PE=3 SV=1 290 556 7.0E-32
sp|Q54HB2|EFTU_DICDI Elongation factor Tu, mitochondrial OS=Dictyostelium discoideum GN=tufm PE=1 SV=2 290 719 7.0E-32
sp|A5F578|CYSN_VIBC3 Sulfate adenylyltransferase subunit 1 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=cysN PE=3 SV=1 290 556 7.0E-32
sp|Q31XB3|CYSN_SHIBS Sulfate adenylyltransferase subunit 1 OS=Shigella boydii serotype 4 (strain Sb227) GN=cysN PE=3 SV=1 290 544 8.0E-32
sp|B2TZI0|CYSN_SHIB3 Sulfate adenylyltransferase subunit 1 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=cysN PE=3 SV=1 290 544 1.0E-31
sp|A4FPM7|EFTU_SACEN Elongation factor Tu OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=tuf PE=3 SV=1 290 621 1.0E-31
sp|Q66EC7|CYSN_YERPS Sulfate adenylyltransferase subunit 1 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cysN PE=3 SV=1 290 556 1.0E-31
sp|Q8ZBP2|CYSN_YERPE Sulfate adenylyltransferase subunit 1 OS=Yersinia pestis GN=cysN PE=3 SV=1 290 556 1.0E-31
sp|A7FLY2|CYSN_YERP3 Sulfate adenylyltransferase subunit 1 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=cysN PE=3 SV=1 290 556 1.0E-31
sp|Q1XDK1|EFTU_PYRYE Elongation factor Tu, chloroplastic OS=Pyropia yezoensis GN=tufA PE=3 SV=1 290 719 1.0E-31
sp|Q9ZEU3|EFTU_APPPP Elongation factor Tu OS=Apple proliferation phytoplasma GN=tuf PE=3 SV=1 290 621 1.0E-31
sp|A5GIP0|EFTU_SYNPW Elongation factor Tu OS=Synechococcus sp. (strain WH7803) GN=tuf PE=3 SV=1 290 719 2.0E-31
sp|O50274|CYSNC_PSEAE Bifunctional enzyme CysN/CysC OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysNC PE=3 SV=1 268 602 2.0E-31
sp|A8ANW5|CYSN_CITK8 Sulfate adenylyltransferase subunit 1 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=cysN PE=3 SV=1 290 602 2.0E-31
sp|B8HVR7|EFTU_CYAP4 Elongation factor Tu OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=tuf PE=3 SV=1 290 719 2.0E-31
sp|Q0T1I2|CYSN_SHIF8 Sulfate adenylyltransferase subunit 1 OS=Shigella flexneri serotype 5b (strain 8401) GN=cysN PE=3 SV=1 290 544 2.0E-31
sp|Q3AMT6|EFTU_SYNSC Elongation factor Tu OS=Synechococcus sp. (strain CC9605) GN=tuf PE=3 SV=1 290 719 2.0E-31
sp|Q3MDM5|EFTU_ANAVT Elongation factor Tu OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=tuf PE=3 SV=1 290 719 3.0E-31
sp|B1IUS8|CYSN_ECOLC Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=cysN PE=3 SV=1 290 544 3.0E-31
sp|Q15VB8|CYSN_PSEA6 Sulfate adenylyltransferase subunit 1 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=cysN PE=3 SV=1 290 574 3.0E-31
sp|Q1ACI3|EFTU_CHAVU Elongation factor Tu, chloroplastic OS=Chara vulgaris GN=tufA PE=3 SV=1 290 719 3.0E-31
sp|P50371|EFTU_CHACO Elongation factor Tu, chloroplastic OS=Chara connivens GN=tufA PE=3 SV=1 290 717 3.0E-31
sp|Q8YP63|EFTU_NOSS1 Elongation factor Tu OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=tuf PE=1 SV=1 290 719 4.0E-31
sp|Q6YQV8|EFTU_ONYPE Elongation factor Tu OS=Onion yellows phytoplasma (strain OY-M) GN=tuf PE=3 SV=1 285 621 4.0E-31
sp|Q2NVM8|CYSN_SODGM Sulfate adenylyltransferase subunit 1 OS=Sodalis glossinidius (strain morsitans) GN=cysN PE=3 SV=1 290 556 4.0E-31
sp|A5GW14|EFTU_SYNR3 Elongation factor Tu OS=Synechococcus sp. (strain RCC307) GN=tuf PE=3 SV=1 290 719 5.0E-31
sp|P9WNM5|CYSNC_MYCTU Bifunctional enzyme CysN/CysC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cysNC PE=1 SV=1 299 662 6.0E-31
sp|P9WNM4|CYSNC_MYCTO Bifunctional enzyme CysN/CysC OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cysNC PE=3 SV=1 299 662 6.0E-31
sp|Q7NVN5|CYSN_CHRVO Sulfate adenylyltransferase subunit 1 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cysN PE=3 SV=1 282 556 6.0E-31
sp|P50064|EFTU_GLOVI Elongation factor Tu OS=Gloeobacter violaceus (strain PCC 7421) GN=tufA PE=3 SV=2 290 719 6.0E-31
sp|Q3AW53|EFTU_SYNS9 Elongation factor Tu OS=Synechococcus sp. (strain CC9902) GN=tuf PE=3 SV=1 290 719 6.0E-31
sp|A9W4X1|CYSN_METEP Sulfate adenylyltransferase subunit 1 OS=Methylobacterium extorquens (strain PA1) GN=cysN PE=3 SV=1 284 567 6.0E-31
sp|Q2NJ20|EFTU_AYWBP Elongation factor Tu OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=tuf PE=3 SV=1 285 621 6.0E-31
sp|C4ZB99|EFTU_EUBR3 Elongation factor Tu OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=tuf PE=3 SV=1 290 621 6.0E-31
sp|P56893|CYSN_RHIME Sulfate adenylyltransferase subunit 1 OS=Rhizobium meliloti (strain 1021) GN=cysN PE=3 SV=1 281 556 7.0E-31
sp|Q4MYA4|EFTU_THEPA Elongation factor Tu, apicoplast OS=Theileria parva GN=tufA PE=3 SV=1 290 719 9.0E-31
sp|C3LRM1|CYSN_VIBCM Sulfate adenylyltransferase subunit 1 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=cysN PE=3 SV=1 290 556 9.0E-31
sp|Q9KP20|CYSN_VIBCH Sulfate adenylyltransferase subunit 1 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cysN PE=3 SV=1 290 556 9.0E-31
sp|Q83JX8|CYSN_SHIFL Sulfate adenylyltransferase subunit 1 OS=Shigella flexneri GN=cysN PE=3 SV=1 290 544 1.0E-30
sp|A7GZK6|EFTU_CAMC5 Elongation factor Tu OS=Campylobacter curvus (strain 525.92) GN=tuf PE=3 SV=1 290 621 1.0E-30
sp|Q06J54|EFTU_BIGNA Elongation factor Tu, chloroplastic OS=Bigelowiella natans GN=tufA PE=3 SV=1 290 621 1.0E-30
sp|Q2EEV7|EFTU_HELSJ Elongation factor Tu, plastid OS=Helicosporidium sp. subsp. Simulium jonesii GN=tufA PE=3 SV=2 290 719 1.0E-30
sp|B7L0X9|CYSN_METC4 Sulfate adenylyltransferase subunit 1 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=cysN PE=3 SV=1 284 598 1.0E-30
sp|B3PII1|CYSN_CELJU Sulfate adenylyltransferase subunit 1 OS=Cellvibrio japonicus (strain Ueda107) GN=cysN PE=3 SV=1 290 713 1.0E-30
sp|A9WFP3|EFTU_CHLAA Elongation factor Tu OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=tuf1 PE=3 SV=1 290 719 1.0E-30
sp|P40175|EFTU3_STRCO Elongation factor Tu-3 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=tuf3 PE=3 SV=2 290 718 2.0E-30
sp|A0KP35|CYSN_AERHH Sulfate adenylyltransferase subunit 1 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=cysN PE=3 SV=1 290 556 2.0E-30
sp|P02992|EFTU_YEAST Elongation factor Tu, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUF1 PE=1 SV=1 290 719 2.0E-30
sp|B1WQY4|EFTU_CYAA5 Elongation factor Tu OS=Cyanothece sp. (strain ATCC 51142) GN=tuf PE=3 SV=1 290 719 2.0E-30
sp|A4SRG8|CYSN_AERS4 Sulfate adenylyltransferase subunit 1 OS=Aeromonas salmonicida (strain A449) GN=cysN PE=3 SV=1 290 556 2.0E-30
sp|B1XI63|EFTU_SYNP2 Elongation factor Tu OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=tuf PE=3 SV=1 290 719 3.0E-30
sp|O07309|NODQ_RHISB Bifunctional enzyme NodQ OS=Rhizobium sp. (strain BR816) GN=nodQ PE=3 SV=1 289 654 3.0E-30
sp|Q04B37|EFTU_LACDB Elongation factor Tu OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=tuf PE=3 SV=1 290 621 3.0E-30
sp|Q1GAQ0|EFTU_LACDA Elongation factor Tu OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=tuf PE=3 SV=1 290 621 3.0E-30
sp|B5BEY8|CYSN_SALPK Sulfate adenylyltransferase subunit 1 OS=Salmonella paratyphi A (strain AKU_12601) GN=cysN PE=3 SV=1 290 556 4.0E-30
sp|Q5PEH2|CYSN_SALPA Sulfate adenylyltransferase subunit 1 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=cysN PE=3 SV=1 290 556 4.0E-30
sp|Q826Z7|EFTU2_STRAW Elongation factor Tu 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=tuf2 PE=3 SV=1 290 624 4.0E-30
sp|A2CI56|EFTU_CHLAT Elongation factor Tu, chloroplastic OS=Chlorokybus atmophyticus GN=tufA PE=3 SV=1 290 719 6.0E-30
sp|A0LRL8|EFTU_ACIC1 Elongation factor Tu OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=tuf PE=3 SV=1 290 621 6.0E-30
sp|A7HWP7|EFTU_PARL1 Elongation factor Tu OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=tuf1 PE=3 SV=1 290 621 6.0E-30
sp|Q87SX9|CYSN_VIBPA Sulfate adenylyltransferase subunit 1 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=cysN PE=3 SV=1 288 598 7.0E-30
sp|Q255F3|EFTU_CHLFF Elongation factor Tu OS=Chlamydophila felis (strain Fe/C-56) GN=tuf PE=3 SV=1 290 622 8.0E-30
sp|B5RDQ7|CYSN_SALG2 Sulfate adenylyltransferase subunit 1 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=cysN PE=3 SV=1 290 556 9.0E-30
sp|Q6A6L7|EFTU_PROAC Elongation factor Tu OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=tuf PE=3 SV=1 290 621 9.0E-30
sp|Q5L5H6|EFTU_CHLAB Elongation factor Tu OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=tuf PE=3 SV=1 290 622 1.0E-29
sp|A4XI37|EFTU_CALS8 Elongation factor Tu OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=tuf PE=3 SV=1 290 621 1.0E-29
sp|B9MQH1|EFTU_CALBD Elongation factor Tu OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=tuf PE=3 SV=1 290 621 1.0E-29
sp|A8EW02|EFTU_ARCB4 Elongation factor Tu OS=Arcobacter butzleri (strain RM4018) GN=tuf PE=3 SV=1 290 621 1.0E-29
sp|Q9PD78|CYSNC_XYLFA Bifunctional enzyme CysN/CysC OS=Xylella fastidiosa (strain 9a5c) GN=cysNC PE=3 SV=2 277 556 1.0E-29
sp|A1ST27|CYSN_PSYIN Sulfate adenylyltransferase subunit 1 OS=Psychromonas ingrahamii (strain 37) GN=cysN PE=3 SV=1 276 544 1.0E-29
sp|Q4G342|EFTU_EMIHU Elongation factor Tu, chloroplastic OS=Emiliania huxleyi GN=tufA PE=3 SV=1 290 719 1.0E-29
sp|B5QW22|CYSN_SALEP Sulfate adenylyltransferase subunit 1 OS=Salmonella enteritidis PT4 (strain P125109) GN=cysN PE=3 SV=1 290 556 1.0E-29
sp|Q822I4|EFTU_CHLCV Elongation factor Tu OS=Chlamydophila caviae (strain GPIC) GN=tuf PE=3 SV=3 290 622 1.0E-29
sp|A9MF24|CYSN_SALAR Sulfate adenylyltransferase subunit 1 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=cysN PE=3 SV=1 290 544 2.0E-29
sp|B5FTS9|CYSN_SALDC Sulfate adenylyltransferase subunit 1 OS=Salmonella dublin (strain CT_02021853) GN=cysN PE=3 SV=1 290 556 2.0E-29
sp|B4TFX1|CYSN_SALHS Sulfate adenylyltransferase subunit 1 OS=Salmonella heidelberg (strain SL476) GN=cysN PE=3 SV=1 290 556 2.0E-29
sp|B4TTW5|CYSN_SALSV Sulfate adenylyltransferase subunit 1 OS=Salmonella schwarzengrund (strain CVM19633) GN=cysN PE=3 SV=1 290 556 2.0E-29
sp|B5F415|CYSN_SALA4 Sulfate adenylyltransferase subunit 1 OS=Salmonella agona (strain SL483) GN=cysN PE=3 SV=1 290 556 2.0E-29
sp|A9N2D8|CYSN_SALPB Sulfate adenylyltransferase subunit 1 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=cysN PE=3 SV=1 290 556 2.0E-29
sp|Q21IS6|CYSN_SACD2 Sulfate adenylyltransferase subunit 1 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=cysN PE=3 SV=1 290 544 2.0E-29
sp|Q8Z470|CYSN_SALTI Sulfate adenylyltransferase subunit 1 OS=Salmonella typhi GN=cysN PE=3 SV=1 290 556 2.0E-29
sp|P42482|EFTU_WOLSU Elongation factor Tu OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=tuf PE=3 SV=2 285 621 2.0E-29
sp|Q98QG1|EFTU_MYCPU Elongation factor Tu OS=Mycoplasma pulmonis (strain UAB CTIP) GN=tuf PE=3 SV=1 290 622 2.0E-29
sp|Q9MUP0|EFTU_MESVI Elongation factor Tu, chloroplastic OS=Mesostigma viride GN=tufA PE=3 SV=1 290 719 2.0E-29
sp|A1SNN5|EFTU_NOCSJ Elongation factor Tu OS=Nocardioides sp. (strain BAA-499 / JS614) GN=tuf PE=3 SV=1 290 621 2.0E-29
sp|A5DN78|EFTU_PICGU Elongation factor Tu, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TUF1 PE=3 SV=1 290 604 2.0E-29
sp|B2RL52|EFTU_PORG3 Elongation factor Tu OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=tuf PE=3 SV=1 290 622 3.0E-29
sp|Q8ZMF5|CYSN_SALTY Sulfate adenylyltransferase subunit 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysN PE=3 SV=1 290 556 3.0E-29
sp|P42471|EFTU_BRELN Elongation factor Tu OS=Brevibacterium linens GN=tuf PE=3 SV=1 290 621 3.0E-29
sp|P29544|EFTU3_STRRA Elongation factor Tu-3 OS=Streptomyces ramocissimus GN=tuf3 PE=3 SV=1 290 640 3.0E-29
sp|B8ELG5|EFTU_METSB Elongation factor Tu OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=tuf PE=3 SV=1 290 621 3.0E-29
sp|P56003|EFTU_HELPY Elongation factor Tu OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=tuf PE=3 SV=1 290 621 3.0E-29
sp|B2UUW8|EFTU_HELPS Elongation factor Tu OS=Helicobacter pylori (strain Shi470) GN=tuf PE=3 SV=1 290 621 3.0E-29
sp|A2C4U5|EFTU_PROM1 Elongation factor Tu OS=Prochlorococcus marinus (strain NATL1A) GN=tuf PE=3 SV=1 290 719 4.0E-29
sp|Q07KJ2|EFTU_RHOP5 Elongation factor Tu OS=Rhodopseudomonas palustris (strain BisA53) GN=tuf1 PE=3 SV=1 290 604 4.0E-29
sp|Q20EU5|EFTU_OLTVI Elongation factor Tu, chloroplastic OS=Oltmannsiellopsis viridis GN=tufA PE=3 SV=1 290 621 4.0E-29
sp|B5Z8K3|EFTU_HELPG Elongation factor Tu OS=Helicobacter pylori (strain G27) GN=tuf PE=3 SV=1 290 621 4.0E-29
sp|Q118Z2|EFTU_TRIEI Elongation factor Tu OS=Trichodesmium erythraeum (strain IMS101) GN=tuf PE=3 SV=1 290 719 4.0E-29
sp|Q1KVS9|EFTU_ACUOB Elongation factor Tu, chloroplastic OS=Acutodesmus obliquus GN=tufA PE=3 SV=1 290 719 5.0E-29
sp|P33165|EFTU_BACFR Elongation factor Tu OS=Bacteroides fragilis (strain YCH46) GN=tuf PE=3 SV=1 290 622 5.0E-29
sp|Q5L890|EFTU_BACFN Elongation factor Tu OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=tuf PE=3 SV=1 290 622 5.0E-29
sp|Q1RHL9|EFTU_RICBR Elongation factor Tu OS=Rickettsia bellii (strain RML369-C) GN=tuf PE=3 SV=1 290 621 5.0E-29
sp|A8GVB2|EFTU_RICB8 Elongation factor Tu OS=Rickettsia bellii (strain OSU 85-389) GN=tuf PE=3 SV=1 290 621 5.0E-29
sp|A1WVD6|EFTU2_HALHL Elongation factor Tu 2 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=tuf2 PE=3 SV=1 290 621 5.0E-29
sp|Q6LM69|CYSN_PHOPR Sulfate adenylyltransferase subunit 1 OS=Photobacterium profundum GN=cysN PE=3 SV=1 269 556 6.0E-29
sp|C5BSJ5|CYSN_TERTT Sulfate adenylyltransferase subunit 1 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=cysN PE=3 SV=1 290 556 6.0E-29
sp|A1WVC4|EFTU1_HALHL Elongation factor Tu 1 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=tuf1 PE=3 SV=1 290 621 6.0E-29
sp|P60339|EFTU2_THET8 Elongation factor Tu-B OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=tufB PE=1 SV=2 287 622 6.0E-29
sp|A5D5I8|EFTU2_PELTS Elongation factor Tu 2 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=tuf2 PE=3 SV=1 290 604 6.0E-29
sp|Q5FKR8|EFTU_LACAC Elongation factor Tu OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=tuf PE=3 SV=1 290 622 6.0E-29
sp|Q5HVZ7|EFTU_CAMJR Elongation factor Tu OS=Campylobacter jejuni (strain RM1221) GN=tuf PE=3 SV=1 290 621 7.0E-29
sp|A1VYI6|EFTU_CAMJJ Elongation factor Tu OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=tuf PE=3 SV=1 290 621 7.0E-29
sp|O69303|EFTU_CAMJE Elongation factor Tu OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=tuf PE=3 SV=1 290 621 7.0E-29
sp|A7H4R3|EFTU_CAMJD Elongation factor Tu OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=tuf PE=3 SV=1 290 621 7.0E-29
sp|A8FKQ5|EFTU_CAMJ8 Elongation factor Tu OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=tuf PE=3 SV=1 290 621 7.0E-29
sp|C0PXB1|CYSN_SALPC Sulfate adenylyltransferase subunit 1 OS=Salmonella paratyphi C (strain RKS4594) GN=cysN PE=3 SV=1 290 556 7.0E-29
sp|Q57KJ0|CYSN_SALCH Sulfate adenylyltransferase subunit 1 OS=Salmonella choleraesuis (strain SC-B67) GN=cysN PE=3 SV=1 290 556 7.0E-29
sp|Q8DI42|EFTU_THEEB Elongation factor Tu OS=Thermosynechococcus elongatus (strain BP-1) GN=tuf PE=3 SV=1 290 719 7.0E-29
sp|B4T461|CYSN_SALNS Sulfate adenylyltransferase subunit 1 OS=Salmonella newport (strain SL254) GN=cysN PE=3 SV=1 290 556 7.0E-29
sp|Q4A7K0|EFTU_MYCH7 Elongation factor Tu OS=Mycoplasma hyopneumoniae (strain 7448) GN=tuf PE=3 SV=1 290 622 7.0E-29
sp|Q600B6|EFTU_MYCH2 Elongation factor Tu OS=Mycoplasma hyopneumoniae (strain 232) GN=tuf PE=3 SV=1 290 622 7.0E-29
sp|B0TC54|EFTU_HELMI Elongation factor Tu OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=tuf PE=3 SV=1 290 621 7.0E-29
sp|Q83ES6|EFTU_COXBU Elongation factor Tu OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=tufA PE=1 SV=1 290 621 8.0E-29
sp|A9NAK7|EFTU_COXBR Elongation factor Tu OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=tuf1 PE=3 SV=1 290 621 8.0E-29
sp|A9KD33|EFTU_COXBN Elongation factor Tu OS=Coxiella burnetii (strain Dugway 5J108-111) GN=tuf1 PE=3 SV=1 290 621 8.0E-29
sp|Q01SX2|EFTU_SOLUE Elongation factor Tu OS=Solibacter usitatus (strain Ellin6076) GN=tuf1 PE=3 SV=1 290 604 8.0E-29
sp|B2GIL2|EFTU_KOCRD Elongation factor Tu OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=tuf PE=3 SV=1 290 621 8.0E-29
sp|P13442|NODQ_RHIME Bifunctional enzyme NodQ OS=Rhizobium meliloti (strain 1021) GN=nodQ PE=3 SV=1 284 618 9.0E-29
sp|Q0ID59|EFTU_SYNS3 Elongation factor Tu OS=Synechococcus sp. (strain CC9311) GN=tuf PE=3 SV=1 290 719 9.0E-29
sp|C4Z2R9|EFTU_EUBE2 Elongation factor Tu OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=tuf PE=3 SV=1 290 621 1.0E-28
sp|Q4A9G1|EFTU_MYCHJ Elongation factor Tu OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=tuf PE=3 SV=1 290 622 1.0E-28
sp|Q8A463|EFTU_BACTN Elongation factor Tu OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=tuf PE=3 SV=1 290 622 1.0E-28
sp|A9BCK0|EFTU_PROM4 Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9211) GN=tuf PE=3 SV=1 290 719 1.0E-28
sp|A8YUS2|EFTU_LACH4 Elongation factor Tu OS=Lactobacillus helveticus (strain DPC 4571) GN=tuf PE=3 SV=1 290 621 1.0E-28
sp|B9E8Q0|EFTU_MACCJ Elongation factor Tu OS=Macrococcus caseolyticus (strain JCSC5402) GN=tuf PE=3 SV=1 290 621 1.0E-28
sp|Q9ZT91|EFTM_ARATH Elongation factor Tu, mitochondrial OS=Arabidopsis thaliana GN=TUFA PE=1 SV=1 290 720 1.0E-28
sp|Q01698|EFTU_THEAQ Elongation factor Tu OS=Thermus aquaticus GN=tuf PE=1 SV=2 287 622 1.0E-28
sp|Q3A9R3|EFTU1_CARHZ Elongation factor Tu 1 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=tuf1 PE=3 SV=1 290 604 1.0E-28
sp|Q661E5|EFTU_BORBP Elongation factor Tu OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=tuf PE=3 SV=1 285 604 1.0E-28
sp|Q99QM0|EFTU_CAUCR Elongation factor Tu OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=tufA PE=3 SV=1 290 604 1.0E-28
sp|Q72GW4|EFTU_THET2 Elongation factor Tu OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=tuf1 PE=3 SV=1 287 622 1.0E-28
sp|A9BHA7|EFTU_PETMO Elongation factor Tu OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=tuf PE=3 SV=1 285 719 2.0E-28
sp|Q0SN31|EFTU_BORAP Elongation factor Tu OS=Borrelia afzelii (strain PKo) GN=tuf PE=3 SV=1 285 604 2.0E-28
sp|Q0RRS3|EFTU_FRAAA Elongation factor Tu OS=Frankia alni (strain ACN14a) GN=tuf PE=3 SV=1 290 621 2.0E-28
sp|P72339|NODQ_RHIS3 Bifunctional enzyme NodQ OS=Rhizobium sp. (strain N33) GN=nodQ PE=3 SV=1 290 544 2.0E-28
sp|Q1QN32|EFTU_NITHX Elongation factor Tu OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=tuf PE=3 SV=1 290 604 2.0E-28
sp|B7J241|EFTU_BORBZ Elongation factor Tu OS=Borrelia burgdorferi (strain ZS7) GN=tuf PE=3 SV=1 285 604 2.0E-28
sp|P50062|EFTU_BORBU Elongation factor Tu OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=tuf PE=3 SV=1 285 604 2.0E-28
sp|Q211E6|EFTU_RHOPB Elongation factor Tu OS=Rhodopseudomonas palustris (strain BisB18) GN=tuf PE=3 SV=1 290 604 2.0E-28
sp|B6JN44|EFTU_HELP2 Elongation factor Tu OS=Helicobacter pylori (strain P12) GN=tuf PE=3 SV=1 290 621 2.0E-28
sp|A6KYK9|EFTU_BACV8 Elongation factor Tu OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=tuf PE=3 SV=1 290 622 2.0E-28
sp|A5D5K0|EFTU1_PELTS Elongation factor Tu 1 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=tuf1 PE=3 SV=1 290 604 2.0E-28
sp|A8LC58|EFTU_FRASN Elongation factor Tu OS=Frankia sp. (strain EAN1pec) GN=tuf PE=3 SV=1 290 621 2.0E-28
sp|O50293|EFTU_AQUPY Elongation factor Tu OS=Aquifex pyrophilus GN=tuf PE=3 SV=1 290 621 2.0E-28
sp|A7ZCN0|EFTU_CAMC1 Elongation factor Tu OS=Campylobacter concisus (strain 13826) GN=tuf PE=3 SV=1 290 621 2.0E-28
sp|P17745|EFTU_ARATH Elongation factor Tu, chloroplastic OS=Arabidopsis thaliana GN=TUFA PE=1 SV=1 290 622 3.0E-28
sp|Q2IXR2|EFTU_RHOP2 Elongation factor Tu OS=Rhodopseudomonas palustris (strain HaA2) GN=tuf1 PE=3 SV=1 290 604 3.0E-28
sp|P42473|EFTU_CHLP8 Elongation factor Tu OS=Chlorobaculum parvum (strain NCIB 8327) GN=tuf PE=3 SV=1 290 622 3.0E-28
sp|Q46IW4|EFTU_PROMT Elongation factor Tu OS=Prochlorococcus marinus (strain NATL2A) GN=tuf PE=3 SV=1 290 719 3.0E-28
sp|Q11Q98|EFTU_CYTH3 Elongation factor Tu OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=tuf PE=3 SV=1 290 621 3.0E-28
sp|A6LE88|EFTU_PARD8 Elongation factor Tu OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=tuf PE=3 SV=1 290 622 3.0E-28
sp|A0QS98|EFTU_MYCS2 Elongation factor Tu OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=tuf PE=1 SV=1 290 621 3.0E-28
sp|Q9PK73|EFTU_CHLMU Elongation factor Tu OS=Chlamydia muridarum (strain MoPn / Nigg) GN=tuf PE=3 SV=3 290 622 3.0E-28
sp|P09953|EFTU_MICLU Elongation factor Tu OS=Micrococcus luteus GN=tuf PE=3 SV=1 290 621 3.0E-28
sp|P0CD71|EFTU_CHLTR Elongation factor Tu OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=tuf PE=3 SV=1 290 622 4.0E-28
sp|Q3KM40|EFTU_CHLTA Elongation factor Tu OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=tuf PE=3 SV=1 290 622 4.0E-28
sp|Q7U4D1|EFTU_SYNPX Elongation factor Tu OS=Synechococcus sp. (strain WH8102) GN=tuf PE=3 SV=1 290 719 4.0E-28
sp|B4S5M9|EFTU_PROA2 Elongation factor Tu OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=tuf PE=3 SV=1 285 622 4.0E-28
sp|A7I3U7|EFTU_CAMHC Elongation factor Tu OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=tuf PE=3 SV=1 290 621 4.0E-28
sp|Q87DG7|CYSNC_XYLFT Bifunctional enzyme CysN/CysC OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=cysNC PE=3 SV=1 284 556 4.0E-28
sp|Q73SD1|EFTU_MYCPA Elongation factor Tu OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=tuf PE=3 SV=1 290 621 4.0E-28
sp|A0QL35|EFTU_MYCA1 Elongation factor Tu OS=Mycobacterium avium (strain 104) GN=tuf PE=3 SV=1 290 621 4.0E-28
sp|A0RQJ3|EFTU_CAMFF Elongation factor Tu OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=tuf PE=3 SV=1 290 621 4.0E-28
sp|Q3A9P8|EFTU2_CARHZ Elongation factor Tu 2 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=tuf2 PE=3 SV=1 290 604 4.0E-28
sp|P19457|EFTU_GUITH Elongation factor Tu, chloroplastic OS=Guillardia theta GN=tufA PE=3 SV=1 290 719 4.0E-28
sp|Q9TJQ8|EFTU_PROWI Elongation factor Tu, plastid OS=Prototheca wickerhamii GN=tufA PE=3 SV=1 290 621 4.0E-28
sp|B8DLL9|EFTU_DESVM Elongation factor Tu OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=tuf PE=3 SV=1 290 621 5.0E-28
sp|B0BBV3|EFTU_CHLTB Elongation factor Tu OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=tuf PE=3 SV=1 290 607 5.0E-28
sp|B0B7N8|EFTU_CHLT2 Elongation factor Tu OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=tuf PE=1 SV=1 290 607 5.0E-28
sp|Q2JFH8|EFTU_FRASC Elongation factor Tu OS=Frankia sp. (strain CcI3) GN=tuf PE=3 SV=1 290 621 5.0E-28
sp|P60338|EFTU1_THETH Elongation factor Tu-A OS=Thermus thermophilus GN=tufA PE=1 SV=2 290 622 5.0E-28
sp|Q5SHN6|EFTU1_THET8 Elongation factor Tu-A OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=tufA PE=1 SV=3 290 622 5.0E-28
sp|P30768|EFTU_MYCLE Elongation factor Tu OS=Mycobacterium leprae (strain TN) GN=tuf PE=3 SV=2 290 621 6.0E-28
sp|B8ZSC1|EFTU_MYCLB Elongation factor Tu OS=Mycobacterium leprae (strain Br4923) GN=tuf PE=3 SV=1 290 621 6.0E-28
sp|B3ETZ7|EFTU_AMOA5 Elongation factor Tu OS=Amoebophilus asiaticus (strain 5a2) GN=tuf PE=3 SV=1 290 621 6.0E-28
sp|P42474|EFTU_CELLY Elongation factor Tu OS=Cellulophaga lytica GN=tuf PE=3 SV=1 290 622 6.0E-28
sp|A6W5T5|EFTU_KINRD Elongation factor Tu OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=tuf PE=3 SV=1 290 621 6.0E-28
sp|P22679|EFTU_MYCHP Elongation factor Tu OS=Mycoplasma hominis (strain ATCC 23114 / NBRC 14850 / NCTC 10111 / PG21) GN=tuf PE=1 SV=1 290 719 7.0E-28
sp|B9KFF9|EFTU_CAMLR Elongation factor Tu OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=tuf PE=3 SV=1 290 621 7.0E-28
sp|Q6MDN0|EFTU_PARUW Elongation factor Tu OS=Protochlamydia amoebophila (strain UWE25) GN=tuf PE=3 SV=1 290 604 7.0E-28
sp|Q748X8|EFTU_GEOSL Elongation factor Tu OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=tuf1 PE=3 SV=1 290 621 8.0E-28
sp|Q8UH69|CYSN_AGRFC Sulfate adenylyltransferase subunit 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysN PE=3 SV=1 293 556 8.0E-28
sp|Q04FQ4|EFTU_OENOB Elongation factor Tu OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=tuf PE=3 SV=1 290 621 8.0E-28
sp|Q3J8Q0|EFTU_NITOC Elongation factor Tu OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=tuf1 PE=3 SV=1 290 621 1.0E-27
sp|Q6AP73|EFTU2_DESPS Elongation factor Tu 2 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=tuf2 PE=3 SV=1 290 621 1.0E-27
sp|B1LBP2|EFTU_THESQ Elongation factor Tu OS=Thermotoga sp. (strain RQ2) GN=tuf PE=3 SV=1 285 719 1.0E-27
sp|A5IM81|EFTU_THEP1 Elongation factor Tu OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=tuf PE=3 SV=1 285 719 1.0E-27
sp|Q03F25|EFTU_PEDPA Elongation factor Tu OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=tuf PE=3 SV=1 290 621 1.0E-27
sp|A8G708|EFTU_PROM2 Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9215) GN=tuf PE=3 SV=1 290 719 1.0E-27
sp|B8D9K1|CYSN_BUCA5 Sulfate adenylyltransferase subunit 1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=cysN PE=3 SV=1 299 544 1.0E-27
sp|A7HM54|EFTU_FERNB Elongation factor Tu OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=tuf PE=3 SV=1 285 622 1.0E-27
sp|B3WE38|EFTU_LACCB Elongation factor Tu OS=Lactobacillus casei (strain BL23) GN=tuf PE=3 SV=1 290 621 1.0E-27
sp|Q039K9|EFTU_LACC3 Elongation factor Tu OS=Lactobacillus casei (strain ATCC 334) GN=tuf PE=3 SV=1 290 621 1.0E-27
sp|B6YQ04|EFTU_AZOPC Elongation factor Tu OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=tuf PE=3 SV=1 290 719 1.0E-27
sp|P17746|EFTU_CHLRE Elongation factor Tu, chloroplastic OS=Chlamydomonas reinhardtii GN=tufA PE=3 SV=1 290 719 2.0E-27
sp|P64029|EFTU_STAAW Elongation factor Tu OS=Staphylococcus aureus (strain MW2) GN=tuf PE=3 SV=1 290 621 2.0E-27
sp|A8YZP5|EFTU_STAAT Elongation factor Tu OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=tuf PE=3 SV=1 290 621 2.0E-27
sp|Q6GBT9|EFTU_STAAS Elongation factor Tu OS=Staphylococcus aureus (strain MSSA476) GN=tuf PE=3 SV=1 290 621 2.0E-27
sp|Q6GJC0|EFTU_STAAR Elongation factor Tu OS=Staphylococcus aureus (strain MRSA252) GN=tuf PE=3 SV=1 290 621 2.0E-27
sp|P99152|EFTU_STAAN Elongation factor Tu OS=Staphylococcus aureus (strain N315) GN=tuf PE=1 SV=1 290 621 2.0E-27
sp|P64028|EFTU_STAAM Elongation factor Tu OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=tuf PE=3 SV=1 290 621 2.0E-27
sp|A6QEK0|EFTU_STAAE Elongation factor Tu OS=Staphylococcus aureus (strain Newman) GN=tuf PE=3 SV=1 290 621 2.0E-27
sp|Q5HIC7|EFTU_STAAC Elongation factor Tu OS=Staphylococcus aureus (strain COL) GN=tuf PE=3 SV=1 290 621 2.0E-27
sp|Q2YSB3|EFTU_STAAB Elongation factor Tu OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=tuf PE=3 SV=1 290 621 2.0E-27
sp|A5IQA2|EFTU_STAA9 Elongation factor Tu OS=Staphylococcus aureus (strain JH9) GN=tuf PE=3 SV=1 290 621 2.0E-27
sp|Q2G0N0|EFTU_STAA8 Elongation factor Tu OS=Staphylococcus aureus (strain NCTC 8325) GN=tuf PE=3 SV=1 290 621 2.0E-27
sp|Q2FJ92|EFTU_STAA3 Elongation factor Tu OS=Staphylococcus aureus (strain USA300) GN=tuf PE=3 SV=1 290 621 2.0E-27
sp|A6TZ25|EFTU_STAA2 Elongation factor Tu OS=Staphylococcus aureus (strain JH1) GN=tuf PE=3 SV=1 290 621 2.0E-27
sp|A7WYX6|EFTU_STAA1 Elongation factor Tu OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=tuf PE=3 SV=1 290 621 2.0E-27
sp|Q042T5|EFTU_LACGA Elongation factor Tu OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=tuf PE=3 SV=2 290 719 2.0E-27
sp|P42477|EFTU_HERAU Elongation factor Tu OS=Herpetosiphon aurantiacus GN=tuf PE=3 SV=1 290 622 2.0E-27
sp|Q02WY9|EFTU_LACLS Elongation factor Tu OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=tuf PE=3 SV=1 285 621 2.0E-27
sp|A2RMT1|EFTU_LACLM Elongation factor Tu OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=tuf PE=3 SV=1 285 621 2.0E-27
sp|Q9CEI0|EFTU_LACLA Elongation factor Tu OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=tuf PE=3 SV=1 285 621 2.0E-27
sp|Q9Z9A7|EFTU_CHLPN Elongation factor Tu OS=Chlamydia pneumoniae GN=tuf PE=3 SV=3 290 718 2.0E-27
sp|P17245|EFTU_CYAPA Elongation factor Tu, cyanelle OS=Cyanophora paradoxa GN=tufA PE=3 SV=2 290 719 2.0E-27
sp|B9K884|EFTU_THENN Elongation factor Tu OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=tuf PE=3 SV=1 285 719 2.0E-27
sp|Q8R7T8|EFTU2_CALS4 Elongation factor Tu-B OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=tufB PE=3 SV=1 290 621 2.0E-27
sp|Q134R0|EFTU2_RHOPS Elongation factor Tu 2 OS=Rhodopseudomonas palustris (strain BisB5) GN=tuf2 PE=3 SV=1 290 604 2.0E-27
sp|A6LPP6|EFTU_CLOB8 Elongation factor Tu OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=tuf1 PE=3 SV=1 290 621 2.0E-27
sp|Q74JU6|EFTU_LACJO Elongation factor Tu OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=tuf PE=3 SV=1 290 719 2.0E-27
sp|P18906|EFTU_MYCGA Elongation factor Tu OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=tuf PE=3 SV=1 290 604 2.0E-27
sp|B3QY22|EFTU_CHLT3 Elongation factor Tu OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=tuf PE=3 SV=1 285 621 2.0E-27
sp|Q8R7V2|EFTU1_CALS4 Elongation factor Tu-A OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=tufA PE=3 SV=1 290 621 2.0E-27
sp|Q7VA05|EFTU_PROMA Elongation factor Tu OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=tuf PE=3 SV=1 290 719 2.0E-27
sp|Q134S7|EFTU1_RHOPS Elongation factor Tu 1 OS=Rhodopseudomonas palustris (strain BisB5) GN=tuf1 PE=3 SV=1 290 604 2.0E-27
sp|P13537|EFTU_THEMA Elongation factor Tu OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=tuf PE=3 SV=2 285 719 2.0E-27
sp|Q73PN3|EFTU_TREDE Elongation factor Tu OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=tuf PE=3 SV=1 290 621 3.0E-27
sp|A0L5V8|EFTU_MAGMM Elongation factor Tu OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=tuf1 PE=3 SV=1 290 607 3.0E-27
sp|Q17VM8|EFTU_HELAH Elongation factor Tu OS=Helicobacter acinonychis (strain Sheeba) GN=tuf PE=3 SV=1 290 621 3.0E-27
sp|A1T4L6|EFTU_MYCVP Elongation factor Tu OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=tuf PE=3 SV=1 290 621 3.0E-27
sp|A3PEZ7|EFTU_PROM0 Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9301) GN=tuf PE=3 SV=1 290 719 3.0E-27
sp|P57498|CYSN_BUCAI Sulfate adenylyltransferase subunit 1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=cysN PE=3 SV=1 299 544 3.0E-27
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0032553 ribonucleotide binding No
GO:0016462 pyrophosphatase activity No
GO:0003674 molecular_function No
GO:0032550 purine ribonucleoside binding No
GO:0001883 purine nucleoside binding No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0032549 ribonucleoside binding No
GO:0097159 organic cyclic compound binding No
GO:0019001 guanyl nucleotide binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0016787 hydrolase activity No
GO:0032561 guanyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0001882 nucleoside binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11157
MADLNSWEDDPAAQDEDLSRQAQQQLNVNPQNPAQGQGGFRPNVASFQPTAQTFQPGQAYGGNFMPQYQQQYYQQ
GFYPQYGQQQGFNQYNQGYGGGFSQGYNQGYGGGYPQYGQQTGPQAQQASQPQQPAAPQAAAAAPKQPVAESAAA
TATAPAAKPVLTKEGGTKVLSIGGDTSAAKPKAKVLSIGGSAAPAKDKEEAKAEAKAEPSNKPEAGQKATAVKAI
EKTGEKAGKAAAASKSSGKTSPTPSSGRSSPSGPGEKKVQRDADAVTKDQAADVDQETLKEIYGKEHVNIIFIGH
VDAGKSTLGGSILWSTGMVDERTMEKYKKEAKEIGRESWYLSWVMDLTKEERSKGKTVEVGRGFFETDKRRYSIL
DAPGHKTYVPNMIGGASQADVGILVISARKGEYETGFERGGQTREHAMLAKTQGVNKLIVVINKMDDPTVEWSHE
RYQECTTKLSQFLKGTGYNLKTDVYFMPVAAQQSLNIKDRIPKGVAPWWDGPSLLEYLDNMKALERKVNAPFMMP
VNAKYRDMGTMVDGKIEAGVVKKGMNLVMMPRKQAVEAAALYGEQEEEVPILQCGDQVRLRLKGIEEEDILPGFV
LCSPKRLVHCVAEFEAQIRILELKSILSSGFNCVLHVHSAIEEVTFAALLHKLQKGTNRKSKVPPTHAKKGDSII
ARMQVIGGAGSVCVEKFEDYPQMGRFTLRDQGQTIAIGKITKLITDEAN*
Coding >Hirsu2|11157
ATGGCCGACCTCAATTCGTGGGAGGATGACCCTGCTGCTCAGGACGAGGACCTCTCGAGACAAGCGCAGCAGCAG
CTGAACGTGAACCCGCAGAACCCTGCCCAAGGCCAAGGTGGCTTTCGCCCGAATGTCGCTTCGTTCCAACCGACC
GCCCAGACTTTCCAGCCTGGGCAAGCCTACGGGGGAAACTTCATGCCCCAGTACCAGCAACAATACTACCAGCAG
GGATTCTACCCTCAGTACGGCCAGCAACAGGGCTTCAACCAGTATAACCAAGGATACGGTGGTGGCTTCAGCCAA
GGCTACAACCAAGGCTACGGCGGAGGATATCCCCAGTACGGCCAGCAGACTGGCCCCCAGGCCCAGCAAGCGTCA
CAGCCTCAGCAGCCCGCGGCTCCCCAAGCAGCCGCCGCAGCCCCGAAGCAACCCGTGGCCGAAAGCGCTGCCGCG
ACCGCGACGGCGCCCGCAGCCAAGCCTGTCTTAACGAAAGAAGGCGGCACCAAGGTGCTCAGCATCGGCGGCGAC
ACATCCGCGGCGAAGCCCAAGGCCAAGGTCTTGTCGATTGGGGGAAGCGCGGCGCCCGCCAAGGACAAGGAAGAG
GCCAAGGCCGAGGCCAAGGCCGAGCCATCTAACAAGCCCGAAGCTGGACAAAAGGCCACGGCAGTCAAGGCCATC
GAGAAGACGGGCGAGAAGGCAGGCAAAGCGGCGGCGGCGTCTAAGTCGTCGGGCAAGACATCACCGACCCCCTCA
TCCGGTCGCTCCAGCCCCTCCGGCCCGGGAGAGAAGAAGGTGCAGCGCGATGCCGACGCGGTCACTAAGGATCAG
GCTGCGGACGTGGACCAAGAGACTCTCAAGGAAATCTACGGCAAGGAGCACGTAAACATCATCTTCATCGGCCAC
GTCGACGCCGGCAAATCAACCCTGGGCGGCTCCATCCTCTGGAGCACCGGTATGGTGGACGAGAGAACCATGGAA
AAGTACAAGAAGGAGGCAAAGGAAATCGGACGTGAGTCTTGGTATCTGTCCTGGGTCATGGACCTGACCAAGGAG
GAGCGATCCAAGGGCAAGACGGTCGAGGTCGGCAGGGGCTTCTTCGAGACGGACAAGCGGAGATACAGCATCCTG
GACGCTCCAGGCCACAAGACGTACGTCCCGAACATGATTGGAGGGGCGTCGCAAGCCGATGTCGGCATCCTGGTC
ATCTCGGCTCGCAAGGGTGAGTACGAGACGGGATTCGAGCGCGGAGGACAGACTCGTGAGCATGCCATGCTCGCC
AAGACCCAGGGCGTCAACAAGCTGATCGTCGTCATCAACAAGATGGATGATCCGACGGTGGAGTGGTCTCACGAG
CGATACCAGGAGTGCACGACGAAGCTGTCGCAGTTCTTGAAGGGCACCGGCTACAACCTGAAGACGGACGTCTAC
TTCATGCCGGTGGCAGCCCAGCAGTCGCTCAACATCAAGGACAGGATCCCCAAGGGCGTGGCGCCTTGGTGGGAC
GGCCCATCGCTGCTGGAGTATCTCGACAACATGAAGGCGCTGGAGCGCAAGGTCAACGCGCCCTTCATGATGCCG
GTCAATGCCAAGTACCGCGACATGGGCACAATGGTCGACGGCAAGATCGAGGCCGGGGTGGTGAAGAAGGGGATG
AACCTGGTGATGATGCCGCGCAAGCAAGCCGTCGAAGCGGCCGCCCTGTACGGCGAGCAGGAAGAGGAGGTGCCG
ATCCTGCAGTGCGGCGACCAGGTGCGGCTACGACTGAAGGGCATCGAGGAGGAAGACATCCTGCCCGGCTTCGTG
CTGTGCTCTCCGAAGAGACTGGTGCACTGCGTGGCGGAATTCGAGGCGCAGATCCGCATCCTGGAGCTGAAGAGC
ATCCTGTCGTCGGGCTTCAACTGCGTGCTGCACGTGCACTCGGCCATCGAGGAGGTCACGTTCGCGGCTCTGCTG
CACAAGCTGCAGAAGGGAACCAACCGGAAGAGCAAAGTCCCGCCCACGCACGCCAAGAAGGGCGACAGCATCATT
GCACGGATGCAGGTGATTGGCGGGGCCGGGTCTGTGTGCGTGGAGAAATTCGAGGACTACCCCCAGATGGGTCGT
TTCACGCTGCGAGATCAGGGGCAAACGATTGCCATTGGAAAGATTACGAAGCTCATCACGGACGAGGCGAATTAA
Transcript >Hirsu2|11157
ATGGCCGACCTCAATTCGTGGGAGGATGACCCTGCTGCTCAGGACGAGGACCTCTCGAGACAAGCGCAGCAGCAG
CTGAACGTGAACCCGCAGAACCCTGCCCAAGGCCAAGGTGGCTTTCGCCCGAATGTCGCTTCGTTCCAACCGACC
GCCCAGACTTTCCAGCCTGGGCAAGCCTACGGGGGAAACTTCATGCCCCAGTACCAGCAACAATACTACCAGCAG
GGATTCTACCCTCAGTACGGCCAGCAACAGGGCTTCAACCAGTATAACCAAGGATACGGTGGTGGCTTCAGCCAA
GGCTACAACCAAGGCTACGGCGGAGGATATCCCCAGTACGGCCAGCAGACTGGCCCCCAGGCCCAGCAAGCGTCA
CAGCCTCAGCAGCCCGCGGCTCCCCAAGCAGCCGCCGCAGCCCCGAAGCAACCCGTGGCCGAAAGCGCTGCCGCG
ACCGCGACGGCGCCCGCAGCCAAGCCTGTCTTAACGAAAGAAGGCGGCACCAAGGTGCTCAGCATCGGCGGCGAC
ACATCCGCGGCGAAGCCCAAGGCCAAGGTCTTGTCGATTGGGGGAAGCGCGGCGCCCGCCAAGGACAAGGAAGAG
GCCAAGGCCGAGGCCAAGGCCGAGCCATCTAACAAGCCCGAAGCTGGACAAAAGGCCACGGCAGTCAAGGCCATC
GAGAAGACGGGCGAGAAGGCAGGCAAAGCGGCGGCGGCGTCTAAGTCGTCGGGCAAGACATCACCGACCCCCTCA
TCCGGTCGCTCCAGCCCCTCCGGCCCGGGAGAGAAGAAGGTGCAGCGCGATGCCGACGCGGTCACTAAGGATCAG
GCTGCGGACGTGGACCAAGAGACTCTCAAGGAAATCTACGGCAAGGAGCACGTAAACATCATCTTCATCGGCCAC
GTCGACGCCGGCAAATCAACCCTGGGCGGCTCCATCCTCTGGAGCACCGGTATGGTGGACGAGAGAACCATGGAA
AAGTACAAGAAGGAGGCAAAGGAAATCGGACGTGAGTCTTGGTATCTGTCCTGGGTCATGGACCTGACCAAGGAG
GAGCGATCCAAGGGCAAGACGGTCGAGGTCGGCAGGGGCTTCTTCGAGACGGACAAGCGGAGATACAGCATCCTG
GACGCTCCAGGCCACAAGACGTACGTCCCGAACATGATTGGAGGGGCGTCGCAAGCCGATGTCGGCATCCTGGTC
ATCTCGGCTCGCAAGGGTGAGTACGAGACGGGATTCGAGCGCGGAGGACAGACTCGTGAGCATGCCATGCTCGCC
AAGACCCAGGGCGTCAACAAGCTGATCGTCGTCATCAACAAGATGGATGATCCGACGGTGGAGTGGTCTCACGAG
CGATACCAGGAGTGCACGACGAAGCTGTCGCAGTTCTTGAAGGGCACCGGCTACAACCTGAAGACGGACGTCTAC
TTCATGCCGGTGGCAGCCCAGCAGTCGCTCAACATCAAGGACAGGATCCCCAAGGGCGTGGCGCCTTGGTGGGAC
GGCCCATCGCTGCTGGAGTATCTCGACAACATGAAGGCGCTGGAGCGCAAGGTCAACGCGCCCTTCATGATGCCG
GTCAATGCCAAGTACCGCGACATGGGCACAATGGTCGACGGCAAGATCGAGGCCGGGGTGGTGAAGAAGGGGATG
AACCTGGTGATGATGCCGCGCAAGCAAGCCGTCGAAGCGGCCGCCCTGTACGGCGAGCAGGAAGAGGAGGTGCCG
ATCCTGCAGTGCGGCGACCAGGTGCGGCTACGACTGAAGGGCATCGAGGAGGAAGACATCCTGCCCGGCTTCGTG
CTGTGCTCTCCGAAGAGACTGGTGCACTGCGTGGCGGAATTCGAGGCGCAGATCCGCATCCTGGAGCTGAAGAGC
ATCCTGTCGTCGGGCTTCAACTGCGTGCTGCACGTGCACTCGGCCATCGAGGAGGTCACGTTCGCGGCTCTGCTG
CACAAGCTGCAGAAGGGAACCAACCGGAAGAGCAAAGTCCCGCCCACGCACGCCAAGAAGGGCGACAGCATCATT
GCACGGATGCAGGTGATTGGCGGGGCCGGGTCTGTGTGCGTGGAGAAATTCGAGGACTACCCCCAGATGGGTCGT
TTCACGCTGCGAGATCAGGGGCAAACGATTGCCATTGGAAAGATTACGAAGCTCATCACGGACGAGGCGAATTAA
Gene >Hirsu2|11157
ATGGCCGACCTCAATTCGTGGGAGGATGACCCTGCTGCTCAGGACGAGGACCTCTCGAGACAAGCGCAGCAGCAG
CTGAACGTGAACCCGCAGAACCCTGCCCAAGGCCAAGGTGGCTTTCGCCCGAATGTCGCTTCGTTCCAACCGACC
GCCCAGACTTTCCAGCCTGGGCAAGCCTACGGGGGAAACTTCATGCCCCAGTACCAGCAACAATACTACCAGCAG
GGATTCTACCCTCAGTACGGCCAGCAACAGGGCTTCAACCAGTATAACCAAGGATACGGTGGTGGCTTCAGCCAA
GGCTACAACCAAGGCTACGGTTCGTCCACAGCCGCCTGTCGAGACCTATCCGACCGAACTGACTGACCTTTCTAG
GCGGAGGATATCCCCAGTACGGCCAGCAGACTGGCCCCCAGGCCCAGCAAGCGTCACAGCCTCAGCAGCCCGCGG
CTCCCCAAGCAGCCGCCGCAGCCCCGAAGCAACCCGTGGCCGAAAGCGCTGCCGCGACCGCGACGGCGCCCGCAG
CCAAGCCTGTCTTAACGAAAGAAGGCGGCACCAAGGTGCTCAGCATCGGCGGCGACACATCCGCGGCGAAGCCCA
AGGCCAAGGTCTTGTCGATTGGGGGAAGCGCGGCGCCCGCCAAGGACAAGGAAGAGGCCAAGGCCGAGGCCAAGG
CCGAGCCATCTAACAAGCCCGAAGCTGGACAAAAGGCCACGGCAGTCAAGGCCATCGAGAAGACGGGCGAGAAGG
CAGGCAAAGCGGCGGCGGCGTCTAAGTCGTCGGGCAAGACATCACCGACCCCCTCATCCGGTCGCTCCAGCCCCT
CCGGCCCGGGAGAGAAGAAGGTGCAGCGCGATGCCGACGCGGTCACTAAGGATCAGGCTGCGGACGTGGACCAAG
AGACTCTCAAGGAAATCTACGGCAAGGAGCACGTAAACATCATCTTCATCGGCCACGTCGACGCCGGCAAATCAA
CCCTGGGCGGCTCCATCCTCTGGAGCACCGGTATGGTGGACGAGAGAACCATGGAAAAGTACAAGAAGGAGGCAA
AGGAAATCGGACGTGAGTCTTGGTATCTGTCCTGGGTCATGGACCTGACCAAGGAGGAGCGATCCAAGGGCAAGA
CGGTCGAGGTCGGCAGGGGCTTCTTCGAGACGGACAAGCGGAGATACAGCATCCTGGACGCTCCAGGCCACAAGA
CGTACGTCCCGAACATGATTGGAGGGGCGTCGCAAGCCGATGTCGGCATCCTGGTCATCTCGGCTCGCAAGGGTG
AGTACGAGACGGGATTCGAGCGCGGAGGACAGACTCGTGAGCATGCCATGCTCGCCAAGACCCAGGGCGTCAACA
AGCTGATCGTCGTCATCAACAAGATGGATGATCCGACGGTGGAGTGGTCTCACGAGCGATACCAGGAGTGCACGA
CGAAGCTGTCGCAGTTCTTGAAGGGCACCGGCTACAACCTGAAGACGGACGTCTACTTCATGCCGGTGGCAGCCC
AGCAGTCGCTCAACATCAAGGACAGGATCCCCAAGGGCGTGGCGCCTTGGTGGGACGGCCCATCGCTGCTGGAGT
ATCTCGACAACATGAAGGCGCTGGAGCGCAAGGTCAACGCGCCCTTCATGATGCCGGTCAATGCCAAGTACCGCG
ACATGGGCACAATGGTCGACGGCAAGATCGAGGCCGGGGTGGTGAAGAAGGGGATGAACCTGGTGATGATGCCGC
GCAAGCAAGCCGTCGAAGCGGCCGCCCTGTACGGCGAGCAGGAAGAGGAGGTGCCGATCCTGCAGTGCGGCGACC
AGGTGCGGCTACGACTGAAGGGCATCGAGGAGGAAGACATCCTGCCCGGCTTCGTGCTGTGCTCTCCGAAGAGAC
TGGTGCACTGCGTGGCGGAATTCGAGGCGCAGATCCGCATCCTGGAGCTGAAGAGCATCCTGTCGTCGGGCTTCA
ACTGCGTGCTGCACGTGCACTCGGCCATCGAGGAGGTCACGTTCGCGGCTCTGCTGCACAAGCTGCAGAAGGGAA
CCAACCGGAAGAGCAAAGTCCCGCCCACGCACGCCAAGAAGGGCGACAGCATCATTGCACGGATGCAGGTGATTG
GCGGGGCCGGGTCTGTGTGCGTGGAGAAATTCGAGGACTACCCCCAGATGGGTCGTTTCACGCTGCGAGATCAGG
TACGTATGGGGTCGGCAGGTTGAGCCGACGCGATCTACGTCAGTGGACAAGGACGGAGACGACCGAGGTGCTGAC
GTCTTTGTCTTTTTCTGTCTAGGGGCAAACGATTGCCATTGGAAAGATTACGAAGCTCATCACGGACGAGGCGAA
TTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail