Protein ID | Hirsu2|1115 |
Gene name | |
Location | Contig_1234:4998..6182 |
Strand | - |
Gene length (bp) | 1184 |
Transcript length (bp) | 1011 |
Coding sequence length (bp) | 1011 |
Protein length (aa) | 337 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF00400 | WD40 | WD domain, G-beta repeat | 1.7E-07 | 43 | 79 |
PF00400 | WD40 | WD domain, G-beta repeat | 9.7E-02 | 282 | 314 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q2GTM8|EIF3I_CHAGB | Eukaryotic translation initiation factor 3 subunit I OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=TIF34 PE=3 SV=1 | 1 | 336 | 0.0E+00 |
sp|Q7RXH4|EIF3I_NEUCR | Eukaryotic translation initiation factor 3 subunit I OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tif-34 PE=3 SV=1 | 1 | 336 | 0.0E+00 |
sp|A4RDD7|EIF3I_MAGO7 | Eukaryotic translation initiation factor 3 subunit I OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TIF34 PE=3 SV=1 | 1 | 336 | 0.0E+00 |
sp|A7EF03|EIF3I_SCLS1 | Eukaryotic translation initiation factor 3 subunit I OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=tif34 PE=3 SV=1 | 1 | 331 | 0.0E+00 |
sp|A6RUL1|EIF3I_BOTFB | Eukaryotic translation initiation factor 3 subunit I OS=Botryotinia fuckeliana (strain B05.10) GN=tif34 PE=3 SV=1 | 1 | 331 | 0.0E+00 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q2GTM8|EIF3I_CHAGB | Eukaryotic translation initiation factor 3 subunit I OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=TIF34 PE=3 SV=1 | 1 | 336 | 0.0E+00 |
sp|Q7RXH4|EIF3I_NEUCR | Eukaryotic translation initiation factor 3 subunit I OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tif-34 PE=3 SV=1 | 1 | 336 | 0.0E+00 |
sp|A4RDD7|EIF3I_MAGO7 | Eukaryotic translation initiation factor 3 subunit I OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TIF34 PE=3 SV=1 | 1 | 336 | 0.0E+00 |
sp|A7EF03|EIF3I_SCLS1 | Eukaryotic translation initiation factor 3 subunit I OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=tif34 PE=3 SV=1 | 1 | 331 | 0.0E+00 |
sp|A6RUL1|EIF3I_BOTFB | Eukaryotic translation initiation factor 3 subunit I OS=Botryotinia fuckeliana (strain B05.10) GN=tif34 PE=3 SV=1 | 1 | 331 | 0.0E+00 |
sp|Q2UQ34|EIF3I_ASPOR | Eukaryotic translation initiation factor 3 subunit I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tif34 PE=3 SV=1 | 1 | 335 | 0.0E+00 |
sp|Q0CXH9|EIF3I_ASPTN | Eukaryotic translation initiation factor 3 subunit I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=tif34 PE=3 SV=1 | 1 | 335 | 0.0E+00 |
sp|Q1DPU4|EIF3I_COCIM | Eukaryotic translation initiation factor 3 subunit I OS=Coccidioides immitis (strain RS) GN=TIF34 PE=3 SV=1 | 1 | 335 | 0.0E+00 |
sp|A1D7I5|EIF3I_NEOFI | Eukaryotic translation initiation factor 3 subunit I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=tif34 PE=3 SV=1 | 1 | 335 | 0.0E+00 |
sp|Q5B8Y3|EIF3I_EMENI | Eukaryotic translation initiation factor 3 subunit I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tif34 PE=3 SV=1 | 1 | 335 | 0.0E+00 |
sp|Q4WX90|EIF3I_ASPFU | Eukaryotic translation initiation factor 3 subunit I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tif34 PE=3 SV=1 | 1 | 335 | 0.0E+00 |
sp|B0XYC8|EIF3I_ASPFC | Eukaryotic translation initiation factor 3 subunit I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=tif34 PE=3 SV=1 | 1 | 335 | 0.0E+00 |
sp|A1CJY4|EIF3I_ASPCL | Eukaryotic translation initiation factor 3 subunit I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=tif34 PE=3 SV=1 | 1 | 335 | 1.0E-178 |
sp|A2QEV8|EIF3I_ASPNC | Eukaryotic translation initiation factor 3 subunit I OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=tif34 PE=3 SV=1 | 1 | 335 | 4.0E-173 |
sp|Q0V320|EIF3I_PHANO | Eukaryotic translation initiation factor 3 subunit I OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=TIF34 PE=3 SV=2 | 1 | 333 | 5.0E-160 |
sp|P79083|EIF3I_SCHPO | Eukaryotic translation initiation factor 3 subunit I OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sum1 PE=1 SV=1 | 1 | 328 | 1.0E-150 |
sp|Q6CI08|EIF3I_YARLI | Eukaryotic translation initiation factor 3 subunit I OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TIF34 PE=3 SV=1 | 1 | 330 | 8.0E-147 |
sp|A5DGL8|EIF3I_PICGU | Eukaryotic translation initiation factor 3 subunit I OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TIF34 PE=3 SV=2 | 1 | 330 | 2.0E-131 |
sp|Q6BSL7|EIF3I_DEBHA | Eukaryotic translation initiation factor 3 subunit I OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TIF34 PE=3 SV=1 | 1 | 330 | 2.0E-130 |
sp|A3LX18|EIF3I_PICST | Eukaryotic translation initiation factor 3 subunit I OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=TIF34 PE=3 SV=1 | 1 | 335 | 3.0E-129 |
sp|A5DVY3|EIF3I_LODEL | Eukaryotic translation initiation factor 3 subunit I OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=TIF34 PE=3 SV=1 | 1 | 330 | 3.0E-128 |
sp|Q5AI86|EIF3I_CANAL | Eukaryotic translation initiation factor 3 subunit I OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TIF34 PE=3 SV=1 | 1 | 327 | 7.0E-128 |
sp|Q4P6E2|EIF3I_USTMA | Eukaryotic translation initiation factor 3 subunit I OS=Ustilago maydis (strain 521 / FGSC 9021) GN=TIF34 PE=3 SV=2 | 1 | 323 | 2.0E-127 |
sp|A7TH19|EIF3I_VANPO | Eukaryotic translation initiation factor 3 subunit I OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=TIF34 PE=3 SV=1 | 1 | 330 | 3.0E-127 |
sp|Q6CKX3|EIF3I_KLULA | Eukaryotic translation initiation factor 3 subunit I OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TIF34 PE=3 SV=1 | 1 | 330 | 1.0E-122 |
sp|E3LB80|EIF3I_PUCGT | Eukaryotic translation initiation factor 3 subunit I OS=Puccinia graminis f. sp. tritici (strain CRL 75-36-700-3 / race SCCL) GN=TIF34 PE=3 SV=2 | 1 | 322 | 4.0E-122 |
sp|P40217|EIF3I_YEAST | Eukaryotic translation initiation factor 3 subunit I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIF34 PE=1 SV=1 | 1 | 330 | 8.0E-121 |
sp|A6ZMK5|EIF3I_YEAS7 | Eukaryotic translation initiation factor 3 subunit I OS=Saccharomyces cerevisiae (strain YJM789) GN=TIF34 PE=3 SV=1 | 1 | 330 | 8.0E-121 |
sp|P0CS32|EIF3I_CRYNJ | Eukaryotic translation initiation factor 3 subunit I OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TIF34 PE=3 SV=1 | 1 | 322 | 2.0E-118 |
sp|P0CS33|EIF3I_CRYNB | Eukaryotic translation initiation factor 3 subunit I OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TIF34 PE=3 SV=1 | 1 | 322 | 2.0E-118 |
sp|Q6FL15|EIF3I_CANGA | Eukaryotic translation initiation factor 3 subunit I OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TIF34 PE=3 SV=1 | 1 | 330 | 5.0E-118 |
sp|Q759L2|EIF3I_ASHGO | Eukaryotic translation initiation factor 3 subunit I OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TIF34 PE=3 SV=1 | 1 | 330 | 4.0E-115 |
sp|Q5EBE8|EIF3I_XENTR | Eukaryotic translation initiation factor 3 subunit I OS=Xenopus tropicalis GN=eif3i PE=2 SV=1 | 1 | 327 | 6.0E-115 |
sp|Q66J51|EIF3I_XENLA | Eukaryotic translation initiation factor 3 subunit I OS=Xenopus laevis GN=eif3i PE=2 SV=1 | 1 | 327 | 5.0E-114 |
sp|B5FZ19|EIF3I_TAEGU | Eukaryotic translation initiation factor 3 subunit I OS=Taeniopygia guttata GN=EIF3I PE=2 SV=2 | 1 | 327 | 1.0E-113 |
sp|B0BNA7|EIF3I_RAT | Eukaryotic translation initiation factor 3 subunit I OS=Rattus norvegicus GN=Eif3i PE=2 SV=1 | 1 | 327 | 3.0E-113 |
sp|Q9QZD9|EIF3I_MOUSE | Eukaryotic translation initiation factor 3 subunit I OS=Mus musculus GN=Eif3i PE=1 SV=1 | 1 | 327 | 7.0E-113 |
sp|Q5E966|EIF3I_BOVIN | Eukaryotic translation initiation factor 3 subunit I OS=Bos taurus GN=EIF3I PE=2 SV=1 | 1 | 327 | 2.0E-112 |
sp|Q13347|EIF3I_HUMAN | Eukaryotic translation initiation factor 3 subunit I OS=Homo sapiens GN=EIF3I PE=1 SV=1 | 1 | 327 | 2.0E-112 |
sp|Q7ZV55|EIF3I_DANRE | Eukaryotic translation initiation factor 3 subunit I OS=Danio rerio GN=eif3i PE=2 SV=1 | 1 | 327 | 3.0E-111 |
sp|Q5R7R2|EIF3I_PONAB | Eukaryotic translation initiation factor 3 subunit I OS=Pongo abelii GN=EIF3I PE=2 SV=1 | 1 | 327 | 4.0E-111 |
sp|Q5IH81|EIF3I_RABIT | Eukaryotic translation initiation factor 3 subunit I OS=Oryctolagus cuniculus GN=EIF3I PE=2 SV=1 | 1 | 327 | 1.0E-108 |
sp|A7RM20|EIF3I_NEMVE | Eukaryotic translation initiation factor 3 subunit I OS=Nematostella vectensis GN=v1g239264 PE=3 SV=1 | 1 | 327 | 1.0E-106 |
sp|Q16K15|EIF3I_AEDAE | Eukaryotic translation initiation factor 3 subunit I OS=Aedes aegypti GN=AAEL013144 PE=3 SV=1 | 1 | 327 | 9.0E-105 |
sp|Q1HPW4|EIF3I_BOMMO | Eukaryotic translation initiation factor 3 subunit I OS=Bombyx mori PE=2 SV=1 | 1 | 331 | 3.0E-103 |
sp|B0XFT7|EIF3I_CULQU | Eukaryotic translation initiation factor 3 subunit I OS=Culex quinquefasciatus GN=CPIJ018275 PE=3 SV=1 | 1 | 327 | 3.0E-102 |
sp|B4JB43|EIF3I_DROGR | Eukaryotic translation initiation factor 3 subunit I OS=Drosophila grimshawi GN=Trip1 PE=3 SV=1 | 1 | 327 | 5.0E-96 |
sp|B3N4C7|EIF3I_DROER | Eukaryotic translation initiation factor 3 subunit I OS=Drosophila erecta GN=Trip1 PE=3 SV=1 | 1 | 327 | 8.0E-96 |
sp|B4I195|EIF3I_DROSE | Eukaryotic translation initiation factor 3 subunit I OS=Drosophila sechellia GN=Trip1 PE=3 SV=1 | 1 | 327 | 1.0E-95 |
sp|O02195|EIF3I_DROME | Eukaryotic translation initiation factor 3 subunit I OS=Drosophila melanogaster GN=Trip1 PE=1 SV=1 | 1 | 327 | 1.0E-95 |
sp|B4Q354|EIF3I_DROSI | Eukaryotic translation initiation factor 3 subunit I OS=Drosophila simulans GN=Trip1 PE=3 SV=1 | 1 | 327 | 3.0E-95 |
sp|Q29L19|EIF3I_DROPS | Eukaryotic translation initiation factor 3 subunit I OS=Drosophila pseudoobscura pseudoobscura GN=Trip1 PE=3 SV=2 | 1 | 327 | 1.0E-94 |
sp|B4GSH1|EIF3I_DROPE | Eukaryotic translation initiation factor 3 subunit I OS=Drosophila persimilis GN=Trip1 PE=3 SV=1 | 1 | 327 | 1.0E-94 |
sp|Q7PP77|EIF3I_ANOGA | Eukaryotic translation initiation factor 3 subunit I OS=Anopheles gambiae GN=AGAP006607 PE=3 SV=4 | 1 | 327 | 1.0E-92 |
sp|B4NW98|EIF3I_DROYA | Eukaryotic translation initiation factor 3 subunit I OS=Drosophila yakuba GN=Trip1 PE=3 SV=2 | 5 | 327 | 2.0E-92 |
sp|B4LUA5|EIF3I_DROVI | Eukaryotic translation initiation factor 3 subunit I OS=Drosophila virilis GN=Trip1 PE=3 SV=2 | 5 | 327 | 9.0E-92 |
sp|B4KGX9|EIF3I_DROMO | Eukaryotic translation initiation factor 3 subunit I OS=Drosophila mojavensis GN=Trip1 PE=3 SV=1 | 5 | 327 | 1.0E-91 |
sp|B3MVL6|EIF3I_DROAN | Eukaryotic translation initiation factor 3 subunit I OS=Drosophila ananassae GN=Trip1 PE=3 SV=2 | 5 | 327 | 2.0E-91 |
sp|B4N0L0|EIF3I_DROWI | Eukaryotic translation initiation factor 3 subunit I OS=Drosophila willistoni GN=Trip1 PE=3 SV=1 | 5 | 327 | 3.0E-90 |
sp|A8QBF3|EIF3I_BRUMA | Eukaryotic translation initiation factor 3 subunit I OS=Brugia malayi GN=Bm1_48300 PE=3 SV=1 | 1 | 327 | 4.0E-88 |
sp|A8WVX8|EIF3I_CAEBR | Eukaryotic translation initiation factor 3 subunit I OS=Caenorhabditis briggsae GN=eif-3.I PE=3 SV=1 | 1 | 327 | 4.0E-85 |
sp|Q965S8|EIF3I_CAEEL | Eukaryotic translation initiation factor 3 subunit I OS=Caenorhabditis elegans GN=eif-3.I PE=3 SV=2 | 1 | 327 | 5.0E-84 |
sp|Q38884|EIF3I_ARATH | Eukaryotic translation initiation factor 3 subunit I OS=Arabidopsis thaliana GN=TIF3I1 PE=2 SV=2 | 1 | 323 | 7.0E-81 |
sp|Q54MT0|EIF3I_DICDI | Eukaryotic translation initiation factor 3 subunit I OS=Dictyostelium discoideum GN=eif3I PE=3 SV=1 | 1 | 324 | 1.0E-74 |
sp|Q54LT8|STRAP_DICDI | Serine-threonine kinase receptor-associated protein OS=Dictyostelium discoideum GN=strap PE=3 SV=1 | 2 | 314 | 2.0E-21 |
sp|Q5ZL33|STRAP_CHICK | Serine-threonine kinase receptor-associated protein OS=Gallus gallus GN=STRAP PE=2 SV=2 | 3 | 314 | 3.0E-16 |
sp|Q5E959|STRAP_BOVIN | Serine-threonine kinase receptor-associated protein OS=Bos taurus GN=STRAP PE=2 SV=1 | 3 | 314 | 3.0E-16 |
sp|Q5XIG8|STRAP_RAT | Serine-threonine kinase receptor-associated protein OS=Rattus norvegicus GN=Strap PE=1 SV=1 | 3 | 314 | 7.0E-16 |
sp|Q9Y3F4|STRAP_HUMAN | Serine-threonine kinase receptor-associated protein OS=Homo sapiens GN=STRAP PE=1 SV=1 | 3 | 314 | 8.0E-16 |
sp|Q9Z1Z2|STRAP_MOUSE | Serine-threonine kinase receptor-associated protein OS=Mus musculus GN=Strap PE=1 SV=2 | 3 | 314 | 9.0E-16 |
sp|Q5M786|WDR5_XENTR | WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 | 6 | 209 | 5.0E-14 |
sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 8 | 314 | 5.0E-14 |
sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 6 | 334 | 6.0E-14 |
sp|Q498M4|WDR5_RAT | WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 | 6 | 209 | 1.0E-13 |
sp|P61965|WDR5_MOUSE | WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 | 6 | 209 | 1.0E-13 |
sp|P61964|WDR5_HUMAN | WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 | 6 | 209 | 1.0E-13 |
sp|Q2KIG2|WDR5_BOVIN | WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 | 6 | 209 | 2.0E-13 |
sp|Q9M2Z2|WDR5A_ARATH | COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 | 6 | 110 | 4.0E-13 |
sp|Q9V3J8|WDS_DROME | Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 | 6 | 209 | 1.0E-12 |
sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 5 | 108 | 2.0E-12 |
sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 6 | 322 | 2.0E-12 |
sp|Q9USN3|UTP13_SCHPO | Probable U3 small nucleolar RNA-associated protein 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp13 PE=3 SV=3 | 6 | 109 | 2.0E-12 |
sp|Q8N136|DAW1_HUMAN | Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 | 5 | 314 | 2.0E-12 |
sp|Q0P593|DAW1_BOVIN | Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 | 5 | 314 | 4.0E-12 |
sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 8 | 108 | 7.0E-12 |
sp|Q9D7H2|WDR5B_MOUSE | WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 | 6 | 247 | 1.0E-11 |
sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 6 | 320 | 2.0E-11 |
sp|Q5BK30|DAW1_RAT | Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 | 5 | 314 | 2.0E-11 |
sp|Q5XGI5|WDR83_XENTR | WD repeat domain-containing protein 83 OS=Xenopus tropicalis GN=wdr83 PE=2 SV=1 | 6 | 229 | 2.0E-11 |
sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 5 | 320 | 3.0E-11 |
sp|Q4R8E7|DAW1_MACFA | Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 | 5 | 314 | 3.0E-11 |
sp|Q8JZX3|POC1A_MOUSE | POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 | 6 | 314 | 3.0E-11 |
sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 6 | 318 | 4.0E-11 |
sp|Q4V8C4|WDR5B_RAT | WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 | 4 | 229 | 4.0E-11 |
sp|Q54KL5|WDR5_DICDI | WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 | 6 | 106 | 4.0E-11 |
sp|Q00808|HETE1_PODAS | Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 | 6 | 314 | 5.0E-11 |
sp|Q2TBP4|POC1A_BOVIN | POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 | 6 | 335 | 5.0E-11 |
sp|Q5RE95|WDR5B_PONAB | WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 | 6 | 109 | 6.0E-11 |
sp|Q86VZ2|WDR5B_HUMAN | WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 | 6 | 110 | 6.0E-11 |
sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 6 | 115 | 7.0E-11 |
sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 6 | 227 | 7.0E-11 |
sp|Q6DH44|WDR83_DANRE | WD repeat domain-containing protein 83 OS=Danio rerio GN=wdr83 PE=2 SV=1 | 9 | 229 | 8.0E-11 |
sp|Q4V8C4|WDR5B_RAT | WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 | 6 | 212 | 1.0E-10 |
sp|Q9SY00|WDR5B_ARATH | COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 | 8 | 188 | 1.0E-10 |
sp|Q3KQ62|WDR83_XENLA | WD repeat domain-containing protein 83 OS=Xenopus laevis GN=wdr83 PE=2 SV=1 | 6 | 229 | 1.0E-10 |
sp|A9V790|LIS1_MONBE | Lissencephaly-1 homolog OS=Monosiga brevicollis GN=35260 PE=3 SV=1 | 6 | 252 | 1.0E-10 |
sp|Q9D7H2|WDR5B_MOUSE | WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 | 4 | 229 | 2.0E-10 |
sp|Q8BG40|KTNB1_MOUSE | Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 | 8 | 108 | 2.0E-10 |
sp|Q9BVA0|KTNB1_HUMAN | Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 | 8 | 108 | 2.0E-10 |
sp|Q3Y8L7|DAW1_CHLRE | Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 | 6 | 220 | 2.0E-10 |
sp|Q5BLX8|WDR83_RAT | WD repeat domain-containing protein 83 OS=Rattus norvegicus GN=Wdr83 PE=1 SV=1 | 12 | 229 | 3.0E-10 |
sp|Q96DI7|SNR40_HUMAN | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 | 6 | 248 | 3.0E-10 |
sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 5 | 314 | 4.0E-10 |
sp|Q9DAJ4|WDR83_MOUSE | WD repeat domain-containing protein 83 OS=Mus musculus GN=Wdr83 PE=1 SV=1 | 12 | 229 | 4.0E-10 |
sp|Q9BRX9|WDR83_HUMAN | WD repeat domain-containing protein 83 OS=Homo sapiens GN=WDR83 PE=1 SV=1 | 12 | 229 | 4.0E-10 |
sp|Q8NBT0|POC1A_HUMAN | POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 | 6 | 314 | 5.0E-10 |
sp|Q7T0P4|POC1A_XENLA | POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 | 6 | 322 | 5.0E-10 |
sp|Q90ZL4|LIS1_XENLA | Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 | 6 | 182 | 5.0E-10 |
sp|Q86VZ2|WDR5B_HUMAN | WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 | 6 | 229 | 6.0E-10 |
sp|Q7ZVF0|POC1A_DANRE | POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 | 8 | 332 | 6.0E-10 |
sp|Q55563|Y163_SYNY3 | Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 | 2 | 109 | 6.0E-10 |
sp|Q55563|Y163_SYNY3 | Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 | 6 | 317 | 7.0E-10 |
sp|C3XVT5|LIS1_BRAFL | Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 | 6 | 217 | 7.0E-10 |
sp|Q17963|WDR51_CAEEL | WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 | 6 | 189 | 7.0E-10 |
sp|Q2HJH6|SNR40_BOVIN | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 | 6 | 248 | 7.0E-10 |
sp|Q6PE01|SNR40_MOUSE | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 | 6 | 248 | 8.0E-10 |
sp|Q8W1K8|MUT11_CHLRE | Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 | 6 | 109 | 9.0E-10 |
sp|Q5RE95|WDR5B_PONAB | WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 | 6 | 229 | 1.0E-09 |
sp|Q5RF51|SNR40_PONAB | U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 | 6 | 248 | 1.0E-09 |
sp|Q6NZH4|LIS1_XENTR | Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 | 6 | 182 | 1.0E-09 |
sp|Q9PTR5|LIS1_CHICK | Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 | 6 | 182 | 1.0E-09 |
sp|Q5IS43|LIS1_PANTR | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 | 6 | 182 | 1.0E-09 |
sp|P63004|LIS1_RAT | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 | 6 | 182 | 1.0E-09 |
sp|Q5REG7|LIS1_PONAB | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 | 6 | 182 | 1.0E-09 |
sp|P63005|LIS1_MOUSE | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 | 6 | 182 | 1.0E-09 |
sp|B0LSW3|LIS1_FELCA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 | 6 | 182 | 1.0E-09 |
sp|P43034|LIS1_HUMAN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 | 6 | 182 | 1.0E-09 |
sp|P43033|LIS1_BOVIN | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 | 6 | 182 | 1.0E-09 |
sp|Q6P2Y2|DAW1_XENTR | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 | 5 | 314 | 2.0E-09 |
sp|Q8HXX0|LIS1_MACFA | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 | 6 | 182 | 2.0E-09 |
sp|Q9VPR4|NLE_DROME | Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 | 6 | 108 | 3.0E-09 |
sp|Q9GL51|LIS1_PIG | Platelet-activating factor acetylhydrolase IB subunit alpha OS=Sus scrofa GN=PAFAH1B1 PE=2 SV=3 | 6 | 182 | 3.0E-09 |
sp|Q4RJN5|LIS1_TETNG | Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 | 6 | 182 | 3.0E-09 |
sp|Q5FWQ6|DAW1_XENLA | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 | 5 | 314 | 3.0E-09 |
sp|Q28I85|POC1A_XENTR | POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 | 6 | 314 | 4.0E-09 |
sp|A8X8C6|TG125_CAEBR | WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 | 6 | 192 | 5.0E-09 |
sp|Q6PBD6|WDR61_XENTR | WD repeat-containing protein 61 OS=Xenopus tropicalis GN=wdr61 PE=2 SV=1 | 9 | 217 | 5.0E-09 |
sp|Q8YRI1|YY46_NOSS1 | Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 | 8 | 108 | 6.0E-09 |
sp|Q498M4|WDR5_RAT | WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 | 6 | 229 | 6.0E-09 |
sp|P61965|WDR5_MOUSE | WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 | 6 | 229 | 6.0E-09 |
sp|P61964|WDR5_HUMAN | WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 | 6 | 229 | 6.0E-09 |
sp|Q2KIG2|WDR5_BOVIN | WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 | 6 | 229 | 6.0E-09 |
sp|Q8W1K8|MUT11_CHLRE | Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 | 6 | 248 | 6.0E-09 |
sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 6 | 320 | 7.0E-09 |
sp|Q9V3J8|WDS_DROME | Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 | 6 | 229 | 8.0E-09 |
sp|Q5M786|WDR5_XENTR | WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 | 6 | 317 | 1.0E-08 |
sp|Q803D2|LIS1B_DANRE | Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 | 6 | 182 | 1.0E-08 |
sp|Q5ZIU8|KTNB1_CHICK | Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 | 8 | 110 | 1.0E-08 |
sp|Q6P2Y2|DAW1_XENTR | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 | 6 | 314 | 2.0E-08 |
sp|Q8H0T9|KTNB1_ARATH | Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 | 8 | 113 | 2.0E-08 |
sp|Q6GMD2|WDR61_XENLA | WD repeat-containing protein 61 OS=Xenopus laevis GN=wdr61 PE=2 SV=1 | 9 | 217 | 2.0E-08 |
sp|B5X3Z6|LIS1A_SALSA | Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 | 6 | 182 | 2.0E-08 |
sp|P42841|PFS2_YEAST | Polyadenylation factor subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFS2 PE=1 SV=1 | 7 | 209 | 2.0E-08 |
sp|Q8I0F4|LIS1_DICDI | Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 | 5 | 115 | 2.0E-08 |
sp|P38123|SWD3_YEAST | COMPASS component SWD3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWD3 PE=1 SV=1 | 8 | 109 | 2.0E-08 |
sp|P49695|PKWA_THECU | Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 | 5 | 109 | 2.0E-08 |
sp|Q54KL5|WDR5_DICDI | WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 | 6 | 229 | 3.0E-08 |
sp|Q7T394|LIS1A_DANRE | Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 | 6 | 106 | 3.0E-08 |
sp|Q23256|WDR53_CAEEL | WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 | 6 | 182 | 3.0E-08 |
sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 6 | 112 | 4.0E-08 |
sp|Q8NBT0|POC1A_HUMAN | POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 | 6 | 197 | 4.0E-08 |
sp|P49695|PKWA_THECU | Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 | 31 | 314 | 5.0E-08 |
sp|Q8MY12|MHCKC_DICDI | Myosin heavy chain kinase C OS=Dictyostelium discoideum GN=mhkC PE=1 SV=1 | 6 | 87 | 5.0E-08 |
sp|B5X3C4|LIS1B_SALSA | Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 | 6 | 106 | 6.0E-08 |
sp|A7S338|LIS1_NEMVE | Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 | 6 | 222 | 7.0E-08 |
sp|Q2KJJ5|TBL3_BOVIN | Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 | 9 | 109 | 7.0E-08 |
sp|Q8C4J7|TBL3_MOUSE | Transducin beta-like protein 3 OS=Mus musculus GN=Tbl3 PE=2 SV=1 | 3 | 110 | 7.0E-08 |
sp|Q8YV57|Y2124_NOSS1 | Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 | 6 | 109 | 9.0E-08 |
sp|Q12788|TBL3_HUMAN | Transducin beta-like protein 3 OS=Homo sapiens GN=TBL3 PE=1 SV=2 | 3 | 110 | 9.0E-08 |
sp|Q9FLX9|NLE1_ARATH | Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 | 6 | 116 | 9.0E-08 |
sp|Q55563|Y163_SYNY3 | Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 | 4 | 314 | 1.0E-07 |
sp|Q9NVX2|NLE1_HUMAN | Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 | 6 | 108 | 1.0E-07 |
sp|F6ZT52|POC1B_XENTR | POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 | 6 | 319 | 1.0E-07 |
sp|Q5U2W5|TBL3_RAT | Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 | 9 | 110 | 1.0E-07 |
sp|Q5RFF8|NLE1_PONAB | Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 | 6 | 108 | 1.0E-07 |
sp|Q7ZUV2|KTNB1_DANRE | Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 | 8 | 116 | 1.0E-07 |
sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 5 | 86 | 2.0E-07 |
sp|Q9VZF4|FBXW7_DROME | F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 | 5 | 185 | 2.0E-07 |
sp|O94620|CWF17_SCHPO | Pre-mRNA-splicing factor cwf17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf17 PE=1 SV=1 | 5 | 204 | 2.0E-07 |
sp|D3BUN1|LIS1_POLPA | Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 | 6 | 122 | 2.0E-07 |
sp|Q8VEJ4|NLE1_MOUSE | Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 | 6 | 108 | 2.0E-07 |
sp|Q93847|YZLL_CAEEL | Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 | 6 | 108 | 2.0E-07 |
sp|Q229Z6|POC1_TETTS | POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 | 8 | 320 | 2.0E-07 |
sp|O14170|POP2_SCHPO | WD repeat-containing protein pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pop2 PE=1 SV=1 | 22 | 182 | 2.0E-07 |
sp|Q6P2Y2|DAW1_XENTR | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 | 4 | 217 | 3.0E-07 |
sp|Q5FWQ6|DAW1_XENLA | Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 | 4 | 217 | 3.0E-07 |
sp|Q9C4Z6|GPLPB_ARATH | Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1 | 8 | 174 | 3.0E-07 |
sp|Q9VU65|POC1_DROME | POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 | 6 | 323 | 3.0E-07 |
sp|Q08E38|PRP19_BOVIN | Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1 | 21 | 229 | 3.0E-07 |
sp|Q58D20|NLE1_BOVIN | Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 | 6 | 82 | 3.0E-07 |
sp|Q4P9P9|LIS1_USTMA | Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 | 6 | 217 | 3.0E-07 |
sp|Q8I0F4|LIS1_DICDI | Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 | 6 | 123 | 4.0E-07 |
sp|Q93847|YZLL_CAEEL | Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 | 6 | 188 | 4.0E-07 |
sp|Q1LV15|DAW1_DANRE | Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 | 5 | 109 | 4.0E-07 |
sp|O61585|KTNB1_STRPU | Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 | 8 | 113 | 4.0E-07 |
sp|Q9UMS4|PRP19_HUMAN | Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1 | 21 | 229 | 4.0E-07 |
sp|Q55563|Y163_SYNY3 | Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 | 5 | 317 | 5.0E-07 |
sp|B7PS00|LIS1_IXOSC | Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 | 6 | 217 | 5.0E-07 |
sp|Q7ZXK9|NLE1_XENLA | Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 | 6 | 87 | 6.0E-07 |
sp|Q9NSI6|BRWD1_HUMAN | Bromodomain and WD repeat-containing protein 1 OS=Homo sapiens GN=BRWD1 PE=1 SV=4 | 6 | 83 | 7.0E-07 |
sp|Q9JMJ4|PRP19_RAT | Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=1 SV=2 | 21 | 229 | 7.0E-07 |
sp|Q99KP6|PRP19_MOUSE | Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=1 SV=1 | 21 | 229 | 7.0E-07 |
sp|O43017|SWD3_SCHPO | Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 | 6 | 184 | 8.0E-07 |
sp|Q17N69|LIS1_AEDAE | Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 | 6 | 112 | 8.0E-07 |
sp|Q6NVM2|KTNB1_XENTR | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 | 8 | 105 | 8.0E-07 |
sp|P74442|Y143_SYNY3 | Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 | 6 | 111 | 8.0E-07 |
sp|Q8TC44|POC1B_HUMAN | POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 | 17 | 118 | 9.0E-07 |
sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 6 | 108 | 1.0E-06 |
sp|Q5XGI5|WDR83_XENTR | WD repeat domain-containing protein 83 OS=Xenopus tropicalis GN=wdr83 PE=2 SV=1 | 7 | 214 | 1.0E-06 |
sp|Q00808|HETE1_PODAS | Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 | 6 | 102 | 1.0E-06 |
sp|Q3Y8L7|DAW1_CHLRE | Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 | 6 | 250 | 1.0E-06 |
sp|Q3Y8L7|DAW1_CHLRE | Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 | 6 | 85 | 1.0E-06 |
sp|D3BUN1|LIS1_POLPA | Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 | 5 | 88 | 1.0E-06 |
sp|Q9UTN4|PFS2_SCHPO | Polyadenylation factor subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfs2 PE=3 SV=1 | 5 | 225 | 1.0E-06 |
sp|Q4V7Y7|KTNB1_XENLA | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 | 8 | 105 | 1.0E-06 |
sp|B4JWA1|LIS1_DROGR | Lissencephaly-1 homolog OS=Drosophila grimshawi GN=Lis-1 PE=3 SV=1 | 6 | 90 | 1.0E-06 |
sp|Q5ZJH5|WDR61_CHICK | WD repeat-containing protein 61 OS=Gallus gallus GN=WDR61 PE=2 SV=1 | 41 | 217 | 1.0E-06 |
sp|B4P6P9|LIS1_DROYA | Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 | 6 | 90 | 1.0E-06 |
sp|B3NPW0|LIS1_DROER | Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 | 6 | 90 | 1.0E-06 |
sp|B4QHG6|LIS1_DROSI | Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 | 6 | 90 | 1.0E-06 |
sp|B4HSL3|LIS1_DROSE | Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 | 6 | 90 | 1.0E-06 |
sp|Q7KNS3|LIS1_DROME | Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 | 6 | 90 | 1.0E-06 |
sp|Q5RD06|POC1B_PONAB | POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 | 17 | 118 | 1.0E-06 |
sp|Q6PH57|GBB1_DANRE | Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Danio rerio GN=gnb1 PE=2 SV=1 | 6 | 86 | 1.0E-06 |
sp|Q5ZMA2|PRP19_CHICK | Pre-mRNA-processing factor 19 OS=Gallus gallus GN=PRPF19 PE=1 SV=1 | 21 | 229 | 1.0E-06 |
sp|Q4V7A0|WDR61_RAT | WD repeat-containing protein 61 OS=Rattus norvegicus GN=Wdr61 PE=1 SV=1 | 34 | 217 | 1.0E-06 |
sp|Q8YTC2|Y2800_NOSS1 | Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 | 6 | 217 | 2.0E-06 |
sp|Q8BG40|KTNB1_MOUSE | Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 | 6 | 105 | 2.0E-06 |
sp|Q9BVA0|KTNB1_HUMAN | Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 | 6 | 105 | 2.0E-06 |
sp|Q9VZF4|FBXW7_DROME | F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster GN=ago PE=1 SV=1 | 2 | 99 | 2.0E-06 |
sp|Q93847|YZLL_CAEEL | Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 | 9 | 229 | 2.0E-06 |
sp|Q6P5M2|WDR61_DANRE | WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 | 34 | 315 | 2.0E-06 |
sp|Q921C3|BRWD1_MOUSE | Bromodomain and WD repeat-containing protein 1 OS=Mus musculus GN=Brwd1 PE=1 SV=2 | 6 | 83 | 2.0E-06 |
sp|D3ZW91|POC1B_RAT | POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 | 17 | 118 | 2.0E-06 |
sp|P25382|NLE1_YEAST | Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 | 2 | 85 | 2.0E-06 |
sp|B4KT48|LIS1_DROMO | Lissencephaly-1 homolog OS=Drosophila mojavensis GN=Lis-1 PE=3 SV=1 | 6 | 90 | 2.0E-06 |
sp|B4LQ21|LIS1_DROVI | Lissencephaly-1 homolog OS=Drosophila virilis GN=Lis-1 PE=3 SV=1 | 6 | 90 | 2.0E-06 |
sp|Q9JHB4|WDR31_MOUSE | WD repeat-containing protein 31 OS=Mus musculus GN=Wdr31 PE=2 SV=1 | 6 | 88 | 2.0E-06 |
sp|Q9ERF3|WDR61_MOUSE | WD repeat-containing protein 61 OS=Mus musculus GN=Wdr61 PE=1 SV=1 | 34 | 217 | 2.0E-06 |
sp|Q291L9|LIS1_DROPS | Lissencephaly-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Lis-1 PE=3 SV=1 | 6 | 90 | 2.0E-06 |
sp|B4GAJ1|LIS1_DROPE | Lissencephaly-1 homolog OS=Drosophila persimilis GN=Lis-1 PE=3 SV=1 | 6 | 90 | 2.0E-06 |
sp|Q5SUS0|FBW10_MOUSE | F-box/WD repeat-containing protein 10 OS=Mus musculus GN=Fbxw10 PE=2 SV=1 | 3 | 203 | 2.0E-06 |
sp|Q9U2A9|BOP1_CAEEL | Ribosome biogenesis protein BOP1 homolog OS=Caenorhabditis elegans GN=Y48B6A.1 PE=3 SV=1 | 50 | 228 | 2.0E-06 |
sp|Q54H44|WDR83_DICDI | WD repeat domain-containing protein 83 homolog OS=Dictyostelium discoideum GN=morg1 PE=3 SV=1 | 5 | 229 | 2.0E-06 |
sp|Q39336|GBLP_BRANA | Guanine nucleotide-binding protein subunit beta-like protein OS=Brassica napus GN=GB1 PE=2 SV=1 | 8 | 171 | 2.0E-06 |
sp|Q91WQ5|TAF5L_MOUSE | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 | 5 | 86 | 2.0E-06 |
sp|Q00808|HETE1_PODAS | Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 | 6 | 108 | 3.0E-06 |
sp|Q00808|HETE1_PODAS | Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 | 6 | 108 | 3.0E-06 |
sp|Q6NVM2|KTNB1_XENTR | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 | 6 | 113 | 3.0E-06 |
sp|Q4V7Y7|KTNB1_XENLA | Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 | 6 | 113 | 3.0E-06 |
sp|P16371|GROU_DROME | Protein groucho OS=Drosophila melanogaster GN=gro PE=1 SV=3 | 21 | 215 | 3.0E-06 |
sp|P62884|GBLP_LEIIN | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania infantum GN=LACK1 PE=2 SV=1 | 1 | 168 | 3.0E-06 |
sp|P62883|GBLP_LEICH | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania chagasi PE=2 SV=1 | 1 | 168 | 3.0E-06 |
sp|A0CH87|LIS12_PARTE | Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 | 6 | 119 | 3.0E-06 |
sp|A0JMQ0|BOP1_DANRE | Ribosome biogenesis protein bop1 OS=Danio rerio GN=bop1 PE=2 SV=1 | 47 | 109 | 3.0E-06 |
sp|Q5JTN6|WDR38_HUMAN | WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 | 18 | 133 | 3.0E-06 |
sp|B3MEY6|LIS1_DROAN | Lissencephaly-1 homolog OS=Drosophila ananassae GN=Lis-1 PE=3 SV=1 | 6 | 90 | 3.0E-06 |
sp|Q54TD8|BOP1_DICDI | Ribosome biogenesis protein BOP1 homolog OS=Dictyostelium discoideum GN=DDB_G0281839 PE=3 SV=1 | 27 | 224 | 4.0E-06 |
sp|Q25306|GBLP_LEIMA | Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1 | 1 | 168 | 4.0E-06 |
sp|C4Q0P6|LIS1_SCHMA | Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 | 6 | 88 | 4.0E-06 |
sp|P38011|GBLP_YEAST | Guanine nucleotide-binding protein subunit beta-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASC1 PE=1 SV=4 | 8 | 154 | 4.0E-06 |
sp|Q59WJ4|PFS2_CANAL | Polyadenylation factor subunit 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PFS2 PE=3 SV=1 | 6 | 115 | 4.0E-06 |
sp|Q1LV15|DAW1_DANRE | Dynein assembly factor with WDR repeat domains 1 OS=Danio rerio GN=daw1 PE=2 SV=2 | 6 | 314 | 5.0E-06 |
sp|P46800|GBLP_DICDI | Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2 | 8 | 178 | 5.0E-06 |
sp|Q6L4F8|GBLPB_ORYSJ | Guanine nucleotide-binding protein subunit beta-like protein B OS=Oryza sativa subsp. japonica GN=RACK1B PE=1 SV=1 | 8 | 171 | 5.0E-06 |
sp|Q8C092|TAF5_MOUSE | Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 | 5 | 109 | 5.0E-06 |
sp|P0CS42|LIS1_CRYNJ | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 | 6 | 217 | 6.0E-06 |
sp|P0CS43|LIS1_CRYNB | Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 | 6 | 217 | 6.0E-06 |
sp|A9UZS7|BOP1_MONBE | Ribosome biogenesis protein BOP1 homolog OS=Monosiga brevicollis GN=37129 PE=3 SV=1 | 15 | 88 | 6.0E-06 |
sp|B4MY65|LIS1_DROWI | Lissencephaly-1 homolog OS=Drosophila willistoni GN=Lis-1 PE=3 SV=1 | 6 | 90 | 6.0E-06 |
sp|B8PD53|LIS12_POSPM | Nuclear distribution protein PAC1-2 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=PAC1-2 PE=3 SV=1 | 6 | 217 | 7.0E-06 |
sp|Q15542|TAF5_HUMAN | Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 | 5 | 109 | 7.0E-06 |
sp|Q6BVZ3|PFS2_DEBHA | Polyadenylation factor subunit 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PFS2 PE=3 SV=2 | 5 | 115 | 7.0E-06 |
sp|Q6CP71|PFS2_KLULA | Polyadenylation factor subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFS2 PE=3 SV=1 | 1 | 217 | 7.0E-06 |
sp|Q12417|PRP46_YEAST | Pre-mRNA-splicing factor PRP46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP46 PE=1 SV=1 | 6 | 83 | 8.0E-06 |
sp|G0SC29|NLE1_CHATD | Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 | 6 | 85 | 9.0E-06 |
sp|O75529|TAF5L_HUMAN | TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 | 34 | 336 | 9.0E-06 |
sp|O24456|GBLPA_ARATH | Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2 | 8 | 174 | 9.0E-06 |
sp|B7PS00|LIS1_IXOSC | Lissencephaly-1 homolog OS=Ixodes scapularis GN=IscW_ISCW007420 PE=3 SV=2 | 6 | 88 | 1.0E-05 |
sp|Q9LV28|GPLPC_ARATH | Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1 | 8 | 174 | 1.0E-05 |
GO Term | Description | Terminal node |
---|---|---|
GO:0005515 | protein binding | Yes |
GO:0003674 | molecular_function | No |
GO:0005488 | binding | No |
Localizations | Signals | Cytoplasm | Nucleus | Extracellular | Cell membrane | Mitochondrion | Plastid | Endoplasmic reticulum | Lysosome vacuole | Golgi apparatus | Peroxisome |
---|---|---|---|---|---|---|---|---|---|---|---|
Cytoplasm|Nucleus | 0.4875 | 0.7192 | 0.0407 | 0.0396 | 0.0702 | 0.002 | 0.2095 | 0.2564 | 0.1013 | 0.0149 |
Orthofinder run ID | 4 |
Orthogroup | 1500 |
Change Orthofinder run |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Hirsu2|1115 MRPILLAGHERALTQIRYNLDGDIIFSVAKDQHICAWFSHNGERLGTYHGHVGAIWTVDVDPTTTMIASGSADNT IRLWEVKTGRCLKAWEFPTAVKRVEFNEDGTKLLGVTEKRMGYLSNIVVVDIDPDVNADQSDEKVLTIVCDESKA TVAGWAALSKYIIAGHEDGSVSQYDGKTGDLLDNVPIHELNQPIVDLQWSTDRTYCITACKDKTAKLVSAHDLTV LKNYPADTPLNSAAIVPKKDFVILGGGQAAMDVTTTAARQGKFEARFYHKIFEDEIGRVRGHFGPLNTVAADPTG KSYASGGEDGYVRVHHFDKGYFDFMYEVEREHANRM* |
Coding | >Hirsu2|1115 ATGAGACCCATCCTCCTCGCCGGGCACGAGCGTGCGCTCACCCAGATCCGGTATAACCTCGACGGCGACATCATC TTCTCCGTCGCCAAGGACCAGCACATCTGCGCCTGGTTCTCGCACAACGGCGAGCGGCTCGGCACCTACCACGGG CACGTGGGCGCCATCTGGACCGTCGACGTGGACCCGACGACGACGATGATCGCCTCGGGCTCGGCCGACAACACG ATCCGCCTGTGGGAGGTCAAGACGGGCCGCTGCCTCAAGGCCTGGGAGTTCCCGACGGCCGTCAAGCGCGTCGAG TTCAACGAGGACGGCACCAAGCTGCTGGGCGTGACGGAGAAGCGGATGGGCTACCTGAGCAACATCGTCGTCGTC GACATCGACCCGGACGTCAACGCCGACCAGAGCGACGAAAAGGTGCTGACCATTGTCTGCGACGAGAGCAAGGCC ACCGTCGCCGGCTGGGCCGCCCTCAGCAAGTACATCATCGCCGGCCACGAGGACGGCAGCGTCTCGCAGTACGAC GGCAAGACGGGCGATCTGCTCGACAACGTACCCATCCACGAGCTCAACCAGCCCATCGTCGACCTGCAATGGTCC ACCGACCGCACCTACTGCATCACCGCCTGCAAGGACAAGACGGCCAAGCTCGTCTCGGCGCACGACCTGACCGTG CTGAAGAACTACCCCGCCGACACGCCGCTCAACAGCGCCGCCATCGTGCCCAAGAAGGACTTCGTCATCCTCGGC GGCGGCCAGGCCGCCATGGACGTCACCACCACGGCCGCCCGCCAGGGCAAGTTCGAGGCCCGCTTCTACCACAAG ATCTTCGAGGACGAGATCGGCCGCGTGCGCGGCCACTTCGGCCCCCTCAACACCGTCGCCGCCGACCCGACCGGC AAGAGCTACGCCAGCGGCGGCGAGGACGGCTACGTCCGCGTCCACCACTTCGACAAGGGCTACTTCGACTTCATG TACGAGGTCGAGCGCGAGCACGCCAACCGCATGTAG |
Transcript | >Hirsu2|1115 ATGAGACCCATCCTCCTCGCCGGGCACGAGCGTGCGCTCACCCAGATCCGGTATAACCTCGACGGCGACATCATC TTCTCCGTCGCCAAGGACCAGCACATCTGCGCCTGGTTCTCGCACAACGGCGAGCGGCTCGGCACCTACCACGGG CACGTGGGCGCCATCTGGACCGTCGACGTGGACCCGACGACGACGATGATCGCCTCGGGCTCGGCCGACAACACG ATCCGCCTGTGGGAGGTCAAGACGGGCCGCTGCCTCAAGGCCTGGGAGTTCCCGACGGCCGTCAAGCGCGTCGAG TTCAACGAGGACGGCACCAAGCTGCTGGGCGTGACGGAGAAGCGGATGGGCTACCTGAGCAACATCGTCGTCGTC GACATCGACCCGGACGTCAACGCCGACCAGAGCGACGAAAAGGTGCTGACCATTGTCTGCGACGAGAGCAAGGCC ACCGTCGCCGGCTGGGCCGCCCTCAGCAAGTACATCATCGCCGGCCACGAGGACGGCAGCGTCTCGCAGTACGAC GGCAAGACGGGCGATCTGCTCGACAACGTACCCATCCACGAGCTCAACCAGCCCATCGTCGACCTGCAATGGTCC ACCGACCGCACCTACTGCATCACCGCCTGCAAGGACAAGACGGCCAAGCTCGTCTCGGCGCACGACCTGACCGTG CTGAAGAACTACCCCGCCGACACGCCGCTCAACAGCGCCGCCATCGTGCCCAAGAAGGACTTCGTCATCCTCGGC GGCGGCCAGGCCGCCATGGACGTCACCACCACGGCCGCCCGCCAGGGCAAGTTCGAGGCCCGCTTCTACCACAAG ATCTTCGAGGACGAGATCGGCCGCGTGCGCGGCCACTTCGGCCCCCTCAACACCGTCGCCGCCGACCCGACCGGC AAGAGCTACGCCAGCGGCGGCGAGGACGGCTACGTCCGCGTCCACCACTTCGACAAGGGCTACTTCGACTTCATG TACGAGGTCGAGCGCGAGCACGCCAACCGCATGTAG |
Gene | >Hirsu2|1115 ATGAGACCCATCCTCCTCGCCGGGCACGAGCGTGCGCTCACCCAGATCCGGTACGACCGCCCCGAAACCGGCCTT GGCCCAGGCCGGGGAGAGAGAGAGGCTCTAACGGTGCGGCAGGTATAACCTCGACGGCGACATCATCTTCTCCGT CGCCAAGGACCAGCACATCTGCGCCTGGTTCTCGCACAACGGCGAGCGGCTCGGCACCTACCACGGGCACGTGGG CGCCATCTGGACCGTCGACGTGGACCCGACGACGACGATGATCGCCTCGGGCTCGGCCGACAACACGATCCGCCT GTGGGAGGTCAAGACGGGCCGCTGCCTCAAGGCCTGGGAGTTCCCGACGGCCGTCAAGCGCGTCGAGTTCAACGA GGACGGCACCAAGCTGCTGGGCGTGACGGAGAAGCGGATGGGCTACCTGAGCAACATCGTCGTCGTCGACATCGA CCCGGACGTCAACGCCGACCAGAGCGACGAAAAGGTGCTGACCATTGTCTGCGACGAGAGCAAGGCCACCGTCGC CGGCTGGGCCGCCCTCAGCAAGTACATCATCGCCGGCCACGAGGACGGCAGCGTCTCGCAGTACGACGGCAAGAC GGGCGATCTGCTCGACAACGTACCCATCCACGAGCTCAACCAGCCCATCGTCGACCTGCAATGGTCCACCGACCG CACCTACTGCATCACCGCCTGCAAGGACAAGACGGCCAAGGTAAACCCCCCCCCCCCCCCCCTCTTCTCTCTCTT TCTCATTCTCTTTCTCTCTCTCTCCCCCTCTCTCCGACAACGGGGCTGCTGACACAATCGCCGCCCACCAGCTCG TCTCGGCGCACGACCTGACCGTGCTGAAGAACTACCCCGCCGACACGCCGCTCAACAGCGCCGCCATCGTGCCCA AGAAGGACTTCGTCATCCTCGGCGGCGGCCAGGCCGCCATGGACGTCACCACCACGGCCGCCCGCCAGGGCAAGT TCGAGGCCCGCTTCTACCACAAGATCTTCGAGGACGAGATCGGCCGCGTGCGCGGCCACTTCGGCCCCCTCAACA CCGTCGCCGCCGACCCGACCGGCAAGAGCTACGCCAGCGGCGGCGAGGACGGCTACGTCCGCGTCCACCACTTCG ACAAGGGCTACTTCGACTTCATGTACGAGGTCGAGCGCGAGCACGCCAACCGCATGTAG |