Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11144
Gene name
LocationContig_971:6654..9483
Strand-
Gene length (bp)2829
Transcript length (bp)2283
Coding sequence length (bp)2283
Protein length (aa) 761

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 4.5E-09 398 462
PF12796 Ank_2 Ankyrin repeats (3 copies) 5.4E-07 431 494
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.3E-06 464 529
PF12796 Ank_2 Ankyrin repeats (3 copies) 2.6E-09 498 562
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.6E-16 536 626
PF12796 Ank_2 Ankyrin repeats (3 copies) 6.8E-12 605 683
PF13637 Ank_4 Ankyrin repeats (many copies) 8.8E-05 362 419
PF13637 Ank_4 Ankyrin repeats (many copies) 2.8E-06 400 451
PF13637 Ank_4 Ankyrin repeats (many copies) 1.5E-05 473 519
PF13637 Ank_4 Ankyrin repeats (many copies) 2.6E-08 512 552
PF13637 Ank_4 Ankyrin repeats (many copies) 1.8E-08 600 645
PF13637 Ank_4 Ankyrin repeats (many copies) 1.8E-05 637 683
PF13606 Ank_3 Ankyrin repeat 3.2E-03 398 426
PF13606 Ank_3 Ankyrin repeat 1.2E-03 498 527
PF13606 Ank_3 Ankyrin repeat 1.9E-03 533 559
PF13606 Ank_3 Ankyrin repeat 2.0E-04 598 625
PF13606 Ank_3 Ankyrin repeat 3.4E-04 631 658
PF00023 Ank Ankyrin repeat 8.4E-04 498 529
PF00023 Ank Ankyrin repeat 6.9E-04 599 625
PF00023 Ank Ankyrin repeat 5.0E-04 631 662

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 338 695 4.0E-43
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 333 668 9.0E-43
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 339 693 2.0E-41
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 339 685 3.0E-41
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 338 688 1.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 338 695 4.0E-43
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 333 668 9.0E-43
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 339 693 2.0E-41
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 339 685 3.0E-41
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 338 688 1.0E-40
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 328 759 1.0E-39
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 339 652 2.0E-39
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 374 683 4.0E-39
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 365 690 4.0E-39
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 341 758 6.0E-39
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 338 683 2.0E-38
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 339 684 3.0E-38
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 365 690 5.0E-38
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 339 683 6.0E-38
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 339 652 7.0E-38
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 363 678 1.0E-37
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 339 684 1.0E-37
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 339 691 4.0E-37
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 339 684 4.0E-37
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 328 684 4.0E-37
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 342 685 5.0E-37
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 339 683 8.0E-37
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 339 683 1.0E-36
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 328 684 1.0E-36
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 365 690 1.0E-36
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 339 683 2.0E-36
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 339 652 2.0E-36
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 323 671 3.0E-36
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 349 683 4.0E-36
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 349 683 5.0E-36
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 349 683 5.0E-36
sp|Q5UPG5|YL093_MIMIV Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 344 658 1.0E-35
sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 375 681 1.0E-35
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 338 683 2.0E-35
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 339 702 3.0E-35
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 362 673 4.0E-35
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 339 691 4.0E-35
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 339 691 5.0E-35
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 342 687 7.0E-35
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 331 683 1.0E-34
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 318 683 1.0E-34
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 365 661 1.0E-34
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 349 683 4.0E-34
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 339 705 4.0E-34
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 339 702 7.0E-34
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 337 671 9.0E-34
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 339 691 1.0E-33
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 398 693 2.0E-33
sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 350 685 2.0E-33
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 339 691 2.0E-33
sp|Q9J569|V162_FOWPN Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 342 683 2.0E-33
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 323 671 2.0E-33
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 376 691 3.0E-33
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 339 685 3.0E-33
sp|Q5UPG5|YL093_MIMIV Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 357 683 4.0E-33
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 348 683 5.0E-33
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 323 671 6.0E-33
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 339 685 8.0E-33
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 339 671 9.0E-33
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 346 683 1.0E-32
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 339 695 1.0E-32
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 348 683 1.0E-32
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 318 683 1.0E-32
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 339 653 1.0E-32
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 337 671 1.0E-32
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 378 673 1.0E-32
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 348 683 2.0E-32
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 364 675 2.0E-32
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 339 683 2.0E-32
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 337 671 2.0E-32
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 339 679 3.0E-32
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 377 681 3.0E-32
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 348 685 4.0E-32
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 348 685 4.0E-32
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 406 685 6.0E-32
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 364 675 6.0E-32
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 365 675 6.0E-32
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 348 683 7.0E-32
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 348 672 9.0E-32
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 348 683 1.0E-31
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 353 702 1.0E-31
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 377 681 1.0E-31
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 365 675 1.0E-31
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 339 671 1.0E-31
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 339 671 1.0E-31
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 342 673 2.0E-31
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 293 650 2.0E-31
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 436 685 3.0E-31
sp|Q5UPF8|YL088_MIMIV Putative ankyrin repeat protein L88 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L88 PE=3 SV=1 360 671 3.0E-31
sp|Q06527|ANKH_ALLVD Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 401 686 4.0E-31
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 342 676 5.0E-31
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 364 675 5.0E-31
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 338 673 5.0E-31
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 364 675 7.0E-31
sp|Q5UPJ9|YL122_MIMIV Putative ankyrin repeat protein L122 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L122 PE=3 SV=1 343 672 7.0E-31
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 430 686 8.0E-31
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 341 674 2.0E-30
sp|Q9WV72|ASB3_MOUSE Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 425 690 2.0E-30
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 337 684 4.0E-30
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 341 674 4.0E-30
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 353 655 5.0E-30
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 342 689 6.0E-30
sp|Q25338|LITD_LATTR Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 343 683 7.0E-30
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 398 686 9.0E-30
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 433 672 1.0E-29
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 339 653 2.0E-29
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 433 672 3.0E-29
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 336 689 4.0E-29
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 337 683 5.0E-29
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 429 668 5.0E-29
sp|Q9J507|V228_FOWPN Putative ankyrin repeat protein FPV228 OS=Fowlpox virus (strain NVSL) GN=FPV228 PE=3 SV=1 363 670 6.0E-29
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 336 685 7.0E-29
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 336 689 8.0E-29
sp|Q08DV6|ASB3_BOVIN Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 425 690 8.0E-29
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 339 651 9.0E-29
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 348 686 1.0E-28
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 433 672 2.0E-28
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 339 692 2.0E-28
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 394 671 2.0E-28
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 338 673 2.0E-28
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 394 671 2.0E-28
sp|Q9Y575|ASB3_HUMAN Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 372 690 2.0E-28
sp|Q05921|RN5A_MOUSE 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 431 683 3.0E-28
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 352 671 4.0E-28
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 348 683 5.0E-28
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 336 683 6.0E-28
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 342 683 6.0E-28
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 338 673 6.0E-28
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 445 671 8.0E-28
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 386 683 8.0E-28
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 342 672 8.0E-28
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 341 686 9.0E-28
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 342 672 9.0E-28
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 339 671 1.0E-27
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 318 683 1.0E-27
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 372 692 1.0E-27
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 339 693 1.0E-27
sp|A6QPE7|ANR65_BOVIN Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 348 660 1.0E-27
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 339 683 2.0E-27
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 425 683 2.0E-27
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 339 671 2.0E-27
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 348 683 2.0E-27
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 348 683 2.0E-27
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 342 683 2.0E-27
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 339 691 3.0E-27
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 348 683 3.0E-27
sp|Q5UPF8|YL088_MIMIV Putative ankyrin repeat protein L88 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L88 PE=3 SV=1 331 684 3.0E-27
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 341 686 4.0E-27
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 406 683 4.0E-27
sp|Q9J5I7|V014_FOWPN Putative ankyrin repeat protein FPV014 OS=Fowlpox virus (strain NVSL) GN=FPV014 PE=3 SV=1 412 718 4.0E-27
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 341 686 5.0E-27
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 350 672 5.0E-27
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 352 671 6.0E-27
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 433 683 6.0E-27
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 395 684 8.0E-27
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 473 674 8.0E-27
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 348 683 1.0E-26
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 339 654 1.0E-26
sp|Q05823|RN5A_HUMAN 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 436 683 1.0E-26
sp|Q9C0D5|TANC1_HUMAN Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 378 693 1.0E-26
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 348 691 2.0E-26
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 339 691 2.0E-26
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 273 690 2.0E-26
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 273 690 2.0E-26
sp|Q5UPF8|YL088_MIMIV Putative ankyrin repeat protein L88 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L88 PE=3 SV=1 344 700 2.0E-26
sp|Q0VGY8|TANC1_MOUSE Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 378 693 2.0E-26
sp|E5RJM6|ANR65_HUMAN Ankyrin repeat domain-containing protein 65 OS=Homo sapiens GN=ANKRD65 PE=2 SV=2 348 660 2.0E-26
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 400 690 3.0E-26
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 351 672 3.0E-26
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 438 683 3.0E-26
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 355 692 3.0E-26
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 434 671 4.0E-26
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 434 671 4.0E-26
sp|Q9J4Z4|V246_FOWPN Putative ankyrin repeat protein FPV246 OS=Fowlpox virus (strain NVSL) GN=FPV246 PE=3 SV=1 416 678 4.0E-26
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 336 683 5.0E-26
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 473 674 5.0E-26
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 348 691 7.0E-26
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 338 685 7.0E-26
sp|Q6F6B3|TANC1_RAT Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 378 693 7.0E-26
sp|Q9J569|V162_FOWPN Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 344 719 9.0E-26
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 338 685 9.0E-26
sp|Q495B1|AKD1A_HUMAN Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 348 697 9.0E-26
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 375 691 1.0E-25
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 348 691 1.0E-25
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 433 684 1.0E-25
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 433 684 1.0E-25
sp|Q5UPF8|YL088_MIMIV Putative ankyrin repeat protein L88 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L88 PE=3 SV=1 343 683 1.0E-25
sp|Q05823|RN5A_HUMAN 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 480 688 1.0E-25
sp|Q9J4Z6|V244_FOWPN Putative ankyrin repeat protein FPV244 OS=Fowlpox virus (strain NVSL) GN=FPV244 PE=3 SV=1 348 683 1.0E-25
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 375 691 2.0E-25
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 339 666 2.0E-25
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 339 622 2.0E-25
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 338 671 3.0E-25
sp|Q5REW9|ANR27_PONAB Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 348 683 3.0E-25
sp|Q9HCD6|TANC2_HUMAN Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 339 657 3.0E-25
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 339 691 5.0E-25
sp|Q3UMR0|ANR27_MOUSE Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 348 683 5.0E-25
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 364 675 6.0E-25
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 363 683 6.0E-25
sp|Q9J4Z5|V245_FOWPN Putative ankyrin repeat protein FPV245 OS=Fowlpox virus (strain NVSL) GN=FPV245 PE=3 SV=1 416 673 6.0E-25
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 451 683 7.0E-25
sp|A2A690|TANC2_MOUSE Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 339 657 8.0E-25
sp|A6QPE7|ANR65_BOVIN Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 360 673 9.0E-25
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 337 683 1.0E-24
sp|Q9GKW8|AND1A_MACFA Ankyrin repeat and death domain-containing protein 1A (Fragment) OS=Macaca fascicularis GN=ANKDD1A PE=2 SV=3 339 652 1.0E-24
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 362 687 2.0E-24
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 318 672 2.0E-24
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 339 666 2.0E-24
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 457 690 2.0E-24
sp|Q1RK13|Y220_RICBR Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 361 731 2.0E-24
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 337 639 3.0E-24
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 344 671 4.0E-24
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 337 686 4.0E-24
sp|Q71S21|INVSB_XENLA Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 357 655 4.0E-24
sp|Q8BLA8|TRPA1_MOUSE Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 360 673 4.0E-24
sp|Q8N6D5|ANR29_HUMAN Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 386 634 4.0E-24
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 326 685 5.0E-24
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 339 672 6.0E-24
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 491 696 7.0E-24
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 364 675 7.0E-24
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 337 686 7.0E-24
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 436 760 7.0E-24
sp|Q9J5H7|V024_FOWPN Putative ankyrin repeat protein FPV024 OS=Fowlpox virus (strain NVSL) GN=FPV024 PE=3 SV=1 401 683 7.0E-24
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 483 693 8.0E-24
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 337 639 8.0E-24
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 274 650 9.0E-24
sp|Q9WV72|ASB3_MOUSE Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 405 663 9.0E-24
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 352 623 9.0E-24
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 352 623 9.0E-24
sp|Q9W0T5|PYX_DROME Transient receptor potential channel pyrexia OS=Drosophila melanogaster GN=pyx PE=2 SV=2 327 702 9.0E-24
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 344 672 1.0E-23
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 364 675 1.0E-23
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 436 760 1.0E-23
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 342 652 1.0E-23
sp|Q6RI86|TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 380 673 1.0E-23
sp|Q6RI86|TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 342 657 1.0E-23
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 344 672 2.0E-23
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 344 674 2.0E-23
sp|Q9J4Z5|V245_FOWPN Putative ankyrin repeat protein FPV245 OS=Fowlpox virus (strain NVSL) GN=FPV245 PE=3 SV=1 410 686 2.0E-23
sp|Q59H18|TNI3K_HUMAN Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 335 663 2.0E-23
sp|G0LXV8|LATA_LATHA Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 335 692 2.0E-23
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 315 679 3.0E-23
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 433 683 3.0E-23
sp|A6QPE7|ANR65_BOVIN Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 419 686 3.0E-23
sp|Q9GKW8|AND1A_MACFA Ankyrin repeat and death domain-containing protein 1A (Fragment) OS=Macaca fascicularis GN=ANKDD1A PE=2 SV=3 361 687 3.0E-23
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 315 679 4.0E-23
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 344 674 4.0E-23
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 363 605 4.0E-23
sp|Q8UVC1|INVS_DANRE Inversin OS=Danio rerio GN=invs PE=2 SV=1 357 655 4.0E-23
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 353 670 4.0E-23
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 366 683 5.0E-23
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 412 683 5.0E-23
sp|O75832|PSD10_HUMAN 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 491 684 5.0E-23
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 348 656 6.0E-23
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 359 683 6.0E-23
sp|Q06527|ANKH_ALLVD Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 344 567 7.0E-23
sp|Q5UPJ9|YL122_MIMIV Putative ankyrin repeat protein L122 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L122 PE=3 SV=1 343 658 7.0E-23
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 357 651 7.0E-23
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 357 684 7.0E-23
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 412 692 8.0E-23
sp|Q8BLA8|TRPA1_MOUSE Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 342 657 8.0E-23
sp|Q5RF15|TNI3K_PONAB Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 335 663 8.0E-23
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 357 684 8.0E-23
sp|Q5UPJ9|YL122_MIMIV Putative ankyrin repeat protein L122 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L122 PE=3 SV=1 344 608 9.0E-23
sp|Q5DW34|EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 403 639 9.0E-23
sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 436 673 1.0E-22
sp|Q7T163|KDIS_DANRE Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 473 683 1.0E-22
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 351 689 1.0E-22
sp|P23631|LATA_LATTR Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 353 692 1.0E-22
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 351 685 2.0E-22
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 278 602 2.0E-22
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 275 602 2.0E-22
sp|Q71S21|INVSB_XENLA Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 338 683 2.0E-22
sp|Q9J5H7|V024_FOWPN Putative ankyrin repeat protein FPV024 OS=Fowlpox virus (strain NVSL) GN=FPV024 PE=3 SV=1 342 685 2.0E-22
sp|Q8UVC1|INVS_DANRE Inversin OS=Danio rerio GN=invs PE=2 SV=1 337 683 2.0E-22
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 352 692 2.0E-22
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 352 692 2.0E-22
sp|O75762|TRPA1_HUMAN Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 399 673 2.0E-22
sp|Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 403 639 2.0E-22
sp|Q04721|NOTC2_HUMAN Neurogenic locus notch homolog protein 2 OS=Homo sapiens GN=NOTCH2 PE=1 SV=3 353 584 3.0E-22
sp|Q9QW30|NOTC2_RAT Neurogenic locus notch homolog protein 2 OS=Rattus norvegicus GN=Notch2 PE=1 SV=1 353 584 3.0E-22
sp|Q9Z2X2|PSD10_MOUSE 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 491 687 3.0E-22
sp|Q5URB8|YR841_MIMIV Putative ankyrin repeat protein R841 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R841 PE=3 SV=1 342 668 3.0E-22
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 339 644 4.0E-22
sp|Q1RK13|Y220_RICBR Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 348 624 4.0E-22
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 348 688 5.0E-22
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 357 684 5.0E-22
sp|Q96Q27|ASB2_HUMAN Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 354 659 5.0E-22
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 498 684 6.0E-22
sp|O35516|NOTC2_MOUSE Neurogenic locus notch homolog protein 2 OS=Mus musculus GN=Notch2 PE=1 SV=1 353 584 6.0E-22
sp|Q9J5A7|V155_FOWPN Putative ankyrin repeat protein FPV115 OS=Fowlpox virus (strain NVSL) GN=FPV115 PE=3 SV=1 379 703 6.0E-22
sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 323 687 6.0E-22
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 344 674 8.0E-22
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 458 760 8.0E-22
sp|Q9J516|V219_FOWPN Putative ankyrin repeat protein FPV219 OS=Fowlpox virus (strain NVSL) GN=FPV219 PE=3 SV=1 407 651 9.0E-22
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 400 683 1.0E-21
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 338 619 1.0E-21
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 338 619 1.0E-21
sp|P0DJE3|LATA_LATHE Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 351 692 1.0E-21
sp|Q9J5I3|V018_FOWPN Putative ankyrin repeat protein FPV018 OS=Fowlpox virus (strain NVSL) GN=FPV018 PE=3 SV=1 365 657 1.0E-21
sp|P0C927|ASB14_RAT Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 498 673 1.0E-21
sp|P07207|NOTCH_DROME Neurogenic locus Notch protein OS=Drosophila melanogaster GN=N PE=1 SV=3 353 620 1.0E-21
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 362 690 2.0E-21
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 339 651 2.0E-21
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 339 666 2.0E-21
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 326 685 2.0E-21
sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 387 671 2.0E-21
sp|Q6GQX6|ANKS6_MOUSE Ankyrin repeat and SAM domain-containing protein 6 OS=Mus musculus GN=Anks6 PE=1 SV=2 354 633 2.0E-21
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 353 633 2.0E-21
sp|Q7TQP6|TNI3K_RAT Serine/threonine-protein kinase TNNI3K OS=Rattus norvegicus GN=Tnni3k PE=2 SV=3 329 663 2.0E-21
sp|Q08DV6|ASB3_BOVIN Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 354 625 3.0E-21
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 354 668 3.0E-21
sp|Q9J4Z6|V244_FOWPN Putative ankyrin repeat protein FPV244 OS=Fowlpox virus (strain NVSL) GN=FPV244 PE=3 SV=1 416 674 3.0E-21
sp|Q8C6Y6|ASB14_MOUSE Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 439 673 3.0E-21
sp|Q9J517|V218_FOWPN Putative ankyrin repeat protein FPV218 OS=Fowlpox virus (strain NVSL) GN=FPV218 PE=3 SV=1 413 675 3.0E-21
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 326 671 4.0E-21
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 418 674 4.0E-21
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 338 692 4.0E-21
sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 360 658 4.0E-21
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 500 685 5.0E-21
sp|Q5UPJ9|YL122_MIMIV Putative ankyrin repeat protein L122 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L122 PE=3 SV=1 339 673 5.0E-21
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 424 683 5.0E-21
sp|Q9Z2X3|PSD10_RAT 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 491 687 6.0E-21
sp|Q54HW1|PSD10_DICDI 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 500 671 6.0E-21
sp|Q8ZWC4|Y1861_PYRAE Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 407 636 7.0E-21
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 425 671 9.0E-21
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 399 671 9.0E-21
sp|Q8C6Y6|ASB14_MOUSE Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 370 655 9.0E-21
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 329 661 1.0E-20
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 433 672 1.0E-20
sp|P0DJE3|LATA_LATHE Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 340 685 1.0E-20
sp|Q92527|ANKR7_HUMAN Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 503 683 1.0E-20
sp|Q8VBX0|ASB13_MOUSE Ankyrin repeat and SOCS box protein 13 OS=Mus musculus GN=Asb13 PE=2 SV=1 433 634 1.0E-20
sp|Q5GIG6|TNI3K_MOUSE Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 329 663 1.0E-20
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 338 559 2.0E-20
sp|Q9WV72|ASB3_MOUSE Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 354 625 2.0E-20
sp|Q9J507|V228_FOWPN Putative ankyrin repeat protein FPV228 OS=Fowlpox virus (strain NVSL) GN=FPV228 PE=3 SV=1 414 683 2.0E-20
sp|P23631|LATA_LATTR Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 340 684 2.0E-20
sp|Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 388 695 2.0E-20
sp|P0C927|ASB14_RAT Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 370 655 2.0E-20
sp|Q810B6|ANFY1_MOUSE Rabankyrin-5 OS=Mus musculus GN=Ankfy1 PE=1 SV=2 324 668 2.0E-20
sp|Q0JKV1|AKT1_ORYSJ Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 397 597 2.0E-20
sp|Q71S22|INVSA_XENLA Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 357 655 2.0E-20
sp|Q3SX45|ASB2_BOVIN Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 352 659 2.0E-20
sp|P0C550|AKT1_ORYSI Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 397 597 2.0E-20
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 433 672 3.0E-20
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 350 638 3.0E-20
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 344 673 3.0E-20
sp|Q9J5H7|V024_FOWPN Putative ankyrin repeat protein FPV024 OS=Fowlpox virus (strain NVSL) GN=FPV024 PE=3 SV=1 339 669 3.0E-20
sp|Q68DC2|ANKS6_HUMAN Ankyrin repeat and SAM domain-containing protein 6 OS=Homo sapiens GN=ANKS6 PE=1 SV=2 339 633 3.0E-20
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 436 683 4.0E-20
sp|G0LXV8|LATA_LATHA Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 340 684 4.0E-20
sp|Q1RI12|Y921_RICBR Putative ankyrin repeat protein RBE_0921 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0921 PE=3 SV=1 361 689 4.0E-20
sp|P0C0T2|ANKS6_RAT Ankyrin repeat and SAM domain-containing protein 6 OS=Rattus norvegicus GN=Anks6 PE=1 SV=2 399 672 5.0E-20
sp|Q8WXK3|ASB13_HUMAN Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens GN=ASB13 PE=1 SV=2 433 634 5.0E-20
sp|Q8K0L0|ASB2_MOUSE Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 435 683 5.0E-20
sp|Q502M6|ANR29_DANRE Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 399 623 6.0E-20
sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 387 671 7.0E-20
sp|Q9J5H8|V023_FOWPN Putative ankyrin repeat protein FPV023 OS=Fowlpox virus (strain NVSL) GN=FPV023 PE=3 SV=1 444 669 7.0E-20
sp|Q05921|RN5A_MOUSE 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 492 683 8.0E-20
sp|Q06527|ANKH_ALLVD Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 327 600 9.0E-20
sp|Q4R3S3|ANKR7_MACFA Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 500 671 9.0E-20
sp|Q7Z020|TRPA1_DROME Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=4 377 689 9.0E-20
sp|Q9Z148|EHMT2_MOUSE Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 436 685 9.0E-20
sp|Q9Y575|ASB3_HUMAN Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 354 625 1.0E-19
sp|P0C927|ASB14_RAT Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 432 686 1.0E-19
sp|Q8ZWC4|Y1861_PYRAE Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 436 674 1.0E-19
sp|Q978J0|Y1425_THEVO Putative ankyrin repeat protein TV1425 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1425 PE=1 SV=1 526 676 1.0E-19
sp|Q4ULZ2|Y580_RICFE Putative ankyrin repeat protein RF_0580 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0580 PE=3 SV=1 366 612 1.0E-19
sp|Q6P6B7|ANR16_HUMAN Ankyrin repeat domain-containing protein 16 OS=Homo sapiens GN=ANKRD16 PE=1 SV=1 383 683 1.0E-19
sp|Q02989|LITA_LATTR Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 341 693 1.0E-19
sp|Q8C6Y6|ASB14_MOUSE Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 430 686 2.0E-19
sp|Q9J517|V218_FOWPN Putative ankyrin repeat protein FPV218 OS=Fowlpox virus (strain NVSL) GN=FPV218 PE=3 SV=1 436 704 2.0E-19
sp|Q3SX45|ASB2_BOVIN Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 435 683 2.0E-19
sp|Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 436 685 2.0E-19
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 353 633 2.0E-19
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 424 683 2.0E-19
sp|Q9P2R3|ANFY1_HUMAN Rabankyrin-5 OS=Homo sapiens GN=ANKFY1 PE=1 SV=2 324 668 2.0E-19
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 338 624 3.0E-19
sp|Q9J4Z4|V246_FOWPN Putative ankyrin repeat protein FPV246 OS=Fowlpox virus (strain NVSL) GN=FPV246 PE=3 SV=1 341 609 3.0E-19
sp|Q5DW34|EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 409 686 3.0E-19
sp|O75762|TRPA1_HUMAN Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 342 657 3.0E-19
sp|Q8C6Y6|ASB14_MOUSE Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 408 651 3.0E-19
sp|Q8VBX0|ASB13_MOUSE Ankyrin repeat and SOCS box protein 13 OS=Mus musculus GN=Asb13 PE=2 SV=1 481 665 3.0E-19
sp|Q8WXK3|ASB13_HUMAN Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens GN=ASB13 PE=1 SV=2 481 665 3.0E-19
sp|A6NK59|ASB14_HUMAN Ankyrin repeat and SOCS box protein 14 OS=Homo sapiens GN=ASB14 PE=2 SV=2 443 673 3.0E-19
sp|Q9FY48|KEG_ARATH E3 ubiquitin-protein ligase KEG OS=Arabidopsis thaliana GN=KEG PE=1 SV=2 352 633 3.0E-19
sp|Q9J5G9|V034_FOWPN Putative ankyrin repeat protein FPV034 OS=Fowlpox virus (strain NVSL) GN=ANK2 PE=3 SV=1 343 648 3.0E-19
sp|Q9D504|ANKR7_MOUSE Ankyrin repeat domain-containing protein 7 OS=Mus musculus GN=Ankrd7 PE=2 SV=2 403 611 3.0E-19
sp|Q91ZT9|ASB8_MOUSE Ankyrin repeat and SOCS box protein 8 OS=Mus musculus GN=Asb8 PE=2 SV=1 515 691 3.0E-19
sp|Q8UVC1|INVS_DANRE Inversin OS=Danio rerio GN=invs PE=2 SV=1 334 683 4.0E-19
sp|Q8WXK1|ASB15_HUMAN Ankyrin repeat and SOCS box protein 15 OS=Homo sapiens GN=ASB15 PE=2 SV=3 355 659 4.0E-19
sp|Q5RCK5|ASB7_PONAB Ankyrin repeat and SOCS box protein 7 OS=Pongo abelii GN=ASB7 PE=2 SV=1 344 569 4.0E-19
sp|Q4R3S3|ANKR7_MACFA Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 503 683 5.0E-19
sp|P14360|V240_FOWPN Putative ankyrin repeat protein FPV240 OS=Fowlpox virus (strain NVSL) GN=FPV240 PE=3 SV=1 497 683 5.0E-19
sp|Q9J513|V222_FOWPN Putative ankyrin repeat protein FPV222 OS=Fowlpox virus (strain NVSL) GN=FPV222 PE=3 SV=1 501 683 5.0E-19
sp|Q91ZU0|ASB7_MOUSE Ankyrin repeat and SOCS box protein 7 OS=Mus musculus GN=Asb7 PE=2 SV=2 344 569 5.0E-19
sp|Q5U2S6|ASB2_RAT Ankyrin repeat and SOCS box protein 2 OS=Rattus norvegicus GN=Asb2 PE=2 SV=1 435 683 5.0E-19
sp|Q9H672|ASB7_HUMAN Ankyrin repeat and SOCS box protein 7 OS=Homo sapiens GN=ASB7 PE=1 SV=2 344 569 5.0E-19
sp|A5PMU4|ANS1B_DANRE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 442 673 5.0E-19
sp|Q8UVC1|INVS_DANRE Inversin OS=Danio rerio GN=invs PE=2 SV=1 351 655 6.0E-19
sp|Q4R3S3|ANKR7_MACFA Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 421 621 6.0E-19
sp|Q91ZT7|ASB10_MOUSE Ankyrin repeat and SOCS box protein 10 OS=Mus musculus GN=Asb10 PE=2 SV=1 429 655 6.0E-19
sp|Q06527|ANKH_ALLVD Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 509 691 7.0E-19
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 416 672 7.0E-19
sp|Q5UPA0|YL025_MIMIV Putative ankyrin repeat protein L25 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L25 PE=3 SV=1 364 661 7.0E-19
sp|Q5UQV3|YL371_MIMIV Putative ankyrin repeat protein L371 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L371 PE=3 SV=1 408 672 7.0E-19
sp|Q6B858|FANK1_BOVIN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 463 684 7.0E-19
sp|E5RJM6|ANR65_HUMAN Ankyrin repeat domain-containing protein 65 OS=Homo sapiens GN=ANKRD65 PE=2 SV=2 409 673 8.0E-19
sp|Q54HW1|PSD10_DICDI 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 450 652 9.0E-19
sp|Q9CZK6|ANKS3_MOUSE Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 503 684 9.0E-19
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 348 603 1.0E-18
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 350 676 1.0E-18
sp|E5RJM6|ANR65_HUMAN Ankyrin repeat domain-containing protein 65 OS=Homo sapiens GN=ANKRD65 PE=2 SV=2 431 671 1.0E-18
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 399 672 1.0E-18
sp|Q9J516|V219_FOWPN Putative ankyrin repeat protein FPV219 OS=Fowlpox virus (strain NVSL) GN=FPV219 PE=3 SV=1 413 658 1.0E-18
sp|Q9J517|V218_FOWPN Putative ankyrin repeat protein FPV218 OS=Fowlpox virus (strain NVSL) GN=FPV218 PE=3 SV=1 342 602 1.0E-18
sp|Q71S22|INVSA_XENLA Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 352 683 1.0E-18
sp|Q5RCK5|ASB7_PONAB Ankyrin repeat and SOCS box protein 7 OS=Pongo abelii GN=ASB7 PE=2 SV=1 368 611 1.0E-18
sp|Q08E43|ASB8_BOVIN Ankyrin repeat and SOCS box protein 8 OS=Bos taurus GN=ASB8 PE=2 SV=1 515 669 1.0E-18
sp|Q6S545|POTEH_HUMAN POTE ankyrin domain family member H OS=Homo sapiens GN=POTEH PE=2 SV=3 513 722 1.0E-18
sp|Q9BGT9|ASB7_MACFA Ankyrin repeat and SOCS box protein 7 OS=Macaca fascicularis GN=ASB7 PE=2 SV=1 368 635 1.0E-18
sp|Q8HXA6|ASB15_BOVIN Ankyrin repeat and SOCS box protein 15 OS=Bos taurus GN=ASB15 PE=2 SV=2 355 659 1.0E-18
sp|A6NI47|POTEM_HUMAN Putative POTE ankyrin domain family member M OS=Homo sapiens GN=POTEM PE=3 SV=2 513 722 1.0E-18
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 497 683 2.0E-18
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 500 683 2.0E-18
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 500 683 2.0E-18
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 334 589 2.0E-18
sp|Q05823|RN5A_HUMAN 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 337 560 2.0E-18
sp|Q9J4Z5|V245_FOWPN Putative ankyrin repeat protein FPV245 OS=Fowlpox virus (strain NVSL) GN=FPV245 PE=3 SV=1 440 685 2.0E-18
sp|A2A690|TANC2_MOUSE Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 422 683 2.0E-18
sp|Q1RK13|Y220_RICBR Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 344 557 2.0E-18
sp|Q6RI86|TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 425 683 2.0E-18
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 355 683 2.0E-18
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 399 672 2.0E-18
sp|P0C927|ASB14_RAT Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 531 674 2.0E-18
sp|Q9J513|V222_FOWPN Putative ankyrin repeat protein FPV222 OS=Fowlpox virus (strain NVSL) GN=FPV222 PE=3 SV=1 340 683 2.0E-18
sp|Q9BGT9|ASB7_MACFA Ankyrin repeat and SOCS box protein 7 OS=Macaca fascicularis GN=ASB7 PE=2 SV=1 344 569 2.0E-18
sp|Q5JPF3|AN36C_HUMAN Ankyrin repeat domain-containing protein 36C OS=Homo sapiens GN=ANKRD36C PE=2 SV=3 481 717 2.0E-18
sp|Q5R6D7|ASB8_PONAB Ankyrin repeat and SOCS box protein 8 OS=Pongo abelii GN=ASB8 PE=2 SV=1 515 669 2.0E-18
sp|Q9H765|ASB8_HUMAN Ankyrin repeat and SOCS box protein 8 OS=Homo sapiens GN=ASB8 PE=2 SV=1 515 669 2.0E-18
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 365 652 3.0E-18
sp|Q8N6D5|ANR29_HUMAN Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 353 601 3.0E-18
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 334 683 3.0E-18
sp|Q8VBX0|ASB13_MOUSE Ankyrin repeat and SOCS box protein 13 OS=Mus musculus GN=Asb13 PE=2 SV=1 534 696 3.0E-18
sp|Q3SZE4|ASB11_BOVIN Ankyrin repeat and SOCS box protein 11 OS=Bos taurus GN=ASB11 PE=2 SV=1 437 683 3.0E-18
sp|Q4R544|ASB8_MACFA Ankyrin repeat and SOCS box protein 8 OS=Macaca fascicularis GN=ASB8 PE=2 SV=1 515 669 3.0E-18
sp|Q6S8J3|POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 513 715 3.0E-18
sp|Q66H07|FANK1_RAT Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 463 690 3.0E-18
sp|Q5M9H0|ANKS3_RAT Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 488 684 3.0E-18
sp|H3BUK9|POTB2_HUMAN POTE ankyrin domain family member B2 OS=Homo sapiens GN=POTEB2 PE=3 SV=1 513 716 3.0E-18
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 490 694 4.0E-18
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 348 554 4.0E-18
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 500 685 4.0E-18
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 339 685 4.0E-18
sp|Q8WXK3|ASB13_HUMAN Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens GN=ASB13 PE=1 SV=2 534 696 4.0E-18
sp|A6NK59|ASB14_HUMAN Ankyrin repeat and SOCS box protein 14 OS=Homo sapiens GN=ASB14 PE=2 SV=2 370 655 4.0E-18
sp|Q91ZU0|ASB7_MOUSE Ankyrin repeat and SOCS box protein 7 OS=Mus musculus GN=Asb7 PE=2 SV=2 368 635 4.0E-18
sp|Q5U2S6|ASB2_RAT Ankyrin repeat and SOCS box protein 2 OS=Rattus norvegicus GN=Asb2 PE=2 SV=1 408 651 4.0E-18
sp|Q9H672|ASB7_HUMAN Ankyrin repeat and SOCS box protein 7 OS=Homo sapiens GN=ASB7 PE=1 SV=2 368 635 4.0E-18
sp|A5A3E0|POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2 513 715 4.0E-18
sp|Q9HCD6|TANC2_HUMAN Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 422 683 5.0E-18
sp|Q8N6D5|ANR29_HUMAN Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 498 668 5.0E-18
sp|Q96Q27|ASB2_HUMAN Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 435 683 5.0E-18
sp|F1N6G5|HACE1_BOVIN E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 511 674 5.0E-18
sp|Q6S5H5|POTEG_HUMAN POTE ankyrin domain family member G OS=Homo sapiens GN=POTEG PE=2 SV=5 513 722 5.0E-18
sp|Q05921|RN5A_MOUSE 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 363 623 6.0E-18
sp|Q9J5I7|V014_FOWPN Putative ankyrin repeat protein FPV014 OS=Fowlpox virus (strain NVSL) GN=FPV014 PE=3 SV=1 436 683 6.0E-18
sp|Q6F6B3|TANC1_RAT Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 348 523 6.0E-18
sp|P23631|LATA_LATTR Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 336 689 6.0E-18
sp|Q6S5H4|POTEB_HUMAN POTE ankyrin domain family member B OS=Homo sapiens GN=POTEB PE=2 SV=1 513 716 6.0E-18
sp|A0JP26|POTB3_HUMAN POTE ankyrin domain family member B3 OS=Homo sapiens GN=POTEB3 PE=2 SV=2 513 716 6.0E-18
sp|Q0VGY8|TANC1_MOUSE Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 348 523 7.0E-18
sp|Q8BLA8|TRPA1_MOUSE Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 432 683 7.0E-18
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 399 672 7.0E-18
sp|Q8VHS6|ASB15_MOUSE Ankyrin repeat and SOCS box protein 15 OS=Mus musculus GN=Asb15 PE=2 SV=2 355 659 8.0E-18
sp|Q0JKV1|AKT1_ORYSJ Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 415 618 9.0E-18
sp|Q502M6|ANR29_DANRE Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 499 668 9.0E-18
sp|Q5U2S6|ASB2_RAT Ankyrin repeat and SOCS box protein 2 OS=Rattus norvegicus GN=Asb2 PE=2 SV=1 401 659 9.0E-18
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 351 655 1.0E-17
sp|Q9J5I3|V018_FOWPN Putative ankyrin repeat protein FPV018 OS=Fowlpox virus (strain NVSL) GN=FPV018 PE=3 SV=1 415 683 1.0E-17
sp|Q3SX45|ASB2_BOVIN Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 413 651 1.0E-17
sp|P0C550|AKT1_ORYSI Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 415 618 1.0E-17
sp|Q9D504|ANKR7_MOUSE Ankyrin repeat domain-containing protein 7 OS=Mus musculus GN=Ankrd7 PE=2 SV=2 497 671 1.0E-17
sp|Q9J504|V231_FOWPN Putative ankyrin repeat protein FPV231 OS=Fowlpox virus (strain NVSL) GN=FPV231 PE=3 SV=1 443 608 1.0E-17
sp|Q9J504|V231_FOWPN Putative ankyrin repeat protein FPV231 OS=Fowlpox virus (strain NVSL) GN=FPV231 PE=3 SV=1 479 635 1.0E-17
sp|Q8H569|AKT3_ORYSJ Potassium channel AKT3 OS=Oryza sativa subsp. japonica GN=Os07g0175400 PE=3 SV=1 353 547 1.0E-17
sp|Q1RHT6|Y997_RICBR Putative ankyrin repeat protein RBE_0997 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0997 PE=3 SV=1 402 751 1.0E-17
sp|Q6DCL5|HACE1_XENLA E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 476 674 1.0E-17
sp|Q28BK1|HACE1_XENTR E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 476 674 1.0E-17
sp|Q9J507|V228_FOWPN Putative ankyrin repeat protein FPV228 OS=Fowlpox virus (strain NVSL) GN=FPV228 PE=3 SV=1 323 606 2.0E-17
sp|Q05921|RN5A_MOUSE 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 339 557 2.0E-17
sp|A6QPE7|ANR65_BOVIN Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 336 631 2.0E-17
sp|Q9J516|V219_FOWPN Putative ankyrin repeat protein FPV219 OS=Fowlpox virus (strain NVSL) GN=FPV219 PE=3 SV=1 461 683 2.0E-17
sp|Q8K0L0|ASB2_MOUSE Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 408 651 2.0E-17
sp|Q8K0L0|ASB2_MOUSE Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 339 659 2.0E-17
sp|Q02989|LITA_LATTR Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 354 693 2.0E-17
sp|Q9J5G9|V034_FOWPN Putative ankyrin repeat protein FPV034 OS=Fowlpox virus (strain NVSL) GN=ANK2 PE=3 SV=1 439 674 2.0E-17
sp|Q5RCK5|ASB7_PONAB Ankyrin repeat and SOCS box protein 7 OS=Pongo abelii GN=ASB7 PE=2 SV=1 433 672 2.0E-17
sp|Q9J513|V222_FOWPN Putative ankyrin repeat protein FPV222 OS=Fowlpox virus (strain NVSL) GN=FPV222 PE=3 SV=1 345 686 2.0E-17
sp|Q8IYU2|HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 511 674 2.0E-17
sp|Q3U0D9|HACE1_MOUSE E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 511 674 2.0E-17
sp|D3ZBM7|HACE1_RAT E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 511 674 2.0E-17
sp|Q5DU14|MYO16_MOUSE Unconventional myosin-XVI OS=Mus musculus GN=Myo16 PE=1 SV=2 368 660 2.0E-17
sp|P0CG39|POTEJ_HUMAN POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 514 715 2.0E-17
sp|Q8TC84|FANK1_HUMAN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 463 684 2.0E-17
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 363 652 3.0E-17
sp|Q6RI86|TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 342 683 3.0E-17
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 345 683 3.0E-17
sp|Q810B6|ANFY1_MOUSE Rabankyrin-5 OS=Mus musculus GN=Ankfy1 PE=1 SV=2 330 683 3.0E-17
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 443 707 3.0E-17
sp|Q9H672|ASB7_HUMAN Ankyrin repeat and SOCS box protein 7 OS=Homo sapiens GN=ASB7 PE=1 SV=2 439 672 3.0E-17
sp|P0CG38|POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 514 715 3.0E-17
sp|F8W2M1|HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 476 674 3.0E-17
sp|Q9DAM9|FANK1_MOUSE Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 463 690 3.0E-17
sp|Q9J502|V233_FOWPN Putative ankyrin repeat protein FPV233 OS=Fowlpox virus (strain NVSL) GN=FPV233 PE=3 SV=1 351 540 3.0E-17
sp|B2RU33|POTEC_HUMAN POTE ankyrin domain family member C OS=Homo sapiens GN=POTEC PE=2 SV=2 513 716 3.0E-17
sp|A6NGH8|ANR61_HUMAN Ankyrin repeat domain-containing protein 61 OS=Homo sapiens GN=ANKRD61 PE=3 SV=2 431 673 3.0E-17
sp|A2AS55|ANR16_MOUSE Ankyrin repeat domain-containing protein 16 OS=Mus musculus GN=Ankrd16 PE=2 SV=1 399 683 3.0E-17
sp|Q9C0D5|TANC1_HUMAN Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 372 591 4.0E-17
sp|Q5REW9|ANR27_PONAB Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 339 677 4.0E-17
sp|Q8N6D5|ANR29_HUMAN Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 339 568 4.0E-17
sp|Q502M6|ANR29_DANRE Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 353 590 4.0E-17
sp|Q4R3S3|ANKR7_MACFA Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 400 578 4.0E-17
sp|Q8WXK1|ASB15_HUMAN Ankyrin repeat and SOCS box protein 15 OS=Homo sapiens GN=ASB15 PE=2 SV=3 428 683 4.0E-17
sp|Q91ZU0|ASB7_MOUSE Ankyrin repeat and SOCS box protein 7 OS=Mus musculus GN=Asb7 PE=2 SV=2 439 672 4.0E-17
sp|Q5UQV3|YL371_MIMIV Putative ankyrin repeat protein L371 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L371 PE=3 SV=1 353 608 4.0E-17
sp|Q08E43|ASB8_BOVIN Ankyrin repeat and SOCS box protein 8 OS=Bos taurus GN=ASB8 PE=2 SV=1 484 640 4.0E-17
sp|Q9J502|V233_FOWPN Putative ankyrin repeat protein FPV233 OS=Fowlpox virus (strain NVSL) GN=FPV233 PE=3 SV=1 416 608 4.0E-17
sp|P59672|ANS1A_MOUSE Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus GN=Anks1a PE=1 SV=3 421 668 4.0E-17
sp|Q9ERC1|MYO16_RAT Unconventional myosin-XVI OS=Rattus norvegicus GN=Myo16 PE=1 SV=1 368 614 4.0E-17
sp|Q9ET47|ESPN_MOUSE Espin OS=Mus musculus GN=Espn PE=1 SV=2 432 671 4.0E-17
sp|Q8VD46|ASZ1_MOUSE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mus musculus GN=Asz1 PE=1 SV=2 503 694 4.0E-17
sp|Q9J569|V162_FOWPN Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 461 668 5.0E-17
sp|Q9J5H8|V023_FOWPN Putative ankyrin repeat protein FPV023 OS=Fowlpox virus (strain NVSL) GN=FPV023 PE=3 SV=1 328 569 5.0E-17
sp|Q9BXX2|AN30B_HUMAN Ankyrin repeat domain-containing protein 30B OS=Homo sapiens GN=ANKRD30B PE=2 SV=3 383 667 5.0E-17
sp|Q86YR6|POTED_HUMAN POTE ankyrin domain family member D OS=Homo sapiens GN=POTED PE=2 SV=2 421 620 5.0E-17
sp|P0C927|ASB14_RAT Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 351 662 6.0E-17
sp|Q0JKV1|AKT1_ORYSJ Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 518 671 6.0E-17
sp|Q9P2R3|ANFY1_HUMAN Rabankyrin-5 OS=Homo sapiens GN=ANKFY1 PE=1 SV=2 330 683 6.0E-17
sp|Q9FY48|KEG_ARATH E3 ubiquitin-protein ligase KEG OS=Arabidopsis thaliana GN=KEG PE=1 SV=2 394 711 6.0E-17
sp|Q5ZIJ9|MIB2_CHICK E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus GN=MIB2 PE=2 SV=1 320 635 6.0E-17
sp|Q9EP71|RAI14_MOUSE Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 478 683 6.0E-17
sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 424 683 7.0E-17
sp|P0C550|AKT1_ORYSI Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 518 671 7.0E-17
sp|Q7Z020|TRPA1_DROME Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=4 343 672 7.0E-17
sp|Q91ZT9|ASB8_MOUSE Ankyrin repeat and SOCS box protein 8 OS=Mus musculus GN=Asb8 PE=2 SV=1 484 640 7.0E-17
sp|Q86YR6|POTED_HUMAN POTE ankyrin domain family member D OS=Homo sapiens GN=POTED PE=2 SV=2 513 716 7.0E-17
sp|E1C656|HACE1_CHICK E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 511 674 7.0E-17
sp|Q8N283|ANR35_HUMAN Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 498 686 7.0E-17
sp|Q05921|RN5A_MOUSE 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 342 590 8.0E-17
sp|Q96Q27|ASB2_HUMAN Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 408 651 8.0E-17
sp|Q9VUX2|MIB_DROME E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 432 687 8.0E-17
sp|A6NHY2|AKD1B_HUMAN Ankyrin repeat and death domain-containing protein 1B OS=Homo sapiens GN=ANKDD1B PE=3 SV=3 363 687 8.0E-17
sp|P07207|NOTCH_DROME Neurogenic locus Notch protein OS=Drosophila melanogaster GN=N PE=1 SV=3 399 653 9.0E-17
sp|Q3KP44|ANR55_HUMAN Ankyrin repeat domain-containing protein 55 OS=Homo sapiens GN=ANKRD55 PE=2 SV=3 401 699 9.0E-17
sp|Q5RFS1|ASB11_PONAB Ankyrin repeat and SOCS box protein 11 OS=Pongo abelii GN=ASB11 PE=2 SV=1 466 683 9.0E-17
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 512 686 1.0E-16
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 500 685 1.0E-16
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 343 619 1.0E-16
sp|Q71S21|INVSB_XENLA Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 358 622 1.0E-16
sp|Q8BLA8|TRPA1_MOUSE Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 342 683 1.0E-16
sp|Q4R3S3|ANKR7_MACFA Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 454 654 1.0E-16
sp|Q9J513|V222_FOWPN Putative ankyrin repeat protein FPV222 OS=Fowlpox virus (strain NVSL) GN=FPV222 PE=3 SV=1 414 625 1.0E-16
sp|H3BUK9|POTB2_HUMAN POTE ankyrin domain family member B2 OS=Homo sapiens GN=POTEB2 PE=3 SV=1 421 620 1.0E-16
sp|Q6ZW76|ANKS3_HUMAN Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens GN=ANKS3 PE=1 SV=1 503 694 1.0E-16
sp|Q8GXE6|AKT6_ARATH Potassium channel AKT6 OS=Arabidopsis thaliana GN=AKT6 PE=1 SV=2 436 660 1.0E-16
sp|Q862Z2|ASB5_RABIT Ankyrin repeat and SOCS box protein 5 OS=Oryctolagus cuniculus GN=ASB5 PE=2 SV=1 422 659 1.0E-16
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 230 666 2.0E-16
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 497 671 2.0E-16
sp|Q5UPF8|YL088_MIMIV Putative ankyrin repeat protein L88 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L88 PE=3 SV=1 344 683 2.0E-16
sp|Q9C0D5|TANC1_HUMAN Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 348 523 2.0E-16
sp|Q5URB8|YR841_MIMIV Putative ankyrin repeat protein R841 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R841 PE=3 SV=1 413 669 2.0E-16
sp|Q9J516|V219_FOWPN Putative ankyrin repeat protein FPV219 OS=Fowlpox virus (strain NVSL) GN=FPV219 PE=3 SV=1 339 587 2.0E-16
sp|Q9J513|V222_FOWPN Putative ankyrin repeat protein FPV222 OS=Fowlpox virus (strain NVSL) GN=FPV222 PE=3 SV=1 339 664 2.0E-16
sp|Q5UQV3|YL371_MIMIV Putative ankyrin repeat protein L371 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L371 PE=3 SV=1 398 620 2.0E-16
sp|Q9BGT9|ASB7_MACFA Ankyrin repeat and SOCS box protein 7 OS=Macaca fascicularis GN=ASB7 PE=2 SV=1 439 672 2.0E-16
sp|Q5R6D7|ASB8_PONAB Ankyrin repeat and SOCS box protein 8 OS=Pongo abelii GN=ASB8 PE=2 SV=1 484 640 2.0E-16
sp|Q9H765|ASB8_HUMAN Ankyrin repeat and SOCS box protein 8 OS=Homo sapiens GN=ASB8 PE=2 SV=1 484 640 2.0E-16
sp|P0C6P7|FEM1B_RAT Protein fem-1 homolog B OS=Rattus norvegicus GN=Fem1b PE=1 SV=1 467 668 2.0E-16
sp|Q9Z2G0|FEM1B_MOUSE Protein fem-1 homolog B OS=Mus musculus GN=Fem1b PE=1 SV=1 467 668 2.0E-16
sp|Q5URB9|YR840_MIMIV Putative ankyrin repeat protein R840 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R840 PE=3 SV=1 365 717 2.0E-16
sp|Q9UK73|FEM1B_HUMAN Protein fem-1 homolog B OS=Homo sapiens GN=FEM1B PE=1 SV=1 467 668 2.0E-16
sp|Q9J569|V162_FOWPN Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 501 674 3.0E-16
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 500 685 3.0E-16
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 497 671 3.0E-16
sp|Q25338|LITD_LATTR Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 413 683 3.0E-16
sp|Q9J4Z5|V245_FOWPN Putative ankyrin repeat protein FPV245 OS=Fowlpox virus (strain NVSL) GN=FPV245 PE=3 SV=1 339 569 3.0E-16
sp|Q4ULZ2|Y580_RICFE Putative ankyrin repeat protein RF_0580 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0580 PE=3 SV=1 405 624 3.0E-16
sp|Q4R544|ASB8_MACFA Ankyrin repeat and SOCS box protein 8 OS=Macaca fascicularis GN=ASB8 PE=2 SV=1 484 640 3.0E-16
sp|Q6S5H4|POTEB_HUMAN POTE ankyrin domain family member B OS=Homo sapiens GN=POTEB PE=2 SV=1 421 620 3.0E-16
sp|A0JP26|POTB3_HUMAN POTE ankyrin domain family member B3 OS=Homo sapiens GN=POTEB3 PE=2 SV=2 421 620 3.0E-16
sp|Q9J502|V233_FOWPN Putative ankyrin repeat protein FPV233 OS=Fowlpox virus (strain NVSL) GN=FPV233 PE=3 SV=1 512 694 3.0E-16
sp|Q9VUX2|MIB_DROME E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 399 650 3.0E-16
sp|B1AK53|ESPN_HUMAN Espin OS=Homo sapiens GN=ESPN PE=1 SV=1 432 671 3.0E-16
sp|Q9Y574|ASB4_HUMAN Ankyrin repeat and SOCS box protein 4 OS=Homo sapiens GN=ASB4 PE=2 SV=1 463 677 3.0E-16
sp|Q14DN9|AKD1B_MOUSE Ankyrin repeat and death domain-containing protein 1B OS=Mus musculus GN=Ankdd1b PE=2 SV=3 380 687 3.0E-16
sp|Q8BLD6|ANR55_MOUSE Ankyrin repeat domain-containing protein 55 OS=Mus musculus GN=Ankrd55 PE=1 SV=2 354 698 3.0E-16
sp|Q8N2N9|AN36B_HUMAN Ankyrin repeat domain-containing protein 36B OS=Homo sapiens GN=ANKRD36B PE=1 SV=4 513 674 3.0E-16
sp|Q05823|RN5A_HUMAN 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 341 592 4.0E-16
sp|Q8C6Y6|ASB14_MOUSE Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 348 662 4.0E-16
sp|Q92527|ANKR7_HUMAN Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 500 657 4.0E-16
sp|Q71S22|INVSA_XENLA Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 358 622 4.0E-16
sp|Q9D504|ANKR7_MOUSE Ankyrin repeat domain-containing protein 7 OS=Mus musculus GN=Ankrd7 PE=2 SV=2 348 578 4.0E-16
sp|Q8WXK1|ASB15_HUMAN Ankyrin repeat and SOCS box protein 15 OS=Homo sapiens GN=ASB15 PE=2 SV=3 429 683 4.0E-16
sp|Q8VHS6|ASB15_MOUSE Ankyrin repeat and SOCS box protein 15 OS=Mus musculus GN=Asb15 PE=2 SV=2 428 683 4.0E-16
sp|Q5ZIJ9|MIB2_CHICK E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus GN=MIB2 PE=2 SV=1 415 712 4.0E-16
sp|Q3KP44|ANR55_HUMAN Ankyrin repeat domain-containing protein 55 OS=Homo sapiens GN=ANKRD55 PE=2 SV=3 354 650 4.0E-16
sp|Q5URB9|YR840_MIMIV Putative ankyrin repeat protein R840 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R840 PE=3 SV=1 338 658 4.0E-16
sp|Q92527|ANKR7_HUMAN Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 421 591 5.0E-16
sp|A2AS55|ANR16_MOUSE Ankyrin repeat domain-containing protein 16 OS=Mus musculus GN=Ankrd16 PE=2 SV=1 353 654 5.0E-16
sp|Q96DX5|ASB9_HUMAN Ankyrin repeat and SOCS box protein 9 OS=Homo sapiens GN=ASB9 PE=1 SV=1 501 665 5.0E-16
sp|Q92625|ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 454 668 5.0E-16
sp|Q9J5H5|V026_FOWPN Putative ankyrin repeat protein FPV026 OS=Fowlpox virus (strain NVSL) GN=FPV026 PE=3 SV=1 465 656 5.0E-16
sp|Q5UPG0|YL086_MIMIV Putative ankyrin repeat protein L86 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L86 PE=3 SV=1 342 687 5.0E-16
sp|Q9R172|NOTC3_RAT Neurogenic locus notch homolog protein 3 OS=Rattus norvegicus GN=Notch3 PE=2 SV=2 415 641 5.0E-16
sp|B2RU33|POTEC_HUMAN POTE ankyrin domain family member C OS=Homo sapiens GN=POTEC PE=2 SV=2 421 620 6.0E-16
sp|Q2IBB2|CTTB2_RHIFE Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 534 683 6.0E-16
sp|Q5UPG7|YL091_MIMIV Putative ankyrin repeat protein L91 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L91 PE=3 SV=1 376 671 6.0E-16
sp|Q9J5A7|V155_FOWPN Putative ankyrin repeat protein FPV115 OS=Fowlpox virus (strain NVSL) GN=FPV115 PE=3 SV=1 435 683 7.0E-16
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 344 593 7.0E-16
sp|A6NK59|ASB14_HUMAN Ankyrin repeat and SOCS box protein 14 OS=Homo sapiens GN=ASB14 PE=2 SV=2 530 684 7.0E-16
sp|Q9R172|NOTC3_RAT Neurogenic locus notch homolog protein 3 OS=Rattus norvegicus GN=Notch3 PE=2 SV=2 351 602 7.0E-16
sp|Q653P0|KOR1_ORYSJ Potassium channel KOR1 OS=Oryza sativa subsp. japonica GN=Os06g0250600 PE=2 SV=1 512 699 7.0E-16
sp|Q63618|ESPN_RAT Espin OS=Rattus norvegicus GN=Espn PE=1 SV=2 432 671 7.0E-16
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 527 683 8.0E-16
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 536 671 8.0E-16
sp|Q810B6|ANFY1_MOUSE Rabankyrin-5 OS=Mus musculus GN=Ankfy1 PE=1 SV=2 327 673 8.0E-16
sp|Q9J4Z6|V244_FOWPN Putative ankyrin repeat protein FPV244 OS=Fowlpox virus (strain NVSL) GN=FPV244 PE=3 SV=1 333 496 9.0E-16
sp|Q6P9Z4|FEM1A_DANRE Protein fem-1 homolog A OS=Danio rerio GN=fem1a PE=2 SV=1 347 552 9.0E-16
sp|O44997|DAPK_CAEEL Death-associated protein kinase dapk-1 OS=Caenorhabditis elegans GN=dapk-1 PE=2 SV=2 398 689 9.0E-16
sp|Q61982|NOTC3_MOUSE Neurogenic locus notch homolog protein 3 OS=Mus musculus GN=Notch3 PE=1 SV=1 351 602 9.0E-16
sp|Q61982|NOTC3_MOUSE Neurogenic locus notch homolog protein 3 OS=Mus musculus GN=Notch3 PE=1 SV=1 415 641 9.0E-16
sp|Q8IUH5|ZDH17_HUMAN Palmitoyltransferase ZDHHC17 OS=Homo sapiens GN=ZDHHC17 PE=1 SV=2 484 686 9.0E-16
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 345 683 1.0E-15
sp|P0DJE3|LATA_LATHE Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 339 689 1.0E-15
sp|Q92527|ANKR7_HUMAN Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 387 557 1.0E-15
sp|Q91ZT7|ASB10_MOUSE Ankyrin repeat and SOCS box protein 10 OS=Mus musculus GN=Asb10 PE=2 SV=1 467 696 1.0E-15
sp|Q9J504|V231_FOWPN Putative ankyrin repeat protein FPV231 OS=Fowlpox virus (strain NVSL) GN=FPV231 PE=3 SV=1 416 569 1.0E-15
sp|Q5ZIJ9|MIB2_CHICK E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus GN=MIB2 PE=2 SV=1 344 681 1.0E-15
sp|Q9EP71|RAI14_MOUSE Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 403 591 1.0E-15
sp|Q5UPG7|YL091_MIMIV Putative ankyrin repeat protein L91 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L91 PE=3 SV=1 342 674 1.0E-15
sp|Q8WWX0|ASB5_HUMAN Ankyrin repeat and SOCS box protein 5 OS=Homo sapiens GN=ASB5 PE=2 SV=1 422 659 1.0E-15
sp|Q5U312|RAI14_RAT Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 478 683 1.0E-15
sp|Q9WV71|ASB4_MOUSE Ankyrin repeat and SOCS box protein 4 OS=Mus musculus GN=Asb4 PE=1 SV=1 463 677 1.0E-15
sp|Q38998|AKT1_ARATH Potassium channel AKT1 OS=Arabidopsis thaliana GN=AKT1 PE=1 SV=2 518 689 1.0E-15
sp|Q641X1|ANR61_RAT Ankyrin repeat domain-containing protein 61 OS=Rattus norvegicus GN=Ankrd61 PE=2 SV=1 435 635 1.0E-15
sp|Q18297|TRPA1_CAEEL Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans GN=trpa-1 PE=2 SV=5 352 693 1.0E-15
sp|P0C6S7|ANS1B_RAT Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus GN=Anks1b PE=1 SV=1 454 684 1.0E-15
sp|Q7Z6G8|ANS1B_HUMAN Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens GN=ANKS1B PE=1 SV=2 454 684 1.0E-15
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 503 686 2.0E-15
sp|Q9J569|V162_FOWPN Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 334 548 2.0E-15
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 536 671 2.0E-15
sp|E5RJM6|ANR65_HUMAN Ankyrin repeat domain-containing protein 65 OS=Homo sapiens GN=ANKRD65 PE=2 SV=2 336 622 2.0E-15
sp|Q9J4Z6|V244_FOWPN Putative ankyrin repeat protein FPV244 OS=Fowlpox virus (strain NVSL) GN=FPV244 PE=3 SV=1 349 597 2.0E-15
sp|Q71S21|INVSB_XENLA Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 342 589 2.0E-15
sp|Q8N6D5|ANR29_HUMAN Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 524 673 2.0E-15
sp|Q5DW34|EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 512 690 2.0E-15
sp|Q502M6|ANR29_DANRE Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 339 568 2.0E-15
sp|Q9P2R3|ANFY1_HUMAN Rabankyrin-5 OS=Homo sapiens GN=ANKFY1 PE=1 SV=2 327 675 2.0E-15
sp|Q6S545|POTEH_HUMAN POTE ankyrin domain family member H OS=Homo sapiens GN=POTEH PE=2 SV=3 421 620 2.0E-15
sp|Q6S8J3|POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 421 600 2.0E-15
sp|Q8H569|AKT3_ORYSJ Potassium channel AKT3 OS=Oryza sativa subsp. japonica GN=Os07g0175400 PE=3 SV=1 518 674 2.0E-15
sp|Q8H569|AKT3_ORYSJ Potassium channel AKT3 OS=Oryza sativa subsp. japonica GN=Os07g0175400 PE=3 SV=1 405 580 2.0E-15
sp|P0CG39|POTEJ_HUMAN POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 421 600 2.0E-15
sp|P0CG39|POTEJ_HUMAN POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 450 633 2.0E-15
sp|P0CG38|POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 421 600 2.0E-15
sp|P0CG38|POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 450 633 2.0E-15
sp|Q9J502|V233_FOWPN Putative ankyrin repeat protein FPV233 OS=Fowlpox virus (strain NVSL) GN=FPV233 PE=3 SV=1 378 575 2.0E-15
sp|Q9J5H5|V026_FOWPN Putative ankyrin repeat protein FPV026 OS=Fowlpox virus (strain NVSL) GN=FPV026 PE=3 SV=1 494 683 2.0E-15
sp|A6QL64|AN36A_HUMAN Ankyrin repeat domain-containing protein 36A OS=Homo sapiens GN=ANKRD36 PE=2 SV=3 513 717 2.0E-15
sp|Q2IBB4|ASZ1_RHIFE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Rhinolophus ferrumequinum GN=ASZ1 PE=3 SV=1 503 696 2.0E-15
sp|Q9CQ31|ASB11_MOUSE Ankyrin repeat and SOCS box protein 11 OS=Mus musculus GN=Asb11 PE=2 SV=1 437 683 2.0E-15
sp|P17221|FEM1_CAEEL Sex-determining protein fem-1 OS=Caenorhabditis elegans GN=fem-1 PE=1 SV=1 498 664 2.0E-15
sp|Q8BIZ1|ANS1B_MOUSE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus GN=Anks1b PE=1 SV=3 454 684 2.0E-15
sp|Q09YK4|CTTB2_ATEGE Cortactin-binding protein 2 OS=Ateles geoffroyi GN=CTTNBP2 PE=3 SV=1 534 683 2.0E-15
sp|Q80TN5|ZDH17_MOUSE Palmitoyltransferase ZDHHC17 OS=Mus musculus GN=Zdhhc17 PE=1 SV=2 484 686 2.0E-15
sp|Q25338|LITD_LATTR Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 344 673 3.0E-15
sp|Q6GQX6|ANKS6_MOUSE Ankyrin repeat and SAM domain-containing protein 6 OS=Mus musculus GN=Anks6 PE=1 SV=2 339 662 3.0E-15
sp|Q3SX45|ASB2_BOVIN Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 342 626 3.0E-15
sp|Q02989|LITA_LATTR Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 339 685 3.0E-15
sp|Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 467 690 3.0E-15
sp|Q9D504|ANKR7_MOUSE Ankyrin repeat domain-containing protein 7 OS=Mus musculus GN=Ankrd7 PE=2 SV=2 471 672 3.0E-15
sp|A6NI47|POTEM_HUMAN Putative POTE ankyrin domain family member M OS=Homo sapiens GN=POTEM PE=3 SV=2 421 620 3.0E-15
sp|Q8TC84|FANK1_HUMAN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 425 628 3.0E-15
sp|Q6P9Z4|FEM1A_DANRE Protein fem-1 homolog A OS=Danio rerio GN=fem1a PE=2 SV=1 436 651 3.0E-15
sp|Q80SY4|MIB1_MOUSE E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 399 638 3.0E-15
sp|A4D7T3|ASZ1_MACEU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Macropus eugenii GN=ASZ1 PE=3 SV=1 503 696 3.0E-15
sp|P46530|NOTC1_DANRE Neurogenic locus notch homolog protein 1 OS=Danio rerio GN=notch1a PE=2 SV=1 353 620 3.0E-15
sp|Q9UM47|NOTC3_HUMAN Neurogenic locus notch homolog protein 3 OS=Homo sapiens GN=NOTCH3 PE=1 SV=2 351 602 3.0E-15
sp|Q9Y6X6|MYO16_HUMAN Unconventional myosin-XVI OS=Homo sapiens GN=MYO16 PE=2 SV=3 368 590 3.0E-15
sp|E9PTT0|ZDH17_RAT Palmitoyltransferase ZDHHC17 OS=Rattus norvegicus GN=Zdhhc17 PE=1 SV=1 484 686 3.0E-15
sp|Q86YT6|MIB1_HUMAN E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 399 638 3.0E-15
sp|Q8T2Q0|ZDHC6_DICDI Putative ZDHHC-type palmitoyltransferase 6 OS=Dictyostelium discoideum GN=DDB_G0275149 PE=2 SV=1 499 666 3.0E-15
sp|Q9Z2F6|BCL3_MOUSE B-cell lymphoma 3 protein homolog OS=Mus musculus GN=Bcl3 PE=1 SV=2 500 681 3.0E-15
sp|Q99PE2|ANRA2_MOUSE Ankyrin repeat family A protein 2 OS=Mus musculus GN=Ankra2 PE=1 SV=1 559 684 3.0E-15
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 489 683 4.0E-15
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 337 639 4.0E-15
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 344 683 4.0E-15
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 358 622 4.0E-15
sp|Q68DC2|ANKS6_HUMAN Ankyrin repeat and SAM domain-containing protein 6 OS=Homo sapiens GN=ANKS6 PE=1 SV=2 399 662 4.0E-15
sp|Q8TC84|FANK1_HUMAN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 399 587 4.0E-15
sp|Q9VUX2|MIB_DROME E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 338 602 4.0E-15
sp|Q8CEF1|FEM1C_MOUSE Protein fem-1 homolog C OS=Mus musculus GN=Fem1c PE=2 SV=1 433 654 4.0E-15
sp|Q4X251|AKR1_ASPFU Palmitoyltransferase akr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=akr1 PE=3 SV=2 461 668 4.0E-15
sp|A0M8T3|ASZ1_FELCA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Felis catus GN=ASZ1 PE=3 SV=1 503 694 4.0E-15
sp|O75762|TRPA1_HUMAN Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 499 683 5.0E-15
sp|Q4ULZ2|Y580_RICFE Putative ankyrin repeat protein RF_0580 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0580 PE=3 SV=1 484 686 5.0E-15
sp|Q9J513|V222_FOWPN Putative ankyrin repeat protein FPV222 OS=Fowlpox virus (strain NVSL) GN=FPV222 PE=3 SV=1 452 659 5.0E-15
sp|Q66H07|FANK1_RAT Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 399 587 5.0E-15
sp|A0M8T5|CTTB2_FELCA Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 534 683 5.0E-15
sp|Q3UYR4|ESPNL_MOUSE Espin-like protein OS=Mus musculus GN=Espnl PE=2 SV=1 413 671 5.0E-15
sp|O75832|PSD10_HUMAN 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 398 569 6.0E-15
sp|Q02989|LITA_LATTR Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 343 652 6.0E-15
sp|A5A3E0|POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2 421 600 6.0E-15
sp|Q6S5H5|POTEG_HUMAN POTE ankyrin domain family member G OS=Homo sapiens GN=POTEG PE=2 SV=5 421 620 6.0E-15
sp|Q8N2N9|AN36B_HUMAN Ankyrin repeat domain-containing protein 36B OS=Homo sapiens GN=ANKRD36B PE=1 SV=4 503 672 6.0E-15
sp|Q09701|AKR1_SCHPO Palmitoyltransferase akr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=akr1 PE=3 SV=1 436 622 6.0E-15
sp|Q804S5|MIB1_DANRE E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 399 638 6.0E-15
sp|Q94A76|GORK_ARATH Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 515 701 6.0E-15
sp|Q96JP0|FEM1C_HUMAN Protein fem-1 homolog C OS=Homo sapiens GN=FEM1C PE=1 SV=1 433 654 6.0E-15
sp|Q6GPE5|FEM1B_XENLA Protein fem-1 homolog B OS=Xenopus laevis GN=fem1b PE=2 SV=1 467 668 6.0E-15
sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 534 683 6.0E-15
sp|A7MB89|FEM1C_BOVIN Protein fem-1 homolog C OS=Bos taurus GN=FEM1C PE=2 SV=1 433 654 6.0E-15
sp|Q01317|NUC2_NEUCR Ankyrin repeat protein nuc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuc-2 PE=3 SV=2 365 650 6.0E-15
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 358 622 7.0E-15
sp|Q4R3S3|ANKR7_MACFA Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 339 497 7.0E-15
sp|Q8HXA6|ASB15_BOVIN Ankyrin repeat and SOCS box protein 15 OS=Bos taurus GN=ASB15 PE=2 SV=2 428 672 7.0E-15
sp|Q5M9H0|ANKS3_RAT Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 454 630 7.0E-15
sp|Q9J504|V231_FOWPN Putative ankyrin repeat protein FPV231 OS=Fowlpox virus (strain NVSL) GN=FPV231 PE=3 SV=1 516 669 7.0E-15
sp|Q9P0K7|RAI14_HUMAN Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 403 592 7.0E-15
sp|Q499M5|ANR16_RAT Ankyrin repeat domain-containing protein 16 OS=Rattus norvegicus GN=Ankrd16 PE=2 SV=1 407 654 7.0E-15
sp|Q2T9W8|ANR61_BOVIN Ankyrin repeat domain-containing protein 61 OS=Bos taurus GN=ANKRD61 PE=2 SV=1 435 635 7.0E-15
sp|Q5UPG5|YL093_MIMIV Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 338 459 8.0E-15
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 358 622 8.0E-15
sp|P23631|LATA_LATTR Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 348 683 8.0E-15
sp|Q92527|ANKR7_HUMAN Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 339 500 8.0E-15
sp|A0M8T5|CTTB2_FELCA Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 501 655 8.0E-15
sp|Q9D1A4|ASB5_MOUSE Ankyrin repeat and SOCS box protein 5 OS=Mus musculus GN=Asb5 PE=2 SV=1 422 659 8.0E-15
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 332 639 9.0E-15
sp|Q66H07|FANK1_RAT Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 425 619 9.0E-15
sp|Q2KI79|ANRA2_BOVIN Ankyrin repeat family A protein 2 OS=Bos taurus GN=ANKRA2 PE=2 SV=1 559 672 9.0E-15
sp|Q9HYV6|Y3287_PSEAE Putative ankyrin repeat protein PA3287 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA3287 PE=3 SV=1 536 671 9.0E-15
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 338 582 1.0E-14
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 532 683 1.0E-14
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 532 683 1.0E-14
sp|Q08DV6|ASB3_BOVIN Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 480 673 1.0E-14
sp|Q9HCD6|TANC2_HUMAN Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 378 671 1.0E-14
sp|Q59H18|TNI3K_HUMAN Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 493 681 1.0E-14
sp|G0LXV8|LATA_LATHA Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 348 683 1.0E-14
sp|Q5RF15|TNI3K_PONAB Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 493 681 1.0E-14
sp|O75762|TRPA1_HUMAN Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 342 683 1.0E-14
sp|Q04721|NOTC2_HUMAN Neurogenic locus notch homolog protein 2 OS=Homo sapiens GN=NOTCH2 PE=1 SV=3 424 712 1.0E-14
sp|Q9CZK6|ANKS3_MOUSE Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 436 630 1.0E-14
sp|Q9CZK6|ANKS3_MOUSE Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 372 551 1.0E-14
sp|Q8HXA6|ASB15_BOVIN Ankyrin repeat and SOCS box protein 15 OS=Bos taurus GN=ASB15 PE=2 SV=2 429 683 1.0E-14
sp|Q9DAM9|FANK1_MOUSE Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 399 562 1.0E-14
sp|Q9DAM9|FANK1_MOUSE Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 425 619 1.0E-14
sp|Q9J5H5|V026_FOWPN Putative ankyrin repeat protein FPV026 OS=Fowlpox virus (strain NVSL) GN=FPV026 PE=3 SV=1 426 623 1.0E-14
sp|Q18297|TRPA1_CAEEL Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans GN=trpa-1 PE=2 SV=5 347 681 1.0E-14
sp|Q9UM47|NOTC3_HUMAN Neurogenic locus notch homolog protein 3 OS=Homo sapiens GN=NOTCH3 PE=1 SV=2 415 641 1.0E-14
sp|Q9P0K7|RAI14_HUMAN Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 339 528 1.0E-14
sp|Q9CQM6|ANR61_MOUSE Ankyrin repeat domain-containing protein 61 OS=Mus musculus GN=Ankrd61 PE=2 SV=1 435 635 1.0E-14
sp|Q00PJ3|ASZ1_ATEAB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Atelerix albiventris GN=ASZ1 PE=3 SV=1 503 694 1.0E-14
sp|Q09YN0|ASZ1_RABIT Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Oryctolagus cuniculus GN=ASZ1 PE=3 SV=1 483 694 1.0E-14
sp|Q2T9K6|FEM1C_XENLA Protein fem-1 homolog C OS=Xenopus laevis GN=fem1c PE=2 SV=1 433 653 1.0E-14
sp|Q9J5H9|V022_FOWPN Putative ankyrin repeat protein FPV022 OS=Fowlpox virus (strain NVSL) GN=FPV022 PE=3 SV=1 345 676 1.0E-14
sp|Q9J5H9|V022_FOWPN Putative ankyrin repeat protein FPV022 OS=Fowlpox virus (strain NVSL) GN=FPV022 PE=3 SV=1 354 653 1.0E-14
sp|Q07008|NOTC1_RAT Neurogenic locus notch homolog protein 1 OS=Rattus norvegicus GN=Notch1 PE=1 SV=3 353 647 1.0E-14
sp|Q01705|NOTC1_MOUSE Neurogenic locus notch homolog protein 1 OS=Mus musculus GN=Notch1 PE=1 SV=3 353 647 1.0E-14
sp|Q9WV06|ANKR2_MOUSE Ankyrin repeat domain-containing protein 2 OS=Mus musculus GN=Ankrd2 PE=1 SV=3 497 666 1.0E-14
sp|G3I6Z6|NOTC1_CRIGR Neurogenic locus notch homolog protein 1 OS=Cricetulus griseus GN=NOTCH1 PE=1 SV=2 353 647 1.0E-14
sp|Q9WV72|ASB3_MOUSE Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 480 683 2.0E-14
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 343 685 2.0E-14
sp|Q9QW30|NOTC2_RAT Neurogenic locus notch homolog protein 2 OS=Rattus norvegicus GN=Notch2 PE=1 SV=1 424 712 2.0E-14
sp|Q9Z2X2|PSD10_MOUSE 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 398 569 2.0E-14
sp|P0DJE3|LATA_LATHE Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 348 683 2.0E-14
sp|Q8ZWC4|Y1861_PYRAE Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 348 556 2.0E-14
sp|Q6B858|FANK1_BOVIN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 415 619 2.0E-14
sp|Q6B858|FANK1_BOVIN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 447 652 2.0E-14
sp|H3BUK9|POTB2_HUMAN POTE ankyrin domain family member B2 OS=Homo sapiens GN=POTEB2 PE=3 SV=1 379 562 2.0E-14
sp|Q18297|TRPA1_CAEEL Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans GN=trpa-1 PE=2 SV=5 383 686 2.0E-14
sp|Q80SY4|MIB1_MOUSE E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 361 635 2.0E-14
sp|Q86YT6|MIB1_HUMAN E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 361 635 2.0E-14
sp|Q4X251|AKR1_ASPFU Palmitoyltransferase akr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=akr1 PE=3 SV=2 499 673 2.0E-14
sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 501 655 2.0E-14
sp|Q6DD51|CSKI2_XENLA Caskin-2 OS=Xenopus laevis GN=caskin2 PE=2 SV=1 498 686 2.0E-14
sp|Q07DV1|CTTB2_AOTNA Cortactin-binding protein 2 OS=Aotus nancymaae GN=CTTNBP2 PE=3 SV=1 534 683 2.0E-14
sp|Q9H9E1|ANRA2_HUMAN Ankyrin repeat family A protein 2 OS=Homo sapiens GN=ANKRA2 PE=1 SV=1 559 672 2.0E-14
sp|P20749|BCL3_HUMAN B-cell lymphoma 3 protein OS=Homo sapiens GN=BCL3 PE=1 SV=2 500 681 2.0E-14
sp|P20749|BCL3_HUMAN B-cell lymphoma 3 protein OS=Homo sapiens GN=BCL3 PE=1 SV=2 415 580 2.0E-14
sp|Q3EC11|ZDHC2_ARATH Probable protein S-acyltransferase 23 OS=Arabidopsis thaliana GN=PAT23 PE=2 SV=2 512 686 2.0E-14
sp|Q2QLF8|CTTB2_CALJA Cortactin-binding protein 2 OS=Callithrix jacchus GN=CTTNBP2 PE=3 SV=1 534 683 2.0E-14
sp|A6NC57|ANR62_HUMAN Ankyrin repeat domain-containing protein 62 OS=Homo sapiens GN=ANKRD62 PE=2 SV=4 415 595 2.0E-14
sp|Q09YI1|CTTB2_SHEEP Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 501 655 2.0E-14
sp|Q09YG9|CTTB2_SAIBB Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 539 683 2.0E-14
sp|Q2IBD4|CTTB2_RAT Cortactin-binding protein 2 OS=Rattus norvegicus GN=Cttnbp2 PE=1 SV=1 534 683 2.0E-14
sp|Q5UQJ2|YR863_MIMIV Putative ankyrin repeat protein R863 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L863 PE=3 SV=1 298 657 2.0E-14
sp|B9EJA2|CTTB2_MOUSE Cortactin-binding protein 2 OS=Mus musculus GN=Cttnbp2 PE=1 SV=2 536 717 2.0E-14
sp|Q2IBF7|CTTB2_GORGO Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 534 683 2.0E-14
sp|Q07E30|ASZ1_NEONE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Neofelis nebulosa GN=ASZ1 PE=3 SV=1 503 694 2.0E-14
sp|Q8WZ74|CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 534 683 2.0E-14
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 343 685 3.0E-14
sp|Q0VGY8|TANC1_MOUSE Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 339 495 3.0E-14
sp|Q9J4Z6|V244_FOWPN Putative ankyrin repeat protein FPV244 OS=Fowlpox virus (strain NVSL) GN=FPV244 PE=3 SV=1 514 661 3.0E-14
sp|A2A690|TANC2_MOUSE Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 378 671 3.0E-14
sp|Q9D504|ANKR7_MOUSE Ankyrin repeat domain-containing protein 7 OS=Mus musculus GN=Ankrd7 PE=2 SV=2 436 644 3.0E-14
sp|Q5UPA0|YL025_MIMIV Putative ankyrin repeat protein L25 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L25 PE=3 SV=1 339 617 3.0E-14
sp|Q5JPF3|AN36C_HUMAN Ankyrin repeat domain-containing protein 36C OS=Homo sapiens GN=ANKRD36C PE=2 SV=3 424 620 3.0E-14
sp|Q5M9H0|ANKS3_RAT Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 421 584 3.0E-14
sp|Q2IBB2|CTTB2_RHIFE Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 501 655 3.0E-14
sp|Q8IUH5|ZDH17_HUMAN Palmitoyltransferase ZDHHC17 OS=Homo sapiens GN=ZDHHC17 PE=1 SV=2 451 635 3.0E-14
sp|Q9Z2F6|BCL3_MOUSE B-cell lymphoma 3 protein homolog OS=Mus musculus GN=Bcl3 PE=1 SV=2 285 580 3.0E-14
sp|Q7S3M5|AKR1_NEUCR Palmitoyltransferase akr1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-1 PE=3 SV=2 457 656 3.0E-14
sp|Q5CZ79|AN20B_HUMAN Ankyrin repeat domain-containing protein 20B OS=Homo sapiens GN=ANKRD20A8P PE=2 SV=2 412 628 3.0E-14
sp|Q2QLA2|CTTB2_HORSE Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 534 683 3.0E-14
sp|Q2IBE6|CTTB2_PONAB Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 534 683 3.0E-14
sp|P31695|NOTC4_MOUSE Neurogenic locus notch homolog protein 4 OS=Mus musculus GN=Notch4 PE=1 SV=2 353 607 3.0E-14
sp|Q9H560|ANR19_HUMAN Putative ankyrin repeat domain-containing protein 19 OS=Homo sapiens GN=ANKRD19P PE=5 SV=1 411 624 3.0E-14
sp|Q2QL82|CTTB2_MICMU Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 534 683 3.0E-14
sp|Q8VHS5|ASB16_MOUSE Ankyrin repeat and SOCS box protein 16 OS=Mus musculus GN=Asb16 PE=2 SV=1 467 674 3.0E-14
sp|Q5TYW2|A20A1_HUMAN Ankyrin repeat domain-containing protein 20A1 OS=Homo sapiens GN=ANKRD20A1 PE=2 SV=1 412 595 3.0E-14
sp|Q9NU02|ANKE1_HUMAN Ankyrin repeat and EF-hand domain-containing protein 1 OS=Homo sapiens GN=ANKEF1 PE=2 SV=2 432 697 3.0E-14
sp|Q2IBF8|CTTB2_EULMM Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 501 655 3.0E-14
sp|Q6S8J7|POTEA_HUMAN POTE ankyrin domain family member A OS=Homo sapiens GN=POTEA PE=2 SV=1 501 692 3.0E-14
sp|Q07DX4|CTTB2_NOMLE Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 534 683 3.0E-14
sp|Q07DZ5|CTTB2_ORNAN Cortactin-binding protein 2 OS=Ornithorhynchus anatinus GN=CTTNBP2 PE=3 SV=1 534 677 3.0E-14
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 337 639 4.0E-14
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 338 683 4.0E-14
sp|Q05921|RN5A_MOUSE 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 323 559 4.0E-14
sp|Q6F6B3|TANC1_RAT Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 339 495 4.0E-14
sp|Q9Z2X3|PSD10_RAT 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 398 590 4.0E-14
sp|Q978J0|Y1425_THEVO Putative ankyrin repeat protein TV1425 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1425 PE=1 SV=1 461 619 4.0E-14
sp|Q9Y6X6|MYO16_HUMAN Unconventional myosin-XVI OS=Homo sapiens GN=MYO16 PE=2 SV=3 451 718 4.0E-14
sp|Q804S5|MIB1_DANRE E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 480 691 4.0E-14
sp|Q09YI1|CTTB2_SHEEP Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 534 683 4.0E-14
sp|Q09YG9|CTTB2_SAIBB Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 514 653 4.0E-14
sp|Q07DY6|ASZ1_COLGU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Colobus guereza GN=ASZ1 PE=3 SV=1 506 696 4.0E-14
sp|Q07E41|CTTB2_DASNO Cortactin-binding protein 2 OS=Dasypus novemcinctus GN=CTTNBP2 PE=3 SV=1 534 697 4.0E-14
sp|Q9VFD5|FEM1A_DROME Protein fem-1 homolog CG6966 OS=Drosophila melanogaster GN=CG6966 PE=2 SV=2 326 552 4.0E-14
sp|Q9GZV1|ANKR2_HUMAN Ankyrin repeat domain-containing protein 2 OS=Homo sapiens GN=ANKRD2 PE=1 SV=3 497 666 4.0E-14
sp|P98150|NFKB2_CHICK Nuclear factor NF-kappa-B p100 subunit OS=Gallus gallus GN=NFKB2 PE=1 SV=1 460 657 4.0E-14
sp|Q7Z8U2|AKR1_ASPOR Palmitoyltransferase akr1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=akr1 PE=3 SV=2 461 669 4.0E-14
sp|Q5ZM55|FEM1B_CHICK Protein fem-1 homolog B OS=Gallus gallus GN=FEM1B PE=2 SV=1 467 654 4.0E-14
sp|Q2QLB3|CTTB2_CALMO Cortactin-binding protein 2 OS=Callicebus moloch GN=CTTNBP2 PE=3 SV=1 534 683 4.0E-14
sp|Q07E17|ASZ1_MUSPF Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mustela putorius furo GN=ASZ1 PE=3 SV=1 503 694 4.0E-14
sp|Q812A3|ANR23_MOUSE Ankyrin repeat domain-containing protein 23 OS=Mus musculus GN=Ankrd23 PE=2 SV=1 514 676 4.0E-14
sp|P46531|NOTC1_HUMAN Neurogenic locus notch homolog protein 1 OS=Homo sapiens GN=NOTCH1 PE=1 SV=4 353 647 4.0E-14
sp|Q6B858|FANK1_BOVIN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 339 486 5.0E-14
sp|Q6S5H4|POTEB_HUMAN POTE ankyrin domain family member B OS=Homo sapiens GN=POTEB PE=2 SV=1 379 562 5.0E-14
sp|A0JP26|POTB3_HUMAN POTE ankyrin domain family member B3 OS=Homo sapiens GN=POTEB3 PE=2 SV=2 379 562 5.0E-14
sp|Q8TC84|FANK1_HUMAN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 447 652 5.0E-14
sp|Q2T9K6|FEM1C_XENLA Protein fem-1 homolog C OS=Xenopus laevis GN=fem1c PE=2 SV=1 360 551 5.0E-14
sp|Q5VUR7|A20A3_HUMAN Ankyrin repeat domain-containing protein 20A3 OS=Homo sapiens GN=ANKRD20A3 PE=3 SV=1 412 595 5.0E-14
sp|Q00420|GABP1_MOUSE GA-binding protein subunit beta-1 OS=Mus musculus GN=Gabpb1 PE=1 SV=2 536 695 5.0E-14
sp|Q09YJ3|CTTB2_MUNMU Cortactin-binding protein 2 OS=Muntiacus muntjak GN=CTTNBP2 PE=3 SV=1 534 683 5.0E-14
sp|Q108T9|CTTB2_LOXAF Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 534 683 5.0E-14
sp|Q5SQ80|A20A2_HUMAN Ankyrin repeat domain-containing protein 20A2 OS=Homo sapiens GN=ANKRD20A2 PE=3 SV=1 412 595 5.0E-14
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 488 633 6.0E-14
sp|P0C927|ASB14_RAT Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 339 560 6.0E-14
sp|Q9Z148|EHMT2_MOUSE Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 512 690 6.0E-14
sp|Q8N283|ANR35_HUMAN Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 374 562 6.0E-14
sp|Q07008|NOTC1_RAT Neurogenic locus notch homolog protein 1 OS=Rattus norvegicus GN=Notch1 PE=1 SV=3 424 684 6.0E-14
sp|Q01705|NOTC1_MOUSE Neurogenic locus notch homolog protein 1 OS=Mus musculus GN=Notch1 PE=1 SV=3 424 684 6.0E-14
sp|Q2IBF8|CTTB2_EULMM Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 534 683 6.0E-14
sp|P46531|NOTC1_HUMAN Neurogenic locus notch homolog protein 1 OS=Homo sapiens GN=NOTCH1 PE=1 SV=4 424 684 6.0E-14
sp|Q2IBE3|ASZ1_PONAB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pongo abelii GN=ASZ1 PE=3 SV=1 506 696 6.0E-14
sp|Q8CGB3|UACA_MOUSE Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Mus musculus GN=Uaca PE=1 SV=2 403 591 6.0E-14
sp|Q5R4M7|ASB6_PONAB Ankyrin repeat and SOCS box protein 6 OS=Pongo abelii GN=ASB6 PE=2 SV=1 536 672 6.0E-14
sp|Q7T3P8|FEM1C_DANRE Protein fem-1 homolog C OS=Danio rerio GN=fem1c PE=2 SV=2 498 724 6.0E-14
sp|Q5UP11|YR848_MIMIV Putative ankyrin repeat protein R848 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R848 PE=3 SV=1 327 539 6.0E-14
sp|Q8WMX8|ASZ1_BOVIN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Bos taurus GN=ASZ1 PE=2 SV=1 500 694 6.0E-14
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 532 679 7.0E-14
sp|Q80TN5|ZDH17_MOUSE Palmitoyltransferase ZDHHC17 OS=Mus musculus GN=Zdhhc17 PE=1 SV=2 451 635 7.0E-14
sp|E9PTT0|ZDH17_RAT Palmitoyltransferase ZDHHC17 OS=Rattus norvegicus GN=Zdhhc17 PE=1 SV=1 451 635 7.0E-14
sp|G3I6Z6|NOTC1_CRIGR Neurogenic locus notch homolog protein 1 OS=Cricetulus griseus GN=NOTCH1 PE=1 SV=2 424 684 7.0E-14
sp|Q3EC11|ZDHC2_ARATH Probable protein S-acyltransferase 23 OS=Arabidopsis thaliana GN=PAT23 PE=2 SV=2 533 708 7.0E-14
sp|Q2IBG0|ASZ1_EULMM Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Eulemur macaco macaco GN=ASZ1 PE=3 SV=1 503 696 7.0E-14
sp|Q3ZBX7|ANKR1_BOVIN Ankyrin repeat domain-containing protein 1 OS=Bos taurus GN=ANKRD1 PE=2 SV=1 529 672 7.0E-14
sp|P77736|YAHD_ECOLI Putative ankyrin repeat protein YahD OS=Escherichia coli (strain K12) GN=yahD PE=3 SV=1 405 589 7.0E-14
sp|Q9NWX5|ASB6_HUMAN Ankyrin repeat and SOCS box protein 6 OS=Homo sapiens GN=ASB6 PE=1 SV=1 536 672 7.0E-14
sp|O35516|NOTC2_MOUSE Neurogenic locus notch homolog protein 2 OS=Mus musculus GN=Notch2 PE=1 SV=1 424 653 8.0E-14
sp|Q5M9H0|ANKS3_RAT Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 397 551 8.0E-14
sp|B2RU33|POTEC_HUMAN POTE ankyrin domain family member C OS=Homo sapiens GN=POTEC PE=2 SV=2 379 584 8.0E-14
sp|Q8N2N9|AN36B_HUMAN Ankyrin repeat domain-containing protein 36B OS=Homo sapiens GN=ANKRD36B PE=1 SV=4 410 595 8.0E-14
sp|Q1RMI3|GABP1_BOVIN GA-binding protein subunit beta-1 OS=Bos taurus GN=GABPB1 PE=2 SV=1 536 695 8.0E-14
sp|Q06547|GABP1_HUMAN GA-binding protein subunit beta-1 OS=Homo sapiens GN=GABPB1 PE=1 SV=2 536 695 8.0E-14
sp|A2A2Z9|AN18B_HUMAN Ankyrin repeat domain-containing protein 18B OS=Homo sapiens GN=ANKRD18B PE=1 SV=1 326 513 8.0E-14
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 532 679 9.0E-14
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 344 593 9.0E-14
sp|Q92625|ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 350 569 9.0E-14
sp|Q3V096|ANR42_MOUSE Ankyrin repeat domain-containing protein 42 OS=Mus musculus GN=Ankrd42 PE=2 SV=1 331 650 9.0E-14
sp|Q07E15|CTTB2_MUSPF Cortactin-binding protein 2 OS=Mustela putorius furo GN=CTTNBP2 PE=3 SV=1 534 683 9.0E-14
sp|Q05823|RN5A_HUMAN 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 377 662 1.0E-13
sp|Q54HW1|PSD10_DICDI 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 415 608 1.0E-13
sp|F1N6G5|HACE1_BOVIN E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 539 683 1.0E-13
sp|Q8IYU2|HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 539 683 1.0E-13
sp|Q5DU14|MYO16_MOUSE Unconventional myosin-XVI OS=Mus musculus GN=Myo16 PE=1 SV=2 451 687 1.0E-13
sp|Q9ET47|ESPN_MOUSE Espin OS=Mus musculus GN=Espn PE=1 SV=2 383 703 1.0E-13
sp|Q86YR6|POTED_HUMAN POTE ankyrin domain family member D OS=Homo sapiens GN=POTED PE=2 SV=2 379 562 1.0E-13
sp|Q6ZW76|ANKS3_HUMAN Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens GN=ANKS3 PE=1 SV=1 454 630 1.0E-13
sp|Q5U312|RAI14_RAT Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 350 561 1.0E-13
sp|Q9P0K7|RAI14_HUMAN Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 517 673 1.0E-13
sp|Q9H560|ANR19_HUMAN Putative ankyrin repeat domain-containing protein 19 OS=Homo sapiens GN=ANKRD19P PE=5 SV=1 326 521 1.0E-13
sp|Q99466|NOTC4_HUMAN Neurogenic locus notch homolog protein 4 OS=Homo sapiens GN=NOTCH4 PE=1 SV=2 424 641 1.0E-13
sp|Q09YI3|ASZ1_SHEEP Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ovis aries GN=ASZ1 PE=3 SV=1 500 694 1.0E-13
sp|A2RUV0|NOTC1_XENTR Neurogenic locus notch homolog protein 1 OS=Xenopus tropicalis GN=notch1 PE=1 SV=2 353 631 1.0E-13
sp|Q5BKI6|ANKR1_XENTR Ankyrin repeat domain-containing protein 1 OS=Xenopus tropicalis GN=ankrd1 PE=2 SV=1 500 673 1.0E-13
sp|Q4UJ75|A20A4_HUMAN Ankyrin repeat domain-containing protein 20A4 OS=Homo sapiens GN=ANKRD20A4 PE=3 SV=1 412 595 1.0E-13
sp|Q68LP1|MIB2_RAT E3 ubiquitin-protein ligase MIB2 OS=Rattus norvegicus GN=Mib2 PE=1 SV=2 429 673 1.0E-13
sp|Q07DZ7|ASZ1_ORNAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ornithorhynchus anatinus GN=ASZ1 PE=3 SV=1 483 683 1.0E-13
sp|Q5UPU4|YR267_MIMIV Putative ankyrin repeat protein R267 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R267 PE=3 SV=1 469 683 1.0E-13
sp|Q6GNY1|MIB1_XENLA E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis GN=mib1 PE=2 SV=1 361 635 1.0E-13
sp|Q6GNY1|MIB1_XENLA E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis GN=mib1 PE=2 SV=1 399 638 1.0E-13
sp|Q07DW4|CTTB2_MUNRE Cortactin-binding protein 2 OS=Muntiacus reevesi GN=CTTNBP2 PE=3 SV=1 534 683 1.0E-13
sp|Q7XUW4|KOR2_ORYSJ Potassium channel KOR2 OS=Oryza sativa subsp. japonica GN=Os04g0445000 PE=2 SV=2 407 569 1.0E-13
sp|Q5UPH0|YL100_MIMIV Putative ankyrin repeat protein L100 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L100 PE=3 SV=1 316 661 1.0E-13
sp|Q9J508|V227_FOWPN Putative ankyrin repeat protein FPV227 OS=Fowlpox virus (strain NVSL) GN=FPV227 PE=3 SV=1 503 665 1.0E-13
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 536 684 2.0E-13
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 536 684 2.0E-13
sp|Q9XZC0|LCTA_LATTR Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 444 683 2.0E-13
sp|Q495B1|AKD1A_HUMAN Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 339 586 2.0E-13
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 522 677 2.0E-13
sp|Q71S21|INVSB_XENLA Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 392 684 2.0E-13
sp|Q8N6D5|ANR29_HUMAN Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 433 652 2.0E-13
sp|P07207|NOTCH_DROME Neurogenic locus Notch protein OS=Drosophila melanogaster GN=N PE=1 SV=3 457 671 2.0E-13
sp|Q8VBX0|ASB13_MOUSE Ankyrin repeat and SOCS box protein 13 OS=Mus musculus GN=Asb13 PE=2 SV=1 348 535 2.0E-13
sp|Q08E43|ASB8_BOVIN Ankyrin repeat and SOCS box protein 8 OS=Bos taurus GN=ASB8 PE=2 SV=1 411 576 2.0E-13
sp|Q3SZE4|ASB11_BOVIN Ankyrin repeat and SOCS box protein 11 OS=Bos taurus GN=ASB11 PE=2 SV=1 433 667 2.0E-13
sp|Q1RHT6|Y997_RICBR Putative ankyrin repeat protein RBE_0997 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0997 PE=3 SV=1 348 657 2.0E-13
sp|Q3U0D9|HACE1_MOUSE E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 539 683 2.0E-13
sp|Q9ERC1|MYO16_RAT Unconventional myosin-XVI OS=Rattus norvegicus GN=Myo16 PE=1 SV=1 451 687 2.0E-13
sp|Q9EP71|RAI14_MOUSE Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 339 528 2.0E-13
sp|Q8GXE6|AKT6_ARATH Potassium channel AKT6 OS=Arabidopsis thaliana GN=AKT6 PE=1 SV=2 403 584 2.0E-13
sp|Q5U312|RAI14_RAT Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 430 625 2.0E-13
sp|Q3EC11|ZDHC2_ARATH Probable protein S-acyltransferase 23 OS=Arabidopsis thaliana GN=PAT23 PE=2 SV=2 481 694 2.0E-13
sp|Q2QLF8|CTTB2_CALJA Cortactin-binding protein 2 OS=Callithrix jacchus GN=CTTNBP2 PE=3 SV=1 501 653 2.0E-13
sp|Q2QL82|CTTB2_MICMU Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 501 655 2.0E-13
sp|Q07DW4|CTTB2_MUNRE Cortactin-binding protein 2 OS=Muntiacus reevesi GN=CTTNBP2 PE=3 SV=1 501 655 2.0E-13
sp|Q7XUW4|KOR2_ORYSJ Potassium channel KOR2 OS=Oryza sativa subsp. japonica GN=Os04g0445000 PE=2 SV=2 515 686 2.0E-13
sp|Q2QL84|ASZ1_MICMU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Microcebus murinus GN=ASZ1 PE=3 SV=1 503 696 2.0E-13
sp|P14368|V234_FOWPN Putative ankyrin repeat protein FPV234 OS=Fowlpox virus (strain NVSL) GN=FPV234 PE=3 SV=2 513 667 2.0E-13
sp|P14368|V234_FOWPN Putative ankyrin repeat protein FPV234 OS=Fowlpox virus (strain NVSL) GN=FPV234 PE=3 SV=2 481 668 2.0E-13
sp|Q09YJ5|ASZ1_MUNMU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Muntiacus muntjak GN=ASZ1 PE=3 SV=1 500 679 2.0E-13
sp|Q07DX6|ASZ1_NOMLE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Nomascus leucogenys GN=ASZ1 PE=3 SV=1 506 696 2.0E-13
sp|Q4KL97|ANKR1_XENLA Ankyrin repeat domain-containing protein 1 OS=Xenopus laevis GN=ankrd1 PE=2 SV=1 500 673 2.0E-13
sp|Q09YM8|CTTB2_RABIT Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 536 683 2.0E-13
sp|Q09YM8|CTTB2_RABIT Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 503 655 2.0E-13
sp|Q2QLA4|ASZ1_HORSE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Equus caballus GN=ASZ1 PE=3 SV=1 503 694 2.0E-13
sp|Q86SG2|ANR23_HUMAN Ankyrin repeat domain-containing protein 23 OS=Homo sapiens GN=ANKRD23 PE=1 SV=1 415 569 2.0E-13
sp|Q86SG2|ANR23_HUMAN Ankyrin repeat domain-containing protein 23 OS=Homo sapiens GN=ANKRD23 PE=1 SV=1 514 684 2.0E-13
sp|Q8WMX7|ASZ1_PAPAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Papio anubis GN=ASZ1 PE=2 SV=1 506 696 2.0E-13
sp|Q2IBB1|ASZ1_CHLAE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Chlorocebus aethiops GN=ASZ1 PE=3 SV=1 506 696 2.0E-13
sp|Q9SCX5|AKT5_ARATH Probable potassium channel AKT5 OS=Arabidopsis thaliana GN=AKT5 PE=2 SV=2 403 623 2.0E-13
sp|Q8WWH4|ASZ1_HUMAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Homo sapiens GN=ASZ1 PE=2 SV=1 506 696 2.0E-13
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 323 569 3.0E-13
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 512 686 3.0E-13
sp|Q8C6Y6|ASB14_MOUSE Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 342 560 3.0E-13
sp|Q92527|ANKR7_HUMAN Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 532 683 3.0E-13
sp|Q71S22|INVSA_XENLA Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 342 589 3.0E-13
sp|Q91ZT9|ASB8_MOUSE Ankyrin repeat and SOCS box protein 8 OS=Mus musculus GN=Asb8 PE=2 SV=1 411 576 3.0E-13
sp|D3ZBM7|HACE1_RAT E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 539 683 3.0E-13
sp|Q9DAM9|FANK1_MOUSE Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 339 486 3.0E-13
sp|A6NGH8|ANR61_HUMAN Ankyrin repeat domain-containing protein 61 OS=Homo sapiens GN=ANKRD61 PE=3 SV=2 348 569 3.0E-13
sp|Q5RFS1|ASB11_PONAB Ankyrin repeat and SOCS box protein 11 OS=Pongo abelii GN=ASB11 PE=2 SV=1 433 700 3.0E-13
sp|Q9Y574|ASB4_HUMAN Ankyrin repeat and SOCS box protein 4 OS=Homo sapiens GN=ASB4 PE=2 SV=1 365 589 3.0E-13
sp|Q8N2N9|AN36B_HUMAN Ankyrin repeat domain-containing protein 36B OS=Homo sapiens GN=ANKRD36B PE=1 SV=4 368 562 3.0E-13
sp|Q07DV1|CTTB2_AOTNA Cortactin-binding protein 2 OS=Aotus nancymaae GN=CTTNBP2 PE=3 SV=1 501 653 3.0E-13
sp|P31695|NOTC4_MOUSE Neurogenic locus notch homolog protein 4 OS=Mus musculus GN=Notch4 PE=1 SV=2 424 661 3.0E-13
sp|Q6S8J7|POTEA_HUMAN POTE ankyrin domain family member A OS=Homo sapiens GN=POTEA PE=2 SV=1 450 667 3.0E-13
sp|Q9VFD5|FEM1A_DROME Protein fem-1 homolog CG6966 OS=Drosophila melanogaster GN=CG6966 PE=2 SV=2 416 651 3.0E-13
sp|Q7Z8U2|AKR1_ASPOR Palmitoyltransferase akr1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=akr1 PE=3 SV=2 499 686 3.0E-13
sp|Q09YJ3|CTTB2_MUNMU Cortactin-binding protein 2 OS=Muntiacus muntjak GN=CTTNBP2 PE=3 SV=1 501 655 3.0E-13
sp|Q108T9|CTTB2_LOXAF Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 501 655 3.0E-13
sp|Q07E15|CTTB2_MUSPF Cortactin-binding protein 2 OS=Mustela putorius furo GN=CTTNBP2 PE=3 SV=1 501 655 3.0E-13
sp|Q9SCX5|AKT5_ARATH Probable potassium channel AKT5 OS=Arabidopsis thaliana GN=AKT5 PE=2 SV=2 518 708 3.0E-13
sp|Q9M8S6|SKOR_ARATH Potassium channel SKOR OS=Arabidopsis thaliana GN=SKOR PE=1 SV=1 515 695 3.0E-13
sp|Q2QLC6|ASZ1_CARPS Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Carollia perspicillata GN=ASZ1 PE=3 SV=1 503 664 3.0E-13
sp|Q2IBA2|CTTB2_CHLAE Cortactin-binding protein 2 OS=Chlorocebus aethiops GN=CTTNBP2 PE=3 SV=1 534 683 3.0E-13
sp|A0M8S4|CTTB2_PAPAN Cortactin-binding protein 2 OS=Papio anubis GN=CTTNBP2 PE=3 SV=1 534 683 3.0E-13
sp|Q07DY4|CTTB2_COLGU Cortactin-binding protein 2 OS=Colobus guereza GN=CTTNBP2 PE=3 SV=1 534 683 3.0E-13
sp|Q8WMX6|ASZ1_PANTR Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pan troglodytes GN=ASZ1 PE=2 SV=1 506 696 3.0E-13
sp|Q07E43|ASZ1_DASNO Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Dasypus novemcinctus GN=ASZ1 PE=3 SV=1 503 696 3.0E-13
sp|Q96T49|PP16B_HUMAN Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Homo sapiens GN=PPP1R16B PE=1 SV=1 498 660 3.0E-13
sp|Q923M0|PP16A_MOUSE Protein phosphatase 1 regulatory subunit 16A OS=Mus musculus GN=Ppp1r16a PE=1 SV=1 398 637 3.0E-13
sp|Q2QLH1|ASZ1_OTOGA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Otolemur garnettii GN=ASZ1 PE=3 SV=1 503 694 3.0E-13
sp|Q5UR87|YR634_MIMIV Putative ankyrin repeat protein R634 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R634 PE=3 SV=1 342 661 3.0E-13
sp|Q108U1|ASZ1_LOXAF Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Loxodonta africana GN=ASZ1 PE=3 SV=1 503 694 3.0E-13
sp|Q9C0D5|TANC1_HUMAN Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 339 495 4.0E-13
sp|Q6ZW76|ANKS3_HUMAN Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens GN=ANKS3 PE=1 SV=1 421 584 4.0E-13
sp|Q63618|ESPN_RAT Espin OS=Rattus norvegicus GN=Espn PE=1 SV=2 383 633 4.0E-13
sp|Q5U312|RAI14_RAT Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 339 528 4.0E-13
sp|Q38998|AKT1_ARATH Potassium channel AKT1 OS=Arabidopsis thaliana GN=AKT1 PE=1 SV=2 365 535 4.0E-13
sp|Q38998|AKT1_ARATH Potassium channel AKT1 OS=Arabidopsis thaliana GN=AKT1 PE=1 SV=2 458 634 4.0E-13
sp|Q8CEF1|FEM1C_MOUSE Protein fem-1 homolog C OS=Mus musculus GN=Fem1c PE=2 SV=1 360 551 4.0E-13
sp|Q804S5|MIB1_DANRE E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 361 671 4.0E-13
sp|Q96JP0|FEM1C_HUMAN Protein fem-1 homolog C OS=Homo sapiens GN=FEM1C PE=1 SV=1 360 551 4.0E-13
sp|A7MB89|FEM1C_BOVIN Protein fem-1 homolog C OS=Bos taurus GN=FEM1C PE=2 SV=1 360 551 4.0E-13
sp|Q6DD51|CSKI2_XENLA Caskin-2 OS=Xenopus laevis GN=caskin2 PE=2 SV=1 353 619 4.0E-13
sp|Q00PJ1|CTTB2_ATEAB Cortactin-binding protein 2 OS=Atelerix albiventris GN=CTTNBP2 PE=3 SV=1 534 683 4.0E-13
sp|Q95N27|PP16B_BOVIN Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Bos taurus GN=PPP1R16B PE=1 SV=1 498 660 4.0E-13
sp|Q9BXX3|AN30A_HUMAN Ankyrin repeat domain-containing protein 30A OS=Homo sapiens GN=ANKRD30A PE=2 SV=3 397 623 4.0E-13
sp|Q5UQ08|YR787_MIMIV Putative ankyrin repeat protein R787 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R787 PE=3 SV=1 327 658 4.0E-13
sp|Q5UQF1|YL483_MIMIV Putative ankyrin repeat protein L483 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L483 PE=3 SV=1 342 661 4.0E-13
sp|Q2IBF5|ASZ1_GORGO Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Gorilla gorilla gorilla GN=ASZ1 PE=3 SV=1 506 696 4.0E-13
sp|A1X154|ASZ1_ECHTE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Echinops telfairi GN=ASZ1 PE=3 SV=1 486 694 4.0E-13
sp|A1X157|CTTB2_ECHTE Cortactin-binding protein 2 OS=Echinops telfairi GN=CTTNBP2 PE=3 SV=1 534 683 4.0E-13
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 542 686 5.0E-13
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 499 687 5.0E-13
sp|Q7TQP6|TNI3K_RAT Serine/threonine-protein kinase TNNI3K OS=Rattus norvegicus GN=Tnni3k PE=2 SV=3 531 671 5.0E-13
sp|Q91ZT7|ASB10_MOUSE Ankyrin repeat and SOCS box protein 10 OS=Mus musculus GN=Asb10 PE=2 SV=1 363 581 5.0E-13
sp|Q2IBF7|CTTB2_GORGO Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 501 653 5.0E-13
sp|Q8WZ74|CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 501 653 5.0E-13
sp|Q2IBE6|CTTB2_PONAB Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 501 653 5.0E-13
sp|Q9VFD5|FEM1A_DROME Protein fem-1 homolog CG6966 OS=Drosophila melanogaster GN=CG6966 PE=2 SV=2 485 668 5.0E-13
sp|Q7XUW4|KOR2_ORYSJ Potassium channel KOR2 OS=Oryza sativa subsp. japonica GN=Os04g0445000 PE=2 SV=2 451 617 5.0E-13
sp|Q5UR87|YR634_MIMIV Putative ankyrin repeat protein R634 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R634 PE=3 SV=1 326 661 5.0E-13
sp|Q6P9K8|CSKI1_MOUSE Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 357 562 5.0E-13
sp|Q54BA2|Y3800_DICDI Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 399 602 5.0E-13
sp|B2RU33|POTEC_HUMAN POTE ankyrin domain family member C OS=Homo sapiens GN=POTEC PE=2 SV=2 346 554 6.0E-13
sp|Q9EP71|RAI14_MOUSE Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 430 625 6.0E-13
sp|E1C656|HACE1_CHICK E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 539 683 6.0E-13
sp|Q8T2Q0|ZDHC6_DICDI Putative ZDHHC-type palmitoyltransferase 6 OS=Dictyostelium discoideum GN=DDB_G0275149 PE=2 SV=1 452 634 6.0E-13
sp|Q9H560|ANR19_HUMAN Putative ankyrin repeat domain-containing protein 19 OS=Homo sapiens GN=ANKRD19P PE=5 SV=1 512 672 6.0E-13
sp|Q07DX4|CTTB2_NOMLE Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 501 653 6.0E-13
sp|Q07DZ5|CTTB2_ORNAN Cortactin-binding protein 2 OS=Ornithorhynchus anatinus GN=CTTNBP2 PE=3 SV=1 517 658 6.0E-13
sp|Q07E41|CTTB2_DASNO Cortactin-binding protein 2 OS=Dasypus novemcinctus GN=CTTNBP2 PE=3 SV=1 501 655 6.0E-13
sp|Q2QLB3|CTTB2_CALMO Cortactin-binding protein 2 OS=Callicebus moloch GN=CTTNBP2 PE=3 SV=1 501 653 6.0E-13
sp|Q8CGB3|UACA_MOUSE Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Mus musculus GN=Uaca PE=1 SV=2 393 562 6.0E-13
sp|Q8WXH4|ASB11_HUMAN Ankyrin repeat and SOCS box protein 11 OS=Homo sapiens GN=ASB11 PE=1 SV=1 433 697 6.0E-13
sp|Q502M6|ANR29_DANRE Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 434 701 7.0E-13
sp|Q6DCL5|HACE1_XENLA E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 539 683 7.0E-13
sp|Q28BK1|HACE1_XENTR E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 539 683 7.0E-13
sp|Q8BLD6|ANR55_MOUSE Ankyrin repeat domain-containing protein 55 OS=Mus musculus GN=Ankrd55 PE=1 SV=2 446 699 7.0E-13
sp|Q8VHS5|ASB16_MOUSE Ankyrin repeat and SOCS box protein 16 OS=Mus musculus GN=Asb16 PE=2 SV=1 434 635 7.0E-13
sp|Q5B0V6|AKR1_EMENI Palmitoyltransferase akr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=akr1 PE=3 SV=2 499 673 7.0E-13
sp|Q8VHK2|CSKI1_RAT Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 357 562 7.0E-13
sp|Q6B858|FANK1_BOVIN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 399 587 8.0E-13
sp|Q8TC84|FANK1_HUMAN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 339 494 8.0E-13
sp|Q6ZW76|ANKS3_HUMAN Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens GN=ANKS3 PE=1 SV=1 396 554 8.0E-13
sp|Q641X1|ANR61_RAT Ankyrin repeat domain-containing protein 61 OS=Rattus norvegicus GN=Ankrd61 PE=2 SV=1 348 586 8.0E-13
sp|Q6P9K8|CSKI1_MOUSE Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 424 635 8.0E-13
sp|Q2QLG9|CTTB2_OTOGA Cortactin-binding protein 2 OS=Otolemur garnettii GN=CTTNBP2 PE=3 SV=1 501 655 8.0E-13
sp|Q7ZT11|ANKR1_CHICK Ankyrin repeat domain-containing protein 1 OS=Gallus gallus GN=ANKRD1 PE=2 SV=1 505 673 8.0E-13
sp|Q3UMR0|ANR27_MOUSE Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 502 657 9.0E-13
sp|Q8WXK3|ASB13_HUMAN Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens GN=ASB13 PE=1 SV=2 348 535 9.0E-13
sp|H3BUK9|POTB2_HUMAN POTE ankyrin domain family member B2 OS=Homo sapiens GN=POTEB2 PE=3 SV=1 346 554 9.0E-13
sp|Q6S5H4|POTEB_HUMAN POTE ankyrin domain family member B OS=Homo sapiens GN=POTEB PE=2 SV=1 346 554 9.0E-13
sp|A0JP26|POTB3_HUMAN POTE ankyrin domain family member B3 OS=Homo sapiens GN=POTEB3 PE=2 SV=2 346 554 9.0E-13
sp|Q5UP39|YR873_MIMIV Putative ankyrin repeat protein R873 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R873 PE=3 SV=1 371 683 9.0E-13
sp|Q9J4Z4|V246_FOWPN Putative ankyrin repeat protein FPV246 OS=Fowlpox virus (strain NVSL) GN=FPV246 PE=3 SV=1 512 692 1.0E-12
sp|Q59H18|TNI3K_HUMAN Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 531 696 1.0E-12
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 338 558 1.0E-12
sp|A6NK59|ASB14_HUMAN Ankyrin repeat and SOCS box protein 14 OS=Homo sapiens GN=ASB14 PE=2 SV=2 340 658 1.0E-12
sp|Q9J513|V222_FOWPN Putative ankyrin repeat protein FPV222 OS=Fowlpox virus (strain NVSL) GN=FPV222 PE=3 SV=1 362 673 1.0E-12
sp|Q5R6D7|ASB8_PONAB Ankyrin repeat and SOCS box protein 8 OS=Pongo abelii GN=ASB8 PE=2 SV=1 411 576 1.0E-12
sp|Q9H765|ASB8_HUMAN Ankyrin repeat and SOCS box protein 8 OS=Homo sapiens GN=ASB8 PE=2 SV=1 411 576 1.0E-12
sp|Q4R544|ASB8_MACFA Ankyrin repeat and SOCS box protein 8 OS=Macaca fascicularis GN=ASB8 PE=2 SV=1 411 576 1.0E-12
sp|Q6S8J3|POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 379 562 1.0E-12
sp|A5A3E0|POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2 400 562 1.0E-12
sp|F1N6G5|HACE1_BOVIN E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 372 554 1.0E-12
sp|Q8IYU2|HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 372 554 1.0E-12
sp|Q8TC84|FANK1_HUMAN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 339 486 1.0E-12
sp|P0C6P7|FEM1B_RAT Protein fem-1 homolog B OS=Rattus norvegicus GN=Fem1b PE=1 SV=1 534 683 1.0E-12
sp|Q9Z2G0|FEM1B_MOUSE Protein fem-1 homolog B OS=Mus musculus GN=Fem1b PE=1 SV=1 534 683 1.0E-12
sp|Q9UK73|FEM1B_HUMAN Protein fem-1 homolog B OS=Homo sapiens GN=FEM1B PE=1 SV=1 534 683 1.0E-12
sp|Q653P0|KOR1_ORYSJ Potassium channel KOR1 OS=Oryza sativa subsp. japonica GN=Os06g0250600 PE=2 SV=1 407 584 1.0E-12
sp|Q80SY4|MIB1_MOUSE E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 338 602 1.0E-12
sp|Q86YT6|MIB1_HUMAN E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 338 602 1.0E-12
sp|Q8CEF1|FEM1C_MOUSE Protein fem-1 homolog C OS=Mus musculus GN=Fem1c PE=2 SV=1 531 683 1.0E-12
sp|Q96JP0|FEM1C_HUMAN Protein fem-1 homolog C OS=Homo sapiens GN=FEM1C PE=1 SV=1 531 683 1.0E-12
sp|A7MB89|FEM1C_BOVIN Protein fem-1 homolog C OS=Bos taurus GN=FEM1C PE=2 SV=1 531 683 1.0E-12
sp|Q01317|NUC2_NEUCR Ankyrin repeat protein nuc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuc-2 PE=3 SV=2 320 551 1.0E-12
sp|Q9P0K7|RAI14_HUMAN Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 430 625 1.0E-12
sp|Q9H560|ANR19_HUMAN Putative ankyrin repeat domain-containing protein 19 OS=Homo sapiens GN=ANKRD19P PE=5 SV=1 524 683 1.0E-12
sp|Q9H560|ANR19_HUMAN Putative ankyrin repeat domain-containing protein 19 OS=Homo sapiens GN=ANKRD19P PE=5 SV=1 451 657 1.0E-12
sp|Q9NU02|ANKE1_HUMAN Ankyrin repeat and EF-hand domain-containing protein 1 OS=Homo sapiens GN=ANKEF1 PE=2 SV=2 531 697 1.0E-12
sp|Q5UP11|YR848_MIMIV Putative ankyrin repeat protein R848 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R848 PE=3 SV=1 512 752 1.0E-12
sp|Q68LP1|MIB2_RAT E3 ubiquitin-protein ligase MIB2 OS=Rattus norvegicus GN=Mib2 PE=1 SV=2 398 675 1.0E-12
sp|P14368|V234_FOWPN Putative ankyrin repeat protein FPV234 OS=Fowlpox virus (strain NVSL) GN=FPV234 PE=3 SV=2 451 666 1.0E-12
sp|Q8VHK2|CSKI1_RAT Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 424 635 1.0E-12
sp|Q6ZVZ8|ASB18_HUMAN Ankyrin repeat and SOCS box protein 18 OS=Homo sapiens GN=ASB18 PE=2 SV=2 431 655 1.0E-12
sp|Q69ZU8|ANKR6_MOUSE Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 436 686 1.0E-12
sp|Q5UPG6|YL092_MIMIV Putative ankyrin repeat protein L92 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L92 PE=3 SV=1 343 556 1.0E-12
sp|Q8WXD9|CSKI1_HUMAN Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 357 562 1.0E-12
sp|P97819|PLPL9_MOUSE 85/88 kDa calcium-independent phospholipase A2 OS=Mus musculus GN=Pla2g6 PE=1 SV=3 428 666 1.0E-12
sp|Q9GL21|UACA_CANLF Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Canis lupus familiaris GN=UACA PE=2 SV=2 403 604 1.0E-12
sp|Q755Y0|AKR1_ASHGO Palmitoyltransferase AKR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AKR1 PE=3 SV=1 512 673 1.0E-12
sp|Q9BSK4|FEM1A_HUMAN Protein fem-1 homolog A OS=Homo sapiens GN=FEM1A PE=1 SV=1 361 553 1.0E-12
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 336 496 2.0E-12
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 499 687 2.0E-12
sp|P0C927|ASB14_RAT Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 342 623 2.0E-12
sp|Q8ZWC4|Y1861_PYRAE Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 532 671 2.0E-12
sp|A6NK59|ASB14_HUMAN Ankyrin repeat and SOCS box protein 14 OS=Homo sapiens GN=ASB14 PE=2 SV=2 339 560 2.0E-12
sp|Q08E43|ASB8_BOVIN Ankyrin repeat and SOCS box protein 8 OS=Bos taurus GN=ASB8 PE=2 SV=1 548 671 2.0E-12
sp|Q5R6D7|ASB8_PONAB Ankyrin repeat and SOCS box protein 8 OS=Pongo abelii GN=ASB8 PE=2 SV=1 548 671 2.0E-12
sp|Q9H765|ASB8_HUMAN Ankyrin repeat and SOCS box protein 8 OS=Homo sapiens GN=ASB8 PE=2 SV=1 548 671 2.0E-12
sp|Q66H07|FANK1_RAT Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 339 494 2.0E-12
sp|Q66H07|FANK1_RAT Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 339 486 2.0E-12
sp|Q8VHS6|ASB15_MOUSE Ankyrin repeat and SOCS box protein 15 OS=Mus musculus GN=Asb15 PE=2 SV=2 429 683 2.0E-12
sp|F8W2M1|HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 539 683 2.0E-12
sp|E1C656|HACE1_CHICK E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 379 554 2.0E-12
sp|Q09YK4|CTTB2_ATEGE Cortactin-binding protein 2 OS=Ateles geoffroyi GN=CTTNBP2 PE=3 SV=1 501 653 2.0E-12
sp|P46530|NOTC1_DANRE Neurogenic locus notch homolog protein 1 OS=Danio rerio GN=notch1a PE=2 SV=1 424 684 2.0E-12
sp|Q94A76|GORK_ARATH Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 407 584 2.0E-12
sp|Q01317|NUC2_NEUCR Ankyrin repeat protein nuc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuc-2 PE=3 SV=2 393 689 2.0E-12
sp|Q9P0K7|RAI14_HUMAN Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 478 683 2.0E-12
sp|Q2T9K6|FEM1C_XENLA Protein fem-1 homolog C OS=Xenopus laevis GN=fem1c PE=2 SV=1 498 674 2.0E-12
sp|Q2QLA2|CTTB2_HORSE Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 501 655 2.0E-12
sp|P31695|NOTC4_MOUSE Neurogenic locus notch homolog protein 4 OS=Mus musculus GN=Notch4 PE=1 SV=2 416 640 2.0E-12
sp|Q5ZM55|FEM1B_CHICK Protein fem-1 homolog B OS=Gallus gallus GN=FEM1B PE=2 SV=1 534 683 2.0E-12
sp|A1X157|CTTB2_ECHTE Cortactin-binding protein 2 OS=Echinops telfairi GN=CTTNBP2 PE=3 SV=1 501 667 2.0E-12
sp|Q2QLG9|CTTB2_OTOGA Cortactin-binding protein 2 OS=Otolemur garnettii GN=CTTNBP2 PE=3 SV=1 534 683 2.0E-12
sp|Q6ZVZ8|ASB18_HUMAN Ankyrin repeat and SOCS box protein 18 OS=Homo sapiens GN=ASB18 PE=2 SV=2 363 571 2.0E-12
sp|Q8WXD9|CSKI1_HUMAN Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 424 635 2.0E-12
sp|Q17QS6|ASB5_BOVIN Ankyrin repeat and SOCS box protein 5 OS=Bos taurus GN=ASB5 PE=2 SV=1 319 575 2.0E-12
sp|Q8WXE0|CSKI2_HUMAN Caskin-2 OS=Homo sapiens GN=CASKIN2 PE=1 SV=2 498 670 2.0E-12
sp|Q865U8|ANKR1_PIG Ankyrin repeat domain-containing protein 1 OS=Sus scrofa GN=ANKRD1 PE=2 SV=1 514 672 2.0E-12
sp|Q8HYY4|UACA_BOVIN Uveal autoantigen with coiled-coil domains and ankyrin repeats protein OS=Bos taurus GN=UACA PE=1 SV=1 403 591 2.0E-12
sp|P97570|PLPL9_RAT 85/88 kDa calcium-independent phospholipase A2 OS=Rattus norvegicus GN=Pla2g6 PE=1 SV=2 428 666 2.0E-12
sp|Q80VM7|ANR24_MOUSE Ankyrin repeat domain-containing protein 24 OS=Mus musculus GN=Ankrd24 PE=2 SV=4 515 670 2.0E-12
sp|P21783|NOTC1_XENLA Neurogenic locus notch homolog protein 1 OS=Xenopus laevis GN=notch1 PE=1 SV=3 353 631 2.0E-12
sp|Q54KH3|ANR39_DICDI Ankyrin repeat domain-containing protein 39 homolog OS=Dictyostelium discoideum GN=ankrd39 PE=3 SV=2 462 569 2.0E-12
sp|Q15327|ANKR1_HUMAN Ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=ANKRD1 PE=1 SV=2 514 672 2.0E-12
sp|Q8VHK1|CSKI2_MOUSE Caskin-2 OS=Mus musculus GN=Caskin2 PE=1 SV=3 498 670 2.0E-12
sp|Q91ZT8|ASB9_MOUSE Ankyrin repeat and SOCS box protein 9 OS=Mus musculus GN=Asb9 PE=1 SV=2 531 683 2.0E-12
sp|Q9J5I7|V014_FOWPN Putative ankyrin repeat protein FPV014 OS=Fowlpox virus (strain NVSL) GN=FPV014 PE=3 SV=1 342 611 3.0E-12
sp|Q978J0|Y1425_THEVO Putative ankyrin repeat protein TV1425 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1425 PE=1 SV=1 357 496 3.0E-12
sp|Q9D504|ANKR7_MOUSE Ankyrin repeat domain-containing protein 7 OS=Mus musculus GN=Ankrd7 PE=2 SV=2 552 711 3.0E-12
sp|P14360|V240_FOWPN Putative ankyrin repeat protein FPV240 OS=Fowlpox virus (strain NVSL) GN=FPV240 PE=3 SV=1 410 625 3.0E-12
sp|Q5JPF3|AN36C_HUMAN Ankyrin repeat domain-containing protein 36C OS=Homo sapiens GN=ANKRD36C PE=2 SV=3 400 562 3.0E-12
sp|Q4R544|ASB8_MACFA Ankyrin repeat and SOCS box protein 8 OS=Macaca fascicularis GN=ASB8 PE=2 SV=1 548 671 3.0E-12
sp|Q6S5H4|POTEB_HUMAN POTE ankyrin domain family member B OS=Homo sapiens GN=POTEB PE=2 SV=1 326 507 3.0E-12
sp|A0JP26|POTB3_HUMAN POTE ankyrin domain family member B3 OS=Homo sapiens GN=POTEB3 PE=2 SV=2 326 507 3.0E-12
sp|B2RU33|POTEC_HUMAN POTE ankyrin domain family member C OS=Homo sapiens GN=POTEC PE=2 SV=2 326 507 3.0E-12
sp|Q8N283|ANR35_HUMAN Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 529 683 3.0E-12
sp|Q862Z2|ASB5_RABIT Ankyrin repeat and SOCS box protein 5 OS=Oryctolagus cuniculus GN=ASB5 PE=2 SV=1 343 575 3.0E-12
sp|Q5URB9|YR840_MIMIV Putative ankyrin repeat protein R840 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R840 PE=3 SV=1 339 658 3.0E-12
sp|Q653P0|KOR1_ORYSJ Potassium channel KOR1 OS=Oryza sativa subsp. japonica GN=Os06g0250600 PE=2 SV=1 481 650 3.0E-12
sp|Q8WWX0|ASB5_HUMAN Ankyrin repeat and SOCS box protein 5 OS=Homo sapiens GN=ASB5 PE=2 SV=1 384 622 3.0E-12
sp|A6QL64|AN36A_HUMAN Ankyrin repeat domain-containing protein 36A OS=Homo sapiens GN=ANKRD36 PE=2 SV=3 368 562 3.0E-12
sp|Q8CEF1|FEM1C_MOUSE Protein fem-1 homolog C OS=Mus musculus GN=Fem1c PE=2 SV=1 498 674 3.0E-12
sp|Q4X251|AKR1_ASPFU Palmitoyltransferase akr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=akr1 PE=3 SV=2 514 684 3.0E-12
sp|Q96JP0|FEM1C_HUMAN Protein fem-1 homolog C OS=Homo sapiens GN=FEM1C PE=1 SV=1 498 674 3.0E-12
sp|Q9J5H9|V022_FOWPN Putative ankyrin repeat protein FPV022 OS=Fowlpox virus (strain NVSL) GN=FPV022 PE=3 SV=1 342 539 3.0E-12
sp|Q6S8J7|POTEA_HUMAN POTE ankyrin domain family member A OS=Homo sapiens GN=POTEA PE=2 SV=1 379 562 3.0E-12
sp|Q9GZV1|ANKR2_HUMAN Ankyrin repeat domain-containing protein 2 OS=Homo sapiens GN=ANKRD2 PE=1 SV=3 532 683 3.0E-12
sp|Q9GZV1|ANKR2_HUMAN Ankyrin repeat domain-containing protein 2 OS=Homo sapiens GN=ANKRD2 PE=1 SV=3 475 634 3.0E-12
sp|P98150|NFKB2_CHICK Nuclear factor NF-kappa-B p100 subunit OS=Gallus gallus GN=NFKB2 PE=1 SV=1 356 559 3.0E-12
sp|Q99466|NOTC4_HUMAN Neurogenic locus notch homolog protein 4 OS=Homo sapiens GN=NOTCH4 PE=1 SV=2 353 617 3.0E-12
sp|Q99466|NOTC4_HUMAN Neurogenic locus notch homolog protein 4 OS=Homo sapiens GN=NOTCH4 PE=1 SV=2 484 661 3.0E-12
sp|Q7XUW4|KOR2_ORYSJ Potassium channel KOR2 OS=Oryza sativa subsp. japonica GN=Os04g0445000 PE=2 SV=2 339 469 3.0E-12
sp|Q9M8S6|SKOR_ARATH Potassium channel SKOR OS=Arabidopsis thaliana GN=SKOR PE=1 SV=1 481 650 3.0E-12
sp|Q923M0|PP16A_MOUSE Protein phosphatase 1 regulatory subunit 16A OS=Mus musculus GN=Ppp1r16a PE=1 SV=1 413 635 3.0E-12
sp|Q00PJ1|CTTB2_ATEAB Cortactin-binding protein 2 OS=Atelerix albiventris GN=CTTNBP2 PE=3 SV=1 501 657 3.0E-12
sp|Q4I8B6|AKR1_GIBZE Palmitoyltransferase AKR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=AKR1 PE=3 SV=1 457 638 3.0E-12
sp|Q8N9B4|ANR42_HUMAN Ankyrin repeat domain-containing protein 42 OS=Homo sapiens GN=ANKRD42 PE=2 SV=2 418 656 3.0E-12
sp|Q8R516|MIB2_MOUSE E3 ubiquitin-protein ligase MIB2 OS=Mus musculus GN=Mib2 PE=1 SV=2 429 673 3.0E-12
sp|Q9CWU2|ZDH13_MOUSE Palmitoyltransferase ZDHHC13 OS=Mus musculus GN=Zdhhc13 PE=1 SV=2 408 635 3.0E-12
sp|Q8VHA6|ASB18_MOUSE Ankyrin repeat and SOCS box protein 18 OS=Mus musculus GN=Asb18 PE=2 SV=1 431 655 3.0E-12
sp|A1ZBY1|FEM1B_DROME Protein fem-1 homolog B OS=Drosophila melanogaster GN=Fem-1 PE=2 SV=1 501 687 3.0E-12
sp|Q8BLA8|TRPA1_MOUSE Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 336 590 4.0E-12
sp|H3BUK9|POTB2_HUMAN POTE ankyrin domain family member B2 OS=Homo sapiens GN=POTEB2 PE=3 SV=1 326 507 4.0E-12
sp|H3BUK9|POTB2_HUMAN POTE ankyrin domain family member B2 OS=Homo sapiens GN=POTEB2 PE=3 SV=1 517 683 4.0E-12
sp|Q3U0D9|HACE1_MOUSE E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 372 554 4.0E-12
sp|Q9BXX2|AN30B_HUMAN Ankyrin repeat domain-containing protein 30B OS=Homo sapiens GN=ANKRD30B PE=2 SV=3 350 644 4.0E-12
sp|A6NHY2|AKD1B_HUMAN Ankyrin repeat and death domain-containing protein 1B OS=Homo sapiens GN=ANKDD1B PE=3 SV=3 351 600 4.0E-12
sp|Q804S5|MIB1_DANRE E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 333 635 4.0E-12
sp|A7MB89|FEM1C_BOVIN Protein fem-1 homolog C OS=Bos taurus GN=FEM1C PE=2 SV=1 498 674 4.0E-12
sp|Q9P0K7|RAI14_HUMAN Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 350 529 4.0E-12
sp|B9EJA2|CTTB2_MOUSE Cortactin-binding protein 2 OS=Mus musculus GN=Cttnbp2 PE=1 SV=2 503 653 4.0E-12
sp|Q7S3M5|AKR1_NEUCR Palmitoyltransferase akr1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-1 PE=3 SV=2 499 666 4.0E-12
sp|P98150|NFKB2_CHICK Nuclear factor NF-kappa-B p100 subunit OS=Gallus gallus GN=NFKB2 PE=1 SV=1 398 590 4.0E-12
sp|Q7T3P8|FEM1C_DANRE Protein fem-1 homolog C OS=Danio rerio GN=fem1c PE=2 SV=2 354 551 4.0E-12
sp|Q8R516|MIB2_MOUSE E3 ubiquitin-protein ligase MIB2 OS=Mus musculus GN=Mib2 PE=1 SV=2 398 675 4.0E-12
sp|Q5UR04|YR911_MIMIV Putative ankyrin repeat protein R911 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R911 PE=3 SV=1 339 661 4.0E-12
sp|Q91974|IKBA_CHICK NF-kappa-B inhibitor alpha OS=Gallus gallus GN=NFKBIA PE=2 SV=1 559 683 4.0E-12
sp|Q29RM5|FEM1A_BOVIN Protein fem-1 homolog A OS=Bos taurus GN=FEM1A PE=2 SV=1 361 553 4.0E-12
sp|Q8R560|ANKR1_RAT Ankyrin repeat domain-containing protein 1 OS=Rattus norvegicus GN=Ankrd1 PE=1 SV=1 529 672 4.0E-12
sp|Q6RI86|TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 336 590 5.0E-12
sp|Q5GIG6|TNI3K_MOUSE Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 531 671 5.0E-12
sp|Q71S22|INVSA_XENLA Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 392 684 5.0E-12
sp|Q978J0|Y1425_THEVO Putative ankyrin repeat protein TV1425 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1425 PE=1 SV=1 559 684 5.0E-12
sp|Q91ZU0|ASB7_MOUSE Ankyrin repeat and SOCS box protein 7 OS=Mus musculus GN=Asb7 PE=2 SV=2 506 683 5.0E-12
sp|Q9H672|ASB7_HUMAN Ankyrin repeat and SOCS box protein 7 OS=Homo sapiens GN=ASB7 PE=1 SV=2 506 683 5.0E-12
sp|Q6S545|POTEH_HUMAN POTE ankyrin domain family member H OS=Homo sapiens GN=POTEH PE=2 SV=3 400 562 5.0E-12
sp|Q6S5H5|POTEG_HUMAN POTE ankyrin domain family member G OS=Homo sapiens GN=POTEG PE=2 SV=5 400 562 5.0E-12
sp|Q9VUX2|MIB_DROME E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 490 683 5.0E-12
sp|Q5UPU4|YR267_MIMIV Putative ankyrin repeat protein R267 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R267 PE=3 SV=1 342 628 5.0E-12
sp|A1ZBY1|FEM1B_DROME Protein fem-1 homolog B OS=Drosophila melanogaster GN=Fem-1 PE=2 SV=1 352 541 5.0E-12
sp|Q9CR42|ANKR1_MOUSE Ankyrin repeat domain-containing protein 1 OS=Mus musculus GN=Ankrd1 PE=1 SV=1 529 672 5.0E-12
sp|O60733|PLPL9_HUMAN 85/88 kDa calcium-independent phospholipase A2 OS=Homo sapiens GN=PLA2G6 PE=1 SV=2 427 662 5.0E-12
sp|Q5URB8|YR841_MIMIV Putative ankyrin repeat protein R841 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R841 PE=3 SV=1 344 592 6.0E-12
sp|Q54HW1|PSD10_DICDI 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 357 520 6.0E-12
sp|Q9BGT9|ASB7_MACFA Ankyrin repeat and SOCS box protein 7 OS=Macaca fascicularis GN=ASB7 PE=2 SV=1 506 683 6.0E-12
sp|A6NI47|POTEM_HUMAN Putative POTE ankyrin domain family member M OS=Homo sapiens GN=POTEM PE=3 SV=2 400 562 6.0E-12
sp|P0CG39|POTEJ_HUMAN POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 400 562 6.0E-12
sp|Q8WWX0|ASB5_HUMAN Ankyrin repeat and SOCS box protein 5 OS=Homo sapiens GN=ASB5 PE=2 SV=1 343 575 6.0E-12
sp|Q3EC11|ZDHC2_ARATH Probable protein S-acyltransferase 23 OS=Arabidopsis thaliana GN=PAT23 PE=2 SV=2 455 642 6.0E-12
sp|Q17QS6|ASB5_BOVIN Ankyrin repeat and SOCS box protein 5 OS=Bos taurus GN=ASB5 PE=2 SV=1 384 622 6.0E-12
sp|O90760|V031_FOWPN Putative ankyrin repeat protein FPV031 OS=Fowlpox virus (strain NVSL) GN=ANK3 PE=3 SV=1 433 613 6.0E-12
sp|P50086|PSD10_YEAST Probable 26S proteasome regulatory subunit p28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAS6 PE=1 SV=1 428 596 6.0E-12
sp|Q9D738|ASB12_MOUSE Ankyrin repeat and SOCS box protein 12 OS=Mus musculus GN=Asb12 PE=2 SV=1 501 623 6.0E-12
sp|Q8UVC1|INVS_DANRE Inversin OS=Danio rerio GN=invs PE=2 SV=1 499 687 7.0E-12
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 499 687 7.0E-12
sp|Q8C6Y6|ASB14_MOUSE Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 342 623 7.0E-12
sp|Q9D504|ANKR7_MOUSE Ankyrin repeat domain-containing protein 7 OS=Mus musculus GN=Ankrd7 PE=2 SV=2 312 494 7.0E-12
sp|D3ZBM7|HACE1_RAT E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 372 554 7.0E-12
sp|P0CG38|POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 400 562 7.0E-12
sp|Q2IBD4|CTTB2_RAT Cortactin-binding protein 2 OS=Rattus norvegicus GN=Cttnbp2 PE=1 SV=1 501 653 7.0E-12
sp|A2A2Z9|AN18B_HUMAN Ankyrin repeat domain-containing protein 18B OS=Homo sapiens GN=ANKRD18B PE=1 SV=1 524 683 7.0E-12
sp|Q95N27|PP16B_BOVIN Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Bos taurus GN=PPP1R16B PE=1 SV=1 398 624 7.0E-12
sp|Q5NVB9|ZDH13_PONAB Palmitoyltransferase ZDHHC13 OS=Pongo abelii GN=ZDHHC13 PE=2 SV=1 451 635 7.0E-12
sp|Q3UMR0|ANR27_MOUSE Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 357 567 8.0E-12
sp|Q978J0|Y1425_THEVO Putative ankyrin repeat protein TV1425 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1425 PE=1 SV=1 313 486 8.0E-12
sp|Q4ULZ2|Y580_RICFE Putative ankyrin repeat protein RF_0580 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0580 PE=3 SV=1 430 657 8.0E-12
sp|Q9J504|V231_FOWPN Putative ankyrin repeat protein FPV231 OS=Fowlpox virus (strain NVSL) GN=FPV231 PE=3 SV=1 543 683 8.0E-12
sp|Q3ZBX7|ANKR1_BOVIN Ankyrin repeat domain-containing protein 1 OS=Bos taurus GN=ANKRD1 PE=2 SV=1 368 503 8.0E-12
sp|Q2IBA2|CTTB2_CHLAE Cortactin-binding protein 2 OS=Chlorocebus aethiops GN=CTTNBP2 PE=3 SV=1 501 653 8.0E-12
sp|A0M8S4|CTTB2_PAPAN Cortactin-binding protein 2 OS=Papio anubis GN=CTTNBP2 PE=3 SV=1 501 653 8.0E-12
sp|Q5UP39|YR873_MIMIV Putative ankyrin repeat protein R873 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R873 PE=3 SV=1 408 683 8.0E-12
sp|Q8IUH4|ZDH13_HUMAN Palmitoyltransferase ZDHHC13 OS=Homo sapiens GN=ZDHHC13 PE=1 SV=3 451 635 8.0E-12
sp|Q862Z2|ASB5_RABIT Ankyrin repeat and SOCS box protein 5 OS=Oryctolagus cuniculus GN=ASB5 PE=2 SV=1 384 622 9.0E-12
sp|Q07DY4|CTTB2_COLGU Cortactin-binding protein 2 OS=Colobus guereza GN=CTTNBP2 PE=3 SV=1 501 653 9.0E-12
sp|Q91ZT8|ASB9_MOUSE Ankyrin repeat and SOCS box protein 9 OS=Mus musculus GN=Asb9 PE=1 SV=2 501 665 9.0E-12
sp|Q09YK6|ASZ1_ATEGE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ateles geoffroyi GN=ASZ1 PE=3 SV=1 534 696 9.0E-12
sp|Q9QZH2|BARD1_RAT BRCA1-associated RING domain protein 1 OS=Rattus norvegicus GN=Bard1 PE=2 SV=1 519 694 9.0E-12
sp|Q2QLB5|ASZ1_CALMO Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Callicebus moloch GN=ASZ1 PE=3 SV=1 503 696 9.0E-12
sp|Q8WXK4|ASB12_HUMAN Ankyrin repeat and SOCS box protein 12 OS=Homo sapiens GN=ASB12 PE=1 SV=2 501 623 9.0E-12
sp|Q9D2J7|ANKE1_MOUSE Ankyrin repeat and EF-hand domain-containing protein 1 OS=Mus musculus GN=Ankef1 PE=2 SV=1 543 695 9.0E-12
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 565 683 1.0E-11
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 565 683 1.0E-11
sp|Q8VHS6|ASB15_MOUSE Ankyrin repeat and SOCS box protein 15 OS=Mus musculus GN=Asb15 PE=2 SV=2 339 624 1.0E-11
sp|A6NGH8|ANR61_HUMAN Ankyrin repeat domain-containing protein 61 OS=Homo sapiens GN=ANKRD61 PE=3 SV=2 502 687 1.0E-11
sp|P59672|ANS1A_MOUSE Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus GN=Anks1a PE=1 SV=3 350 569 1.0E-11
sp|Q86YR6|POTED_HUMAN POTE ankyrin domain family member D OS=Homo sapiens GN=POTED PE=2 SV=2 346 554 1.0E-11
sp|Q9J5H5|V026_FOWPN Putative ankyrin repeat protein FPV026 OS=Fowlpox virus (strain NVSL) GN=FPV026 PE=3 SV=1 363 524 1.0E-11
sp|Q9R172|NOTC3_RAT Neurogenic locus notch homolog protein 3 OS=Rattus norvegicus GN=Notch3 PE=2 SV=2 422 696 1.0E-11
sp|Q5UPG7|YL091_MIMIV Putative ankyrin repeat protein L91 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L91 PE=3 SV=1 342 659 1.0E-11
sp|Q61982|NOTC3_MOUSE Neurogenic locus notch homolog protein 3 OS=Mus musculus GN=Notch3 PE=1 SV=1 422 696 1.0E-11
sp|A6QL64|AN36A_HUMAN Ankyrin repeat domain-containing protein 36A OS=Homo sapiens GN=ANKRD36 PE=2 SV=3 410 595 1.0E-11
sp|Q9D1A4|ASB5_MOUSE Ankyrin repeat and SOCS box protein 5 OS=Mus musculus GN=Asb5 PE=2 SV=1 500 663 1.0E-11
sp|Q9CQM6|ANR61_MOUSE Ankyrin repeat domain-containing protein 61 OS=Mus musculus GN=Ankrd61 PE=2 SV=1 284 569 1.0E-11
sp|Q7Z8U2|AKR1_ASPOR Palmitoyltransferase akr1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=akr1 PE=3 SV=2 514 690 1.0E-11
sp|Q5BKI6|ANKR1_XENTR Ankyrin repeat domain-containing protein 1 OS=Xenopus tropicalis GN=ankrd1 PE=2 SV=1 532 683 1.0E-11
sp|Q6GNY1|MIB1_XENLA E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis GN=mib1 PE=2 SV=1 490 726 1.0E-11
sp|Q17QS6|ASB5_BOVIN Ankyrin repeat and SOCS box protein 5 OS=Bos taurus GN=ASB5 PE=2 SV=1 500 663 1.0E-11
sp|Q8VHK1|CSKI2_MOUSE Caskin-2 OS=Mus musculus GN=Caskin2 PE=1 SV=3 424 635 1.0E-11
sp|Q8N9B4|ANR42_HUMAN Ankyrin repeat domain-containing protein 42 OS=Homo sapiens GN=ANKRD42 PE=2 SV=2 307 595 1.0E-11
sp|Q9CR42|ANKR1_MOUSE Ankyrin repeat domain-containing protein 1 OS=Mus musculus GN=Ankrd1 PE=1 SV=1 368 503 1.0E-11
sp|Q96I34|PP16A_HUMAN Protein phosphatase 1 regulatory subunit 16A OS=Homo sapiens GN=PPP1R16A PE=1 SV=1 398 619 1.0E-11
sp|P40480|HOS4_YEAST Protein HOS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOS4 PE=1 SV=1 560 668 1.0E-11
sp|Q0V8G2|GABP2_BOVIN GA-binding protein subunit beta-2 OS=Bos taurus GN=GABPB2 PE=2 SV=2 536 695 1.0E-11
sp|Q5UPB9|YL042_MIMIV Putative ankyrin repeat protein L42 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L42 PE=3 SV=1 512 670 1.0E-11
sp|Q8VHQ3|PP16B_MOUSE Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Mus musculus GN=Ppp1r16b PE=1 SV=1 398 624 1.0E-11
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 338 569 2.0E-11
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 351 491 2.0E-11
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 499 687 2.0E-11
sp|P0C0T2|ANKS6_RAT Ankyrin repeat and SAM domain-containing protein 6 OS=Rattus norvegicus GN=Anks6 PE=1 SV=2 538 702 2.0E-11
sp|A5PMU4|ANS1B_DANRE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 350 562 2.0E-11
sp|F8W2M1|HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 379 554 2.0E-11
sp|Q86YR6|POTED_HUMAN POTE ankyrin domain family member D OS=Homo sapiens GN=POTED PE=2 SV=2 326 507 2.0E-11
sp|Q9EP71|RAI14_MOUSE Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 350 561 2.0E-11
sp|Q96DX5|ASB9_HUMAN Ankyrin repeat and SOCS box protein 9 OS=Homo sapiens GN=ASB9 PE=1 SV=1 531 684 2.0E-11
sp|Q9J5H5|V026_FOWPN Putative ankyrin repeat protein FPV026 OS=Fowlpox virus (strain NVSL) GN=FPV026 PE=3 SV=1 360 560 2.0E-11
sp|Q18297|TRPA1_CAEEL Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans GN=trpa-1 PE=2 SV=5 338 688 2.0E-11
sp|P17221|FEM1_CAEEL Sex-determining protein fem-1 OS=Caenorhabditis elegans GN=fem-1 PE=1 SV=1 358 551 2.0E-11
sp|Q94A76|GORK_ARATH Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 543 686 2.0E-11
sp|Q2T9W8|ANR61_BOVIN Ankyrin repeat domain-containing protein 61 OS=Bos taurus GN=ANKRD61 PE=2 SV=1 348 587 2.0E-11
sp|Q9D1A4|ASB5_MOUSE Ankyrin repeat and SOCS box protein 5 OS=Mus musculus GN=Asb5 PE=2 SV=1 343 575 2.0E-11
sp|Q2T9K6|FEM1C_XENLA Protein fem-1 homolog C OS=Xenopus laevis GN=fem1c PE=2 SV=1 531 691 2.0E-11
sp|A6NC57|ANR62_HUMAN Ankyrin repeat domain-containing protein 62 OS=Homo sapiens GN=ANKRD62 PE=2 SV=4 398 562 2.0E-11
sp|Q5TYW2|A20A1_HUMAN Ankyrin repeat domain-containing protein 20A1 OS=Homo sapiens GN=ANKRD20A1 PE=2 SV=1 331 562 2.0E-11
sp|Q7Z8U2|AKR1_ASPOR Palmitoyltransferase akr1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=akr1 PE=3 SV=2 428 625 2.0E-11
sp|Q5VUR7|A20A3_HUMAN Ankyrin repeat domain-containing protein 20A3 OS=Homo sapiens GN=ANKRD20A3 PE=3 SV=1 331 562 2.0E-11
sp|Q5SQ80|A20A2_HUMAN Ankyrin repeat domain-containing protein 20A2 OS=Homo sapiens GN=ANKRD20A2 PE=3 SV=1 331 562 2.0E-11
sp|Q5UP11|YR848_MIMIV Putative ankyrin repeat protein R848 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R848 PE=3 SV=1 351 626 2.0E-11
sp|Q5BKI6|ANKR1_XENTR Ankyrin repeat domain-containing protein 1 OS=Xenopus tropicalis GN=ankrd1 PE=2 SV=1 351 503 2.0E-11
sp|Q5UPU4|YR267_MIMIV Putative ankyrin repeat protein R267 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R267 PE=3 SV=1 413 687 2.0E-11
sp|Q96T49|PP16B_HUMAN Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Homo sapiens GN=PPP1R16B PE=1 SV=1 398 624 2.0E-11
sp|Q5UQ08|YR787_MIMIV Putative ankyrin repeat protein R787 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R787 PE=3 SV=1 433 661 2.0E-11
sp|A1X157|CTTB2_ECHTE Cortactin-binding protein 2 OS=Echinops telfairi GN=CTTNBP2 PE=3 SV=1 305 558 2.0E-11
sp|Q6P9K8|CSKI1_MOUSE Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 513 670 2.0E-11
sp|Q54BA2|Y3800_DICDI Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 539 671 2.0E-11
sp|Q54BA2|Y3800_DICDI Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 372 549 2.0E-11
sp|Q5B0V6|AKR1_EMENI Palmitoyltransferase akr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=akr1 PE=3 SV=2 462 656 2.0E-11
sp|Q8VHK2|CSKI1_RAT Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 513 670 2.0E-11
sp|Q69ZU8|ANKR6_MOUSE Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 341 586 2.0E-11
sp|Q9GL21|UACA_CANLF Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Canis lupus familiaris GN=UACA PE=2 SV=2 351 492 2.0E-11
sp|Q8R560|ANKR1_RAT Ankyrin repeat domain-containing protein 1 OS=Rattus norvegicus GN=Ankrd1 PE=1 SV=1 368 503 2.0E-11
sp|P50086|PSD10_YEAST Probable 26S proteasome regulatory subunit p28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAS6 PE=1 SV=1 498 664 2.0E-11
sp|Q9D738|ASB12_MOUSE Ankyrin repeat and SOCS box protein 12 OS=Mus musculus GN=Asb12 PE=2 SV=1 467 657 2.0E-11
sp|Q8IVF6|AN18A_HUMAN Ankyrin repeat domain-containing protein 18A OS=Homo sapiens GN=ANKRD18A PE=2 SV=3 326 512 2.0E-11
sp|Q6NLQ8|XB32_ARATH E3 ubiquitin-protein ligase XBAT32 OS=Arabidopsis thaliana GN=XBAT32 PE=1 SV=1 513 735 2.0E-11
sp|Q9Y2G4|ANKR6_HUMAN Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 365 617 2.0E-11
sp|O60237|MYPT2_HUMAN Protein phosphatase 1 regulatory subunit 12B OS=Homo sapiens GN=PPP1R12B PE=1 SV=2 343 617 2.0E-11
sp|O70445|BARD1_MOUSE BRCA1-associated RING domain protein 1 OS=Mus musculus GN=Bard1 PE=2 SV=1 552 655 2.0E-11
sp|Q876L5|AKR1_SACU7 Palmitoyltransferase AKR1 OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=AKR1 PE=3 SV=2 444 653 2.0E-11
sp|P0CS66|AKR1_CRYNJ Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=AKR1 PE=3 SV=1 441 634 2.0E-11
sp|P0CS67|AKR1_CRYNB Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=AKR1 PE=3 SV=1 441 634 2.0E-11
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 537 684 3.0E-11
sp|Q3UMR0|ANR27_MOUSE Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 498 629 3.0E-11
sp|Q5DW34|EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 358 607 3.0E-11
sp|Q96Q27|ASB2_HUMAN Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 502 685 3.0E-11
sp|Q978J0|Y1425_THEVO Putative ankyrin repeat protein TV1425 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1425 PE=1 SV=1 500 652 3.0E-11
sp|Q3SZE4|ASB11_BOVIN Ankyrin repeat and SOCS box protein 11 OS=Bos taurus GN=ASB11 PE=2 SV=1 363 588 3.0E-11
sp|F8W2M1|HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 400 650 3.0E-11
sp|Q92625|ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 522 683 3.0E-11
sp|Q9CQ31|ASB11_MOUSE Ankyrin repeat and SOCS box protein 11 OS=Mus musculus GN=Asb11 PE=2 SV=1 363 562 3.0E-11
sp|Q7S3M5|AKR1_NEUCR Palmitoyltransferase akr1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-1 PE=3 SV=2 514 684 3.0E-11
sp|Q5CZ79|AN20B_HUMAN Ankyrin repeat domain-containing protein 20B OS=Homo sapiens GN=ANKRD20A8P PE=2 SV=2 331 562 3.0E-11
sp|Q4UJ75|A20A4_HUMAN Ankyrin repeat domain-containing protein 20A4 OS=Homo sapiens GN=ANKRD20A4 PE=3 SV=1 331 562 3.0E-11
sp|Q9J508|V227_FOWPN Putative ankyrin repeat protein FPV227 OS=Fowlpox virus (strain NVSL) GN=FPV227 PE=3 SV=1 536 672 3.0E-11
sp|P14368|V234_FOWPN Putative ankyrin repeat protein FPV234 OS=Fowlpox virus (strain NVSL) GN=FPV234 PE=3 SV=2 408 636 3.0E-11
sp|Q9SCX5|AKT5_ARATH Probable potassium channel AKT5 OS=Arabidopsis thaliana GN=AKT5 PE=2 SV=2 365 573 3.0E-11
sp|Q7ZT11|ANKR1_CHICK Ankyrin repeat domain-containing protein 1 OS=Gallus gallus GN=ANKRD1 PE=2 SV=1 500 635 3.0E-11
sp|Q69ZU8|ANKR6_MOUSE Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 365 617 3.0E-11
sp|Q8WXE0|CSKI2_HUMAN Caskin-2 OS=Homo sapiens GN=CASKIN2 PE=1 SV=2 424 635 3.0E-11
sp|Q9Y2G4|ANKR6_HUMAN Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 476 683 3.0E-11
sp|P0CS66|AKR1_CRYNJ Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=AKR1 PE=3 SV=1 441 692 3.0E-11
sp|P0CS67|AKR1_CRYNB Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=AKR1 PE=3 SV=1 441 692 3.0E-11
sp|Q9J503|V232_FOWPN Putative ankyrin repeat protein FPV232 OS=Fowlpox virus (strain NVSL) GN=FPV232 PE=3 SV=1 435 679 3.0E-11
sp|Q05753|AKRP_ARATH Ankyrin repeat domain-containing protein, chloroplastic OS=Arabidopsis thaliana GN=AKRP PE=1 SV=2 348 486 3.0E-11
sp|Q6AFL2|Y958_LEIXX Putative ankyrin-containing lipoprotein Lxx09580 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=Lxx09580 PE=3 SV=2 513 671 3.0E-11
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 537 684 4.0E-11
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 537 684 4.0E-11
sp|Q8NB46|ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 532 683 4.0E-11
sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 532 683 4.0E-11
sp|Q8GXE6|AKT6_ARATH Potassium channel AKT6 OS=Arabidopsis thaliana GN=AKT6 PE=1 SV=2 518 666 4.0E-11
sp|Q96DX5|ASB9_HUMAN Ankyrin repeat and SOCS box protein 9 OS=Homo sapiens GN=ASB9 PE=1 SV=1 336 529 4.0E-11
sp|Q6P9Z4|FEM1A_DANRE Protein fem-1 homolog A OS=Danio rerio GN=fem1a PE=2 SV=1 535 668 4.0E-11
sp|Q9WV06|ANKR2_MOUSE Ankyrin repeat domain-containing protein 2 OS=Mus musculus GN=Ankrd2 PE=1 SV=3 368 502 4.0E-11
sp|Q5UPG6|YL092_MIMIV Putative ankyrin repeat protein L92 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L92 PE=3 SV=1 438 685 4.0E-11
sp|Q8WXD9|CSKI1_HUMAN Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 513 670 4.0E-11
sp|Q9D2J7|ANKE1_MOUSE Ankyrin repeat and EF-hand domain-containing protein 1 OS=Mus musculus GN=Ankef1 PE=2 SV=1 431 687 4.0E-11
sp|P81069|GABP2_MOUSE GA-binding protein subunit beta-2 OS=Mus musculus GN=Gabpb2 PE=1 SV=2 536 686 4.0E-11
sp|Q07DV3|ASZ1_AOTNA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Aotus nancymaae GN=ASZ1 PE=3 SV=1 534 696 4.0E-11
sp|Q9J5I3|V018_FOWPN Putative ankyrin repeat protein FPV018 OS=Fowlpox virus (strain NVSL) GN=FPV018 PE=3 SV=1 327 458 5.0E-11
sp|P0C0T2|ANKS6_RAT Ankyrin repeat and SAM domain-containing protein 6 OS=Rattus norvegicus GN=Anks6 PE=1 SV=2 399 684 5.0E-11
sp|B2RU33|POTEC_HUMAN POTE ankyrin domain family member C OS=Homo sapiens GN=POTEC PE=2 SV=2 524 683 5.0E-11
sp|Q9ERC1|MYO16_RAT Unconventional myosin-XVI OS=Rattus norvegicus GN=Myo16 PE=1 SV=1 379 626 5.0E-11
sp|Q9Y574|ASB4_HUMAN Ankyrin repeat and SOCS box protein 4 OS=Homo sapiens GN=ASB4 PE=2 SV=1 318 556 5.0E-11
sp|Q6P9Z4|FEM1A_DANRE Protein fem-1 homolog A OS=Danio rerio GN=fem1a PE=2 SV=1 534 691 5.0E-11
sp|Q38998|AKT1_ARATH Potassium channel AKT1 OS=Arabidopsis thaliana GN=AKT1 PE=1 SV=2 418 584 5.0E-11
sp|Q9CQ31|ASB11_MOUSE Ankyrin repeat and SOCS box protein 11 OS=Mus musculus GN=Asb11 PE=2 SV=1 433 667 5.0E-11
sp|A6NC57|ANR62_HUMAN Ankyrin repeat domain-containing protein 62 OS=Homo sapiens GN=ANKRD62 PE=2 SV=4 526 719 5.0E-11
sp|Q9GZV1|ANKR2_HUMAN Ankyrin repeat domain-containing protein 2 OS=Homo sapiens GN=ANKRD2 PE=1 SV=3 368 502 5.0E-11
sp|Q54BA2|Y3800_DICDI Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 513 732 5.0E-11
sp|O60237|MYPT2_HUMAN Protein phosphatase 1 regulatory subunit 12B OS=Homo sapiens GN=PPP1R12B PE=1 SV=2 481 674 5.0E-11
sp|Q8TAK5|GABP2_HUMAN GA-binding protein subunit beta-2 OS=Homo sapiens GN=GABPB2 PE=1 SV=1 536 716 5.0E-11
sp|Q6P6B7|ANR16_HUMAN Ankyrin repeat domain-containing protein 16 OS=Homo sapiens GN=ANKRD16 PE=1 SV=1 351 621 6.0E-11
sp|Q9WV71|ASB4_MOUSE Ankyrin repeat and SOCS box protein 4 OS=Mus musculus GN=Asb4 PE=1 SV=1 365 589 6.0E-11
sp|A2A2Z9|AN18B_HUMAN Ankyrin repeat domain-containing protein 18B OS=Homo sapiens GN=ANKRD18B PE=1 SV=1 411 620 6.0E-11
sp|Q8HYY4|UACA_BOVIN Uveal autoantigen with coiled-coil domains and ankyrin repeats protein OS=Bos taurus GN=UACA PE=1 SV=1 351 492 6.0E-11
sp|Q9D2J7|ANKE1_MOUSE Ankyrin repeat and EF-hand domain-containing protein 1 OS=Mus musculus GN=Ankef1 PE=2 SV=1 515 652 6.0E-11
sp|Q9Y2G4|ANKR6_HUMAN Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 436 686 6.0E-11
sp|Q96AX9|MIB2_HUMAN E3 ubiquitin-protein ligase MIB2 OS=Homo sapiens GN=MIB2 PE=1 SV=3 294 701 6.0E-11
sp|P14585|LIN12_CAEEL Protein lin-12 OS=Caenorhabditis elegans GN=lin-12 PE=1 SV=1 482 757 6.0E-11
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 338 556 7.0E-11
sp|Q6S545|POTEH_HUMAN POTE ankyrin domain family member H OS=Homo sapiens GN=POTEH PE=2 SV=3 339 518 7.0E-11
sp|Q9HYV6|Y3287_PSEAE Putative ankyrin repeat protein PA3287 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA3287 PE=3 SV=1 518 650 7.0E-11
sp|Q9J508|V227_FOWPN Putative ankyrin repeat protein FPV227 OS=Fowlpox virus (strain NVSL) GN=FPV227 PE=3 SV=1 436 620 7.0E-11
sp|Q6P9K8|CSKI1_MOUSE Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 557 683 7.0E-11
sp|A7E2S9|A30BL_HUMAN Putative ankyrin repeat domain-containing protein 30B-like OS=Homo sapiens GN=ANKRD30BL PE=2 SV=3 424 562 7.0E-11
sp|P39010|AKR1_YEAST Palmitoyltransferase AKR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AKR1 PE=1 SV=1 444 653 7.0E-11
sp|Q9TU71|ANKR1_RABIT Ankyrin repeat domain-containing protein 1 OS=Oryctolagus cuniculus GN=ANKRD1 PE=2 SV=1 368 503 7.0E-11
sp|Q4R690|ZDH13_MACFA Palmitoyltransferase ZDHHC13 OS=Macaca fascicularis GN=ZDHHC13 PE=2 SV=1 451 635 7.0E-11
sp|Q6GQX6|ANKS6_MOUSE Ankyrin repeat and SAM domain-containing protein 6 OS=Mus musculus GN=Anks6 PE=1 SV=2 536 686 8.0E-11
sp|P0C6P7|FEM1B_RAT Protein fem-1 homolog B OS=Rattus norvegicus GN=Fem1b PE=1 SV=1 363 594 8.0E-11
sp|Q9Z2G0|FEM1B_MOUSE Protein fem-1 homolog B OS=Mus musculus GN=Fem1b PE=1 SV=1 363 594 8.0E-11
sp|Q9UK73|FEM1B_HUMAN Protein fem-1 homolog B OS=Homo sapiens GN=FEM1B PE=1 SV=1 363 594 8.0E-11
sp|Q86SG2|ANR23_HUMAN Ankyrin repeat domain-containing protein 23 OS=Homo sapiens GN=ANKRD23 PE=1 SV=1 361 536 8.0E-11
sp|Q8IVF6|AN18A_HUMAN Ankyrin repeat domain-containing protein 18A OS=Homo sapiens GN=ANKRD18A PE=2 SV=3 411 620 8.0E-11
sp|A5A3E0|POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2 339 507 9.0E-11
sp|Q9J503|V232_FOWPN Putative ankyrin repeat protein FPV232 OS=Fowlpox virus (strain NVSL) GN=FPV232 PE=3 SV=1 377 542 9.0E-11
sp|Q86U10|LPP60_HUMAN 60 kDa lysophospholipase OS=Homo sapiens GN=ASPG PE=2 SV=3 406 551 9.0E-11
sp|Q9BZF9|UACA_HUMAN Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens GN=UACA PE=1 SV=2 351 492 9.0E-11
sp|Q4UJC0|Y2042_RICFE Putative ankyrin repeat protein RF_p42/RF_pd42 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_p42 PE=3 SV=1 567 671 9.0E-11
sp|Q1RK13|Y220_RICBR Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 341 497 1.0E-10
sp|Q92527|ANKR7_HUMAN Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 326 524 1.0E-10
sp|Q3SX45|ASB2_BOVIN Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 502 685 1.0E-10
sp|Q8WXK1|ASB15_HUMAN Ankyrin repeat and SOCS box protein 15 OS=Homo sapiens GN=ASB15 PE=2 SV=3 339 565 1.0E-10
sp|Q8HXA6|ASB15_BOVIN Ankyrin repeat and SOCS box protein 15 OS=Bos taurus GN=ASB15 PE=2 SV=2 339 565 1.0E-10
sp|A6NI47|POTEM_HUMAN Putative POTE ankyrin domain family member M OS=Homo sapiens GN=POTEM PE=3 SV=2 339 518 1.0E-10
sp|Q6S8J3|POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 339 507 1.0E-10
sp|Q1RHT6|Y997_RICBR Putative ankyrin repeat protein RBE_0997 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0997 PE=3 SV=1 342 591 1.0E-10
sp|Q8N283|ANR35_HUMAN Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 339 493 1.0E-10
sp|Q862Z2|ASB5_RABIT Ankyrin repeat and SOCS box protein 5 OS=Oryctolagus cuniculus GN=ASB5 PE=2 SV=1 500 661 1.0E-10
sp|Q96DX5|ASB9_HUMAN Ankyrin repeat and SOCS box protein 9 OS=Homo sapiens GN=ASB9 PE=1 SV=1 518 658 1.0E-10
sp|Q96DX5|ASB9_HUMAN Ankyrin repeat and SOCS box protein 9 OS=Homo sapiens GN=ASB9 PE=1 SV=1 434 635 1.0E-10
sp|Q8WWX0|ASB5_HUMAN Ankyrin repeat and SOCS box protein 5 OS=Homo sapiens GN=ASB5 PE=2 SV=1 500 661 1.0E-10
sp|A0M8T5|CTTB2_FELCA Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 463 622 1.0E-10
sp|A0M8T5|CTTB2_FELCA Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 349 496 1.0E-10
sp|Q09701|AKR1_SCHPO Palmitoyltransferase akr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=akr1 PE=3 SV=1 499 655 1.0E-10
sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 349 496 1.0E-10
sp|Q5CZ79|AN20B_HUMAN Ankyrin repeat domain-containing protein 20B OS=Homo sapiens GN=ANKRD20A8P PE=2 SV=2 501 750 1.0E-10
sp|Q2IBF8|CTTB2_EULMM Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 362 600 1.0E-10
sp|Q6S8J7|POTEA_HUMAN POTE ankyrin domain family member A OS=Homo sapiens GN=POTEA PE=2 SV=1 517 683 1.0E-10
sp|Q5ZM55|FEM1B_CHICK Protein fem-1 homolog B OS=Gallus gallus GN=FEM1B PE=2 SV=1 360 585 1.0E-10
sp|A2A2Z9|AN18B_HUMAN Ankyrin repeat domain-containing protein 18B OS=Homo sapiens GN=ANKRD18B PE=1 SV=1 512 671 1.0E-10
sp|Q6GNY1|MIB1_XENLA E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis GN=mib1 PE=2 SV=1 338 602 1.0E-10
sp|Q9J508|V227_FOWPN Putative ankyrin repeat protein FPV227 OS=Fowlpox virus (strain NVSL) GN=FPV227 PE=3 SV=1 418 554 1.0E-10
sp|Q4KL97|ANKR1_XENLA Ankyrin repeat domain-containing protein 1 OS=Xenopus laevis GN=ankrd1 PE=2 SV=1 351 503 1.0E-10
sp|Q8VHK2|CSKI1_RAT Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 557 683 1.0E-10
sp|Q6ZVZ8|ASB18_HUMAN Ankyrin repeat and SOCS box protein 18 OS=Homo sapiens GN=ASB18 PE=2 SV=2 401 651 1.0E-10
sp|Q8WXD9|CSKI1_HUMAN Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 557 683 1.0E-10
sp|Q80VM7|ANR24_MOUSE Ankyrin repeat domain-containing protein 24 OS=Mus musculus GN=Ankrd24 PE=2 SV=4 431 626 1.0E-10
sp|Q9SQK3|EM506_ARATH Ankyrin repeat domain-containing protein EMB506, chloroplastic OS=Arabidopsis thaliana GN=EMB506 PE=1 SV=1 469 617 1.0E-10
sp|Q90623|MYPT1_CHICK Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus GN=PPP1R12A PE=1 SV=1 478 705 1.0E-10
sp|Q09YH1|ASZ1_SAIBB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Saimiri boliviensis boliviensis GN=ASZ1 PE=3 SV=1 534 696 1.0E-10
sp|Q6DRG7|MYPT1_DANRE Protein phosphatase 1 regulatory subunit 12A OS=Danio rerio GN=ppp1r12a PE=2 SV=2 478 673 1.0E-10
sp|Q99728|BARD1_HUMAN BRCA1-associated RING domain protein 1 OS=Homo sapiens GN=BARD1 PE=1 SV=2 561 655 1.0E-10
sp|Q2QLG0|ASZ1_CALJA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Callithrix jacchus GN=ASZ1 PE=3 SV=1 534 696 1.0E-10
sp|O14593|RFXK_HUMAN DNA-binding protein RFXANK OS=Homo sapiens GN=RFXANK PE=1 SV=2 543 672 1.0E-10
sp|Q38898|AKT2_ARATH Potassium channel AKT2/3 OS=Arabidopsis thaliana GN=AKT2 PE=1 SV=1 499 624 1.0E-10
sp|Q876A6|AKR1_NAUCC Palmitoyltransferase AKR1 OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=AKR1 PE=3 SV=3 372 591 1.0E-10
sp|A6QPE7|ANR65_BOVIN Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 569 697 2.0E-10
sp|Q5REW9|ANR27_PONAB Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 399 683 2.0E-10
sp|Q8N6D5|ANR29_HUMAN Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 339 484 2.0E-10
sp|P0C927|ASB14_RAT Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 564 683 2.0E-10
sp|Q0JKV1|AKT1_ORYSJ Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 339 468 2.0E-10
sp|P0C550|AKT1_ORYSI Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 339 468 2.0E-10
sp|Q08E43|ASB8_BOVIN Ankyrin repeat and SOCS box protein 8 OS=Bos taurus GN=ASB8 PE=2 SV=1 342 470 2.0E-10
sp|Q6S545|POTEH_HUMAN POTE ankyrin domain family member H OS=Homo sapiens GN=POTEH PE=2 SV=3 346 554 2.0E-10
sp|F1N6G5|HACE1_BOVIN E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 400 630 2.0E-10
sp|Q6S5H5|POTEG_HUMAN POTE ankyrin domain family member G OS=Homo sapiens GN=POTEG PE=2 SV=5 346 554 2.0E-10
sp|Q6DCL5|HACE1_XENLA E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 379 554 2.0E-10
sp|Q28BK1|HACE1_XENTR E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 372 554 2.0E-10
sp|Q14DN9|AKD1B_MOUSE Ankyrin repeat and death domain-containing protein 1B OS=Mus musculus GN=Ankdd1b PE=2 SV=3 351 600 2.0E-10
sp|Q9UM47|NOTC3_HUMAN Neurogenic locus notch homolog protein 3 OS=Homo sapiens GN=NOTCH3 PE=1 SV=2 422 656 2.0E-10
sp|Q6GPE5|FEM1B_XENLA Protein fem-1 homolog B OS=Xenopus laevis GN=fem1b PE=2 SV=1 534 683 2.0E-10
sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 463 622 2.0E-10
sp|Q07DV1|CTTB2_AOTNA Cortactin-binding protein 2 OS=Aotus nancymaae GN=CTTNBP2 PE=3 SV=1 401 554 2.0E-10
sp|Q09YI1|CTTB2_SHEEP Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 463 622 2.0E-10
sp|Q09YI1|CTTB2_SHEEP Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 362 620 2.0E-10
sp|Q9H560|ANR19_HUMAN Putative ankyrin repeat domain-containing protein 19 OS=Homo sapiens GN=ANKRD19P PE=5 SV=1 565 683 2.0E-10
sp|Q9H560|ANR19_HUMAN Putative ankyrin repeat domain-containing protein 19 OS=Homo sapiens GN=ANKRD19P PE=5 SV=1 539 712 2.0E-10
sp|Q2IBF8|CTTB2_EULMM Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 463 622 2.0E-10
sp|Q3V096|ANR42_MOUSE Ankyrin repeat domain-containing protein 42 OS=Mus musculus GN=Ankrd42 PE=2 SV=1 352 684 2.0E-10
sp|Q4UJ75|A20A4_HUMAN Ankyrin repeat domain-containing protein 20A4 OS=Homo sapiens GN=ANKRD20A4 PE=3 SV=1 501 672 2.0E-10
sp|Q07E43|ASZ1_DASNO Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Dasypus novemcinctus GN=ASZ1 PE=3 SV=1 439 632 2.0E-10
sp|Q923M0|PP16A_MOUSE Protein phosphatase 1 regulatory subunit 16A OS=Mus musculus GN=Ppp1r16a PE=1 SV=1 337 538 2.0E-10
sp|A1X154|ASZ1_ECHTE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Echinops telfairi GN=ASZ1 PE=3 SV=1 439 632 2.0E-10
sp|Q54BA2|Y3800_DICDI Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 576 683 2.0E-10
sp|Q5B0V6|AKR1_EMENI Palmitoyltransferase akr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=akr1 PE=3 SV=2 514 684 2.0E-10
sp|Q865U8|ANKR1_PIG Ankyrin repeat domain-containing protein 1 OS=Sus scrofa GN=ANKRD1 PE=2 SV=1 368 503 2.0E-10
sp|Q15327|ANKR1_HUMAN Ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=ANKRD1 PE=1 SV=2 368 503 2.0E-10
sp|A1ZBY1|FEM1B_DROME Protein fem-1 homolog B OS=Drosophila melanogaster GN=Fem-1 PE=2 SV=1 456 639 2.0E-10
sp|Q8WXK4|ASB12_HUMAN Ankyrin repeat and SOCS box protein 12 OS=Homo sapiens GN=ASB12 PE=1 SV=2 467 657 2.0E-10
sp|Q9Y2G4|ANKR6_HUMAN Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 341 586 2.0E-10
sp|Q876L5|AKR1_SACU7 Palmitoyltransferase AKR1 OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=AKR1 PE=3 SV=2 477 677 2.0E-10
sp|Q05753|AKRP_ARATH Ankyrin repeat domain-containing protein, chloroplastic OS=Arabidopsis thaliana GN=AKRP PE=1 SV=2 357 602 2.0E-10
sp|A7E2S9|A30BL_HUMAN Putative ankyrin repeat domain-containing protein 30B-like OS=Homo sapiens GN=ANKRD30BL PE=2 SV=3 353 493 2.0E-10
sp|P39010|AKR1_YEAST Palmitoyltransferase AKR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AKR1 PE=1 SV=1 477 677 2.0E-10
sp|Q38898|AKT2_ARATH Potassium channel AKT2/3 OS=Arabidopsis thaliana GN=AKT2 PE=1 SV=1 434 607 2.0E-10
sp|Q6TNT2|ANR46_DANRE Ankyrin repeat domain-containing protein 46 OS=Danio rerio GN=ankrd46 PE=2 SV=1 534 652 2.0E-10
sp|Q5UPX1|YL289_MIMIV Putative ankyrin repeat protein L289 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L289 PE=3 SV=1 511 674 2.0E-10
sp|Q9TZC4|ILKH_CAEEL Integrin-linked protein kinase homolog pat-4 OS=Caenorhabditis elegans GN=pat-4 PE=1 SV=1 344 494 2.0E-10
sp|Q6NSI1|AR26L_HUMAN Putative ankyrin repeat domain-containing protein 26-like protein OS=Homo sapiens GN=ANKRD26P1 PE=5 SV=2 566 683 2.0E-10
sp|Q4UKJ3|Y1087_RICFE Putative ankyrin repeat protein RF_1087 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_1087 PE=3 SV=1 531 624 2.0E-10
sp|Q4P6L3|AKR1_USTMA Palmitoyltransferase AKR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=AKR1 PE=3 SV=1 468 681 2.0E-10
sp|A0JNU3|LPP60_MOUSE 60 kDa lysophospholipase OS=Mus musculus GN=Aspg PE=1 SV=1 413 554 2.0E-10
sp|Q9DBR7|MYPT1_MOUSE Protein phosphatase 1 regulatory subunit 12A OS=Mus musculus GN=Ppp1r12a PE=1 SV=2 478 673 2.0E-10
sp|Q3TPE9|ANKY2_MOUSE Ankyrin repeat and MYND domain-containing protein 2 OS=Mus musculus GN=Ankmy2 PE=1 SV=1 496 628 2.0E-10
sp|Q9TXQ1|TNKS1_CAEEL Tankyrase-like protein OS=Caenorhabditis elegans GN=tank-1 PE=2 SV=1 354 623 2.0E-10
sp|Q9TXQ1|TNKS1_CAEEL Tankyrase-like protein OS=Caenorhabditis elegans GN=tank-1 PE=2 SV=1 339 590 2.0E-10
sp|Q9TXQ1|TNKS1_CAEEL Tankyrase-like protein OS=Caenorhabditis elegans GN=tank-1 PE=2 SV=1 406 668 2.0E-10
sp|O73630|NFKB2_XENLA Nuclear factor NF-kappa-B p100 subunit OS=Xenopus laevis GN=nfkb2 PE=2 SV=1 357 634 2.0E-10
sp|Q6C520|AKR1_YARLI Palmitoyltransferase AKR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=AKR1 PE=3 SV=1 431 664 2.0E-10
sp|Q5UPE2|YL063_MIMIV Putative ankyrin repeat protein L63 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L63 PE=3 SV=1 364 626 2.0E-10
sp|Q5UP19|YR864_MIMIV Putative ankyrin repeat protein R864 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L864 PE=3 SV=1 371 597 2.0E-10
sp|Q10728|MYPT1_RAT Protein phosphatase 1 regulatory subunit 12A OS=Rattus norvegicus GN=Ppp1r12a PE=1 SV=2 478 673 2.0E-10
sp|Q1RJN6|Y347_RICBR Putative ankyrin repeat protein RBE_0347 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0347 PE=3 SV=1 536 658 2.0E-10
sp|Q3SX00|ANR46_BOVIN Ankyrin repeat domain-containing protein 46 OS=Bos taurus GN=ANKRD46 PE=2 SV=1 534 652 2.0E-10
sp|Q8BG95|MYPT2_MOUSE Protein phosphatase 1 regulatory subunit 12B OS=Mus musculus GN=Ppp1r12b PE=1 SV=2 365 617 2.0E-10
sp|Q02989|LITA_LATTR Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 440 653 3.0E-10
sp|A6NI47|POTEM_HUMAN Putative POTE ankyrin domain family member M OS=Homo sapiens GN=POTEM PE=3 SV=2 346 554 3.0E-10
sp|Q5R6D7|ASB8_PONAB Ankyrin repeat and SOCS box protein 8 OS=Pongo abelii GN=ASB8 PE=2 SV=1 342 470 3.0E-10
sp|Q9H765|ASB8_HUMAN Ankyrin repeat and SOCS box protein 8 OS=Homo sapiens GN=ASB8 PE=2 SV=1 342 470 3.0E-10
sp|Q4R544|ASB8_MACFA Ankyrin repeat and SOCS box protein 8 OS=Macaca fascicularis GN=ASB8 PE=2 SV=1 341 509 3.0E-10
sp|Q2IBB2|CTTB2_RHIFE Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 463 622 3.0E-10
sp|Q38998|AKT1_ARATH Potassium channel AKT1 OS=Arabidopsis thaliana GN=AKT1 PE=1 SV=2 569 661 3.0E-10
sp|Q7Z6G8|ANS1B_HUMAN Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens GN=ANKS1B PE=1 SV=2 436 683 3.0E-10
sp|Q09YN0|ASZ1_RABIT Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Oryctolagus cuniculus GN=ASZ1 PE=3 SV=1 439 632 3.0E-10
sp|Q09YG9|CTTB2_SAIBB Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 463 620 3.0E-10
sp|Q5TYW2|A20A1_HUMAN Ankyrin repeat domain-containing protein 20A1 OS=Homo sapiens GN=ANKRD20A1 PE=2 SV=1 512 672 3.0E-10
sp|Q2QLB3|CTTB2_CALMO Cortactin-binding protein 2 OS=Callicebus moloch GN=CTTNBP2 PE=3 SV=1 401 554 3.0E-10
sp|Q5VUR7|A20A3_HUMAN Ankyrin repeat domain-containing protein 20A3 OS=Homo sapiens GN=ANKRD20A3 PE=3 SV=1 501 672 3.0E-10
sp|Q108T9|CTTB2_LOXAF Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 362 620 3.0E-10
sp|Q3ZBX7|ANKR1_BOVIN Ankyrin repeat domain-containing protein 1 OS=Bos taurus GN=ANKRD1 PE=2 SV=1 467 635 3.0E-10
sp|Q9M8S6|SKOR_ARATH Potassium channel SKOR OS=Arabidopsis thaliana GN=SKOR PE=1 SV=1 543 690 3.0E-10
sp|Q6AFL2|Y958_LEIXX Putative ankyrin-containing lipoprotein Lxx09580 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=Lxx09580 PE=3 SV=2 485 638 3.0E-10
sp|Q9TU71|ANKR1_RABIT Ankyrin repeat domain-containing protein 1 OS=Oryctolagus cuniculus GN=ANKRD1 PE=2 SV=1 514 672 3.0E-10
sp|Q876A6|AKR1_NAUCC Palmitoyltransferase AKR1 OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=AKR1 PE=3 SV=3 439 648 3.0E-10
sp|A0JNU3|LPP60_MOUSE 60 kDa lysophospholipase OS=Mus musculus GN=Aspg PE=1 SV=1 557 697 3.0E-10
sp|Q8BG95|MYPT2_MOUSE Protein phosphatase 1 regulatory subunit 12B OS=Mus musculus GN=Ppp1r12b PE=1 SV=2 481 674 3.0E-10
sp|Q86W74|ANR46_HUMAN Ankyrin repeat domain-containing protein 46 OS=Homo sapiens GN=ANKRD46 PE=1 SV=1 534 652 3.0E-10
sp|Q5R8C8|ANR46_PONAB Ankyrin repeat domain-containing protein 46 OS=Pongo abelii GN=ANKRD46 PE=2 SV=1 534 652 3.0E-10
sp|Q8WXI3|ASB10_HUMAN Ankyrin repeat and SOCS box protein 10 OS=Homo sapiens GN=ASB10 PE=1 SV=2 465 655 3.0E-10
sp|Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 358 607 4.0E-10
sp|Q91ZT9|ASB8_MOUSE Ankyrin repeat and SOCS box protein 8 OS=Mus musculus GN=Asb8 PE=2 SV=1 342 470 4.0E-10
sp|P14360|V240_FOWPN Putative ankyrin repeat protein FPV240 OS=Fowlpox virus (strain NVSL) GN=FPV240 PE=3 SV=1 353 526 4.0E-10
sp|Q9J504|V231_FOWPN Putative ankyrin repeat protein FPV231 OS=Fowlpox virus (strain NVSL) GN=FPV231 PE=3 SV=1 337 515 4.0E-10
sp|Q1RHT6|Y997_RICBR Putative ankyrin repeat protein RBE_0997 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0997 PE=3 SV=1 430 673 4.0E-10
sp|P0CG39|POTEJ_HUMAN POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 517 683 4.0E-10
sp|A2AS55|ANR16_MOUSE Ankyrin repeat domain-containing protein 16 OS=Mus musculus GN=Ankrd16 PE=2 SV=1 339 595 4.0E-10
sp|Q92625|ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 337 536 4.0E-10
sp|Q2IBB2|CTTB2_RHIFE Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 401 662 4.0E-10
sp|Q8BIZ1|ANS1B_MOUSE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus GN=Anks1b PE=1 SV=3 436 683 4.0E-10
sp|A0M8T5|CTTB2_FELCA Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 362 529 4.0E-10
sp|Q94A76|GORK_ARATH Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 368 551 4.0E-10
sp|Q6GPE5|FEM1B_XENLA Protein fem-1 homolog B OS=Xenopus laevis GN=fem1b PE=2 SV=1 434 649 4.0E-10
sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 362 529 4.0E-10
sp|Q2QLF8|CTTB2_CALJA Cortactin-binding protein 2 OS=Callithrix jacchus GN=CTTNBP2 PE=3 SV=1 401 554 4.0E-10
sp|Q9NU02|ANKE1_HUMAN Ankyrin repeat and EF-hand domain-containing protein 1 OS=Homo sapiens GN=ANKEF1 PE=2 SV=2 515 652 4.0E-10
sp|Q5SQ80|A20A2_HUMAN Ankyrin repeat domain-containing protein 20A2 OS=Homo sapiens GN=ANKRD20A2 PE=3 SV=1 501 672 4.0E-10
sp|Q4KL97|ANKR1_XENLA Ankyrin repeat domain-containing protein 1 OS=Xenopus laevis GN=ankrd1 PE=2 SV=1 532 683 4.0E-10
sp|Q923M0|PP16A_MOUSE Protein phosphatase 1 regulatory subunit 16A OS=Mus musculus GN=Ppp1r16a PE=1 SV=1 513 713 4.0E-10
sp|Q7ZT11|ANKR1_CHICK Ankyrin repeat domain-containing protein 1 OS=Gallus gallus GN=ANKRD1 PE=2 SV=1 372 503 4.0E-10
sp|P97570|PLPL9_RAT 85/88 kDa calcium-independent phospholipase A2 OS=Rattus norvegicus GN=Pla2g6 PE=1 SV=2 352 560 4.0E-10
sp|Q4I8B6|AKR1_GIBZE Palmitoyltransferase AKR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=AKR1 PE=3 SV=1 481 666 4.0E-10
sp|Q9CWU2|ZDH13_MOUSE Palmitoyltransferase ZDHHC13 OS=Mus musculus GN=Zdhhc13 PE=1 SV=2 482 683 4.0E-10
sp|Q9J4Z8|V242_FOWPN Putative ankyrin repeat protein FPV242 OS=Fowlpox virus (strain NVSL) GN=FPV242 PE=3 SV=1 415 659 4.0E-10
sp|Q9Z205|RFXK_MOUSE DNA-binding protein RFXANK OS=Mus musculus GN=Rfxank PE=2 SV=1 559 672 4.0E-10
sp|Q96NS5|ASB16_HUMAN Ankyrin repeat and SOCS box protein 16 OS=Homo sapiens GN=ASB16 PE=1 SV=2 535 674 4.0E-10
sp|Q9Z2G1|FM1AA_MOUSE Protein fem-1 homolog A-A OS=Mus musculus GN=Fem1aa PE=2 SV=1 465 652 4.0E-10
sp|O14974|MYPT1_HUMAN Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens GN=PPP1R12A PE=1 SV=1 478 705 4.0E-10
sp|Q6S5H5|POTEG_HUMAN POTE ankyrin domain family member G OS=Homo sapiens GN=POTEG PE=2 SV=5 339 518 5.0E-10
sp|Q6DCL5|HACE1_XENLA E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 400 630 5.0E-10
sp|Q28BK1|HACE1_XENTR E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 400 630 5.0E-10
sp|P0CG39|POTEJ_HUMAN POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 339 507 5.0E-10
sp|P0CG38|POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 517 683 5.0E-10
sp|P17221|FEM1_CAEEL Sex-determining protein fem-1 OS=Caenorhabditis elegans GN=fem-1 PE=1 SV=1 529 683 5.0E-10
sp|Q07DY6|ASZ1_COLGU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Colobus guereza GN=ASZ1 PE=3 SV=1 439 590 5.0E-10
sp|Q8CGB3|UACA_MOUSE Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Mus musculus GN=Uaca PE=1 SV=2 348 492 5.0E-10
sp|Q923M0|PP16A_MOUSE Protein phosphatase 1 regulatory subunit 16A OS=Mus musculus GN=Ppp1r16a PE=1 SV=1 512 683 5.0E-10
sp|Q5UPX1|YL289_MIMIV Putative ankyrin repeat protein L289 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L289 PE=3 SV=1 370 674 5.0E-10
sp|Q9DBR7|MYPT1_MOUSE Protein phosphatase 1 regulatory subunit 12A OS=Mus musculus GN=Ppp1r12a PE=1 SV=2 339 552 5.0E-10
sp|Q1RJR6|Y317_RICBR Putative ankyrin repeat protein RBE_0317 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0317 PE=3 SV=1 447 653 5.0E-10
sp|Q5R6D7|ASB8_PONAB Ankyrin repeat and SOCS box protein 8 OS=Pongo abelii GN=ASB8 PE=2 SV=1 341 509 6.0E-10
sp|Q3SZE4|ASB11_BOVIN Ankyrin repeat and SOCS box protein 11 OS=Bos taurus GN=ASB11 PE=2 SV=1 343 575 6.0E-10
sp|Q8IYU2|HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 400 630 6.0E-10
sp|P0CG38|POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 339 507 6.0E-10
sp|Q2IBB2|CTTB2_RHIFE Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 349 489 6.0E-10
sp|Q07DX4|CTTB2_NOMLE Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 401 622 6.0E-10
sp|Q812A3|ANR23_MOUSE Ankyrin repeat domain-containing protein 23 OS=Mus musculus GN=Ankrd23 PE=2 SV=1 351 506 6.0E-10
sp|Q9SCX5|AKT5_ARATH Probable potassium channel AKT5 OS=Arabidopsis thaliana GN=AKT5 PE=2 SV=2 339 540 6.0E-10
sp|Q9BXX3|AN30A_HUMAN Ankyrin repeat domain-containing protein 30A OS=Homo sapiens GN=ANKRD30A PE=2 SV=3 350 623 6.0E-10
sp|Q8WXH4|ASB11_HUMAN Ankyrin repeat and SOCS box protein 11 OS=Homo sapiens GN=ASB11 PE=1 SV=1 363 588 6.0E-10
sp|Q4UJC0|Y2042_RICFE Putative ankyrin repeat protein RF_p42/RF_pd42 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_p42 PE=3 SV=1 431 555 6.0E-10
sp|Q86AT8|SPKA_DICDI Stress-activated protein kinase alpha OS=Dictyostelium discoideum GN=spkA-1 PE=1 SV=1 432 613 6.0E-10
sp|Q9H765|ASB8_HUMAN Ankyrin repeat and SOCS box protein 8 OS=Homo sapiens GN=ASB8 PE=2 SV=1 341 509 7.0E-10
sp|P17221|FEM1_CAEEL Sex-determining protein fem-1 OS=Caenorhabditis elegans GN=fem-1 PE=1 SV=1 395 617 7.0E-10
sp|Q91974|IKBA_CHICK NF-kappa-B inhibitor alpha OS=Gallus gallus GN=NFKBIA PE=2 SV=1 500 634 7.0E-10
sp|Q9D2J7|ANKE1_MOUSE Ankyrin repeat and EF-hand domain-containing protein 1 OS=Mus musculus GN=Ankef1 PE=2 SV=1 497 683 7.0E-10
sp|Q10728|MYPT1_RAT Protein phosphatase 1 regulatory subunit 12A OS=Rattus norvegicus GN=Ppp1r12a PE=1 SV=2 339 552 7.0E-10
sp|Q653P0|KOR1_ORYSJ Potassium channel KOR1 OS=Oryza sativa subsp. japonica GN=Os06g0250600 PE=2 SV=1 339 469 8.0E-10
sp|Q641X1|ANR61_RAT Ankyrin repeat domain-containing protein 61 OS=Rattus norvegicus GN=Ankrd61 PE=2 SV=1 468 687 8.0E-10
sp|Q5UR87|YR634_MIMIV Putative ankyrin repeat protein R634 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R634 PE=3 SV=1 527 683 8.0E-10
sp|Q95N27|PP16B_BOVIN Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Bos taurus GN=PPP1R16B PE=1 SV=1 429 635 8.0E-10
sp|Q4UJC0|Y2042_RICFE Putative ankyrin repeat protein RF_p42/RF_pd42 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_p42 PE=3 SV=1 467 588 8.0E-10
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 273 502 9.0E-10
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 455 617 9.0E-10
sp|Q2IBB2|CTTB2_RHIFE Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 379 525 9.0E-10
sp|Q38998|AKT1_ARATH Potassium channel AKT1 OS=Arabidopsis thaliana GN=AKT1 PE=1 SV=2 339 486 9.0E-10
sp|Q2QL82|CTTB2_MICMU Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 463 622 9.0E-10
sp|Q07E17|ASZ1_MUSPF Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mustela putorius furo GN=ASZ1 PE=3 SV=1 439 601 9.0E-10
sp|Q96NS5|ASB16_HUMAN Ankyrin repeat and SOCS box protein 16 OS=Homo sapiens GN=ASB16 PE=1 SV=2 467 674 9.0E-10
sp|Q9WV72|ASB3_MOUSE Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 336 526 1.0E-09
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 399 683 1.0E-09
sp|Q0JKV1|AKT1_ORYSJ Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 569 661 1.0E-09
sp|P0C550|AKT1_ORYSI Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 569 661 1.0E-09
sp|Q08E43|ASB8_BOVIN Ankyrin repeat and SOCS box protein 8 OS=Bos taurus GN=ASB8 PE=2 SV=1 341 509 1.0E-09
sp|Q3U0D9|HACE1_MOUSE E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 400 630 1.0E-09
sp|Q5RFS1|ASB11_PONAB Ankyrin repeat and SOCS box protein 11 OS=Pongo abelii GN=ASB11 PE=2 SV=1 363 584 1.0E-09
sp|Q7Z6G8|ANS1B_HUMAN Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens GN=ANKS1B PE=1 SV=2 522 686 1.0E-09
sp|Q9CQ31|ASB11_MOUSE Ankyrin repeat and SOCS box protein 11 OS=Mus musculus GN=Asb11 PE=2 SV=1 343 575 1.0E-09
sp|A0M8T3|ASZ1_FELCA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Felis catus GN=ASZ1 PE=3 SV=1 439 601 1.0E-09
sp|Q94A76|GORK_ARATH Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 339 484 1.0E-09
sp|Q9D1A4|ASB5_MOUSE Ankyrin repeat and SOCS box protein 5 OS=Mus musculus GN=Asb5 PE=2 SV=1 384 622 1.0E-09
sp|Q2KI79|ANRA2_BOVIN Ankyrin repeat family A protein 2 OS=Bos taurus GN=ANKRA2 PE=2 SV=1 358 487 1.0E-09
sp|Q2QLA2|CTTB2_HORSE Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 401 673 1.0E-09
sp|Q9NU02|ANKE1_HUMAN Ankyrin repeat and EF-hand domain-containing protein 1 OS=Homo sapiens GN=ANKEF1 PE=2 SV=2 497 683 1.0E-09
sp|Q2IBF8|CTTB2_EULMM Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 349 506 1.0E-09
sp|Q7Z8U2|AKR1_ASPOR Palmitoyltransferase akr1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=akr1 PE=3 SV=2 357 557 1.0E-09
sp|Q00420|GABP1_MOUSE GA-binding protein subunit beta-1 OS=Mus musculus GN=Gabpb1 PE=1 SV=2 481 670 1.0E-09
sp|Q2IBE3|ASZ1_PONAB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pongo abelii GN=ASZ1 PE=3 SV=1 439 590 1.0E-09
sp|Q07E15|CTTB2_MUSPF Cortactin-binding protein 2 OS=Mustela putorius furo GN=CTTNBP2 PE=3 SV=1 362 620 1.0E-09
sp|A2RUV0|NOTC1_XENTR Neurogenic locus notch homolog protein 1 OS=Xenopus tropicalis GN=notch1 PE=1 SV=2 424 690 1.0E-09
sp|Q68LP1|MIB2_RAT E3 ubiquitin-protein ligase MIB2 OS=Rattus norvegicus GN=Mib2 PE=1 SV=2 534 693 1.0E-09
sp|Q09YM8|CTTB2_RABIT Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 362 600 1.0E-09
sp|Q8WMX7|ASZ1_PAPAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Papio anubis GN=ASZ1 PE=2 SV=1 439 590 1.0E-09
sp|Q2IBB1|ASZ1_CHLAE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Chlorocebus aethiops GN=ASZ1 PE=3 SV=1 439 590 1.0E-09
sp|A1X157|CTTB2_ECHTE Cortactin-binding protein 2 OS=Echinops telfairi GN=CTTNBP2 PE=3 SV=1 362 532 1.0E-09
sp|Q8VHK1|CSKI2_MOUSE Caskin-2 OS=Mus musculus GN=Caskin2 PE=1 SV=3 353 602 1.0E-09
sp|Q5NVB9|ZDH13_PONAB Palmitoyltransferase ZDHHC13 OS=Pongo abelii GN=ZDHHC13 PE=2 SV=1 482 684 1.0E-09
sp|Q05753|AKRP_ARATH Ankyrin repeat domain-containing protein, chloroplastic OS=Arabidopsis thaliana GN=AKRP PE=1 SV=2 535 677 1.0E-09
sp|Q86U10|LPP60_HUMAN 60 kDa lysophospholipase OS=Homo sapiens GN=ASPG PE=2 SV=3 605 692 1.0E-09
sp|O14593|RFXK_HUMAN DNA-binding protein RFXANK OS=Homo sapiens GN=RFXANK PE=1 SV=2 512 653 1.0E-09
sp|Q1RJN6|Y347_RICBR Putative ankyrin repeat protein RBE_0347 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0347 PE=3 SV=1 515 625 1.0E-09
sp|Q9Z205|RFXK_MOUSE DNA-binding protein RFXANK OS=Mus musculus GN=Rfxank PE=2 SV=1 358 487 1.0E-09
sp|Q9Z205|RFXK_MOUSE DNA-binding protein RFXANK OS=Mus musculus GN=Rfxank PE=2 SV=1 526 653 1.0E-09
sp|Q9Z2G1|FM1AA_MOUSE Protein fem-1 homolog A-A OS=Mus musculus GN=Fem1aa PE=2 SV=1 432 619 1.0E-09
sp|O14974|MYPT1_HUMAN Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens GN=PPP1R12A PE=1 SV=1 339 552 1.0E-09
sp|Q86AT8|SPKA_DICDI Stress-activated protein kinase alpha OS=Dictyostelium discoideum GN=spkA-1 PE=1 SV=1 499 682 1.0E-09
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 273 502 2.0E-09
sp|Q25338|LITD_LATTR Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 348 524 2.0E-09
sp|Q5REW9|ANR27_PONAB Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 455 617 2.0E-09
sp|Q9GKW8|AND1A_MACFA Ankyrin repeat and death domain-containing protein 1A (Fragment) OS=Macaca fascicularis GN=ANKDD1A PE=2 SV=3 338 553 2.0E-09
sp|Q9J5A7|V155_FOWPN Putative ankyrin repeat protein FPV115 OS=Fowlpox virus (strain NVSL) GN=FPV115 PE=3 SV=1 342 516 2.0E-09
sp|Q9J517|V218_FOWPN Putative ankyrin repeat protein FPV218 OS=Fowlpox virus (strain NVSL) GN=FPV218 PE=3 SV=1 351 476 2.0E-09
sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 495 685 2.0E-09
sp|Q9Z2X3|PSD10_RAT 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 339 491 2.0E-09
sp|Q9J5H8|V023_FOWPN Putative ankyrin repeat protein FPV023 OS=Fowlpox virus (strain NVSL) GN=FPV023 PE=3 SV=1 475 708 2.0E-09
sp|Q7Z020|TRPA1_DROME Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=4 358 671 2.0E-09
sp|Q91ZT9|ASB8_MOUSE Ankyrin repeat and SOCS box protein 8 OS=Mus musculus GN=Asb8 PE=2 SV=1 341 509 2.0E-09
sp|D3ZBM7|HACE1_RAT E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 400 630 2.0E-09
sp|B2RU33|POTEC_HUMAN POTE ankyrin domain family member C OS=Homo sapiens GN=POTEC PE=2 SV=2 532 703 2.0E-09
sp|E1C656|HACE1_CHICK E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 400 630 2.0E-09
sp|Q6ZW76|ANKS3_HUMAN Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens GN=ANKS3 PE=1 SV=1 499 650 2.0E-09
sp|Q2IBB4|ASZ1_RHIFE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Rhinolophus ferrumequinum GN=ASZ1 PE=3 SV=1 439 632 2.0E-09
sp|Q8BIZ1|ANS1B_MOUSE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus GN=Anks1b PE=1 SV=3 522 686 2.0E-09
sp|Q9H9E1|ANRA2_HUMAN Ankyrin repeat family A protein 2 OS=Homo sapiens GN=ANKRA2 PE=1 SV=1 358 487 2.0E-09
sp|Q3EC11|ZDHC2_ARATH Probable protein S-acyltransferase 23 OS=Arabidopsis thaliana GN=PAT23 PE=2 SV=2 398 586 2.0E-09
sp|Q2QLF8|CTTB2_CALJA Cortactin-binding protein 2 OS=Callithrix jacchus GN=CTTNBP2 PE=3 SV=1 463 620 2.0E-09
sp|Q09YI1|CTTB2_SHEEP Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 349 489 2.0E-09
sp|Q2QL82|CTTB2_MICMU Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 362 600 2.0E-09
sp|Q8VHS5|ASB16_MOUSE Ankyrin repeat and SOCS box protein 16 OS=Mus musculus GN=Asb16 PE=2 SV=1 363 569 2.0E-09
sp|Q2IBF8|CTTB2_EULMM Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 401 666 2.0E-09
sp|Q812A3|ANR23_MOUSE Ankyrin repeat domain-containing protein 23 OS=Mus musculus GN=Ankrd23 PE=2 SV=1 477 635 2.0E-09
sp|P77736|YAHD_ECOLI Putative ankyrin repeat protein YahD OS=Escherichia coli (strain K12) GN=yahD PE=3 SV=1 366 556 2.0E-09
sp|P77736|YAHD_ECOLI Putative ankyrin repeat protein YahD OS=Escherichia coli (strain K12) GN=yahD PE=3 SV=1 512 683 2.0E-09
sp|Q1RMI3|GABP1_BOVIN GA-binding protein subunit beta-1 OS=Bos taurus GN=GABPB1 PE=2 SV=1 481 670 2.0E-09
sp|Q06547|GABP1_HUMAN GA-binding protein subunit beta-1 OS=Homo sapiens GN=GABPB1 PE=1 SV=2 481 627 2.0E-09
sp|Q96T49|PP16B_HUMAN Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Homo sapiens GN=PPP1R16B PE=1 SV=1 429 635 2.0E-09
sp|Q108U1|ASZ1_LOXAF Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Loxodonta africana GN=ASZ1 PE=3 SV=1 439 632 2.0E-09
sp|P97819|PLPL9_MOUSE 85/88 kDa calcium-independent phospholipase A2 OS=Mus musculus GN=Pla2g6 PE=1 SV=3 352 560 2.0E-09
sp|Q9GL21|UACA_CANLF Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Canis lupus familiaris GN=UACA PE=2 SV=2 511 686 2.0E-09
sp|Q8WXE0|CSKI2_HUMAN Caskin-2 OS=Homo sapiens GN=CASKIN2 PE=1 SV=2 353 602 2.0E-09
sp|Q4I8B6|AKR1_GIBZE Palmitoyltransferase AKR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=AKR1 PE=3 SV=1 514 684 2.0E-09
sp|Q9CR42|ANKR1_MOUSE Ankyrin repeat domain-containing protein 1 OS=Mus musculus GN=Ankrd1 PE=1 SV=1 313 476 2.0E-09
sp|Q8IUH4|ZDH13_HUMAN Palmitoyltransferase ZDHHC13 OS=Homo sapiens GN=ZDHHC13 PE=1 SV=3 482 684 2.0E-09
sp|Q2QLB5|ASZ1_CALMO Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Callicebus moloch GN=ASZ1 PE=3 SV=1 439 590 2.0E-09
sp|Q8VHQ3|PP16B_MOUSE Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Mus musculus GN=Ppp1r16b PE=1 SV=1 429 635 2.0E-09
sp|Q8IVF6|AN18A_HUMAN Ankyrin repeat domain-containing protein 18A OS=Homo sapiens GN=ANKRD18A PE=2 SV=3 513 683 2.0E-09
sp|Q9TU71|ANKR1_RABIT Ankyrin repeat domain-containing protein 1 OS=Oryctolagus cuniculus GN=ANKRD1 PE=2 SV=1 313 492 2.0E-09
sp|Q86U10|LPP60_HUMAN 60 kDa lysophospholipase OS=Homo sapiens GN=ASPG PE=2 SV=3 512 650 2.0E-09
sp|Q9J4Z8|V242_FOWPN Putative ankyrin repeat protein FPV242 OS=Fowlpox virus (strain NVSL) GN=FPV242 PE=3 SV=1 377 676 2.0E-09
sp|Q86AT8|SPKA_DICDI Stress-activated protein kinase alpha OS=Dictyostelium discoideum GN=spkA-1 PE=1 SV=1 423 597 2.0E-09
sp|Q04721|NOTC2_HUMAN Neurogenic locus notch homolog protein 2 OS=Homo sapiens GN=NOTCH2 PE=1 SV=3 338 554 3.0E-09
sp|Q9QW30|NOTC2_RAT Neurogenic locus notch homolog protein 2 OS=Rattus norvegicus GN=Notch2 PE=1 SV=1 338 554 3.0E-09
sp|Q9J5I3|V018_FOWPN Putative ankyrin repeat protein FPV018 OS=Fowlpox virus (strain NVSL) GN=FPV018 PE=3 SV=1 401 567 3.0E-09
sp|H3BUK9|POTB2_HUMAN POTE ankyrin domain family member B2 OS=Homo sapiens GN=POTEB2 PE=3 SV=1 532 703 3.0E-09
sp|Q6S5H4|POTEB_HUMAN POTE ankyrin domain family member B OS=Homo sapiens GN=POTEB PE=2 SV=1 532 703 3.0E-09
sp|A0JP26|POTB3_HUMAN POTE ankyrin domain family member B3 OS=Homo sapiens GN=POTEB3 PE=2 SV=2 532 703 3.0E-09
sp|Q8H569|AKT3_ORYSJ Potassium channel AKT3 OS=Oryza sativa subsp. japonica GN=Os07g0175400 PE=3 SV=1 569 661 3.0E-09
sp|Q8N2N9|AN36B_HUMAN Ankyrin repeat domain-containing protein 36B OS=Homo sapiens GN=ANKRD36B PE=1 SV=4 533 717 3.0E-09
sp|Q9Y6X6|MYO16_HUMAN Unconventional myosin-XVI OS=Homo sapiens GN=MYO16 PE=2 SV=3 348 586 3.0E-09
sp|Q00PJ3|ASZ1_ATEAB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Atelerix albiventris GN=ASZ1 PE=3 SV=1 439 632 3.0E-09
sp|Q07E30|ASZ1_NEONE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Neofelis nebulosa GN=ASZ1 PE=3 SV=1 439 601 3.0E-09
sp|Q00420|GABP1_MOUSE GA-binding protein subunit beta-1 OS=Mus musculus GN=Gabpb1 PE=1 SV=2 339 484 3.0E-09
sp|Q09YJ3|CTTB2_MUNMU Cortactin-binding protein 2 OS=Muntiacus muntjak GN=CTTNBP2 PE=3 SV=1 463 622 3.0E-09
sp|Q108T9|CTTB2_LOXAF Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 463 622 3.0E-09
sp|Q1RMI3|GABP1_BOVIN GA-binding protein subunit beta-1 OS=Bos taurus GN=GABPB1 PE=2 SV=1 339 484 3.0E-09
sp|Q06547|GABP1_HUMAN GA-binding protein subunit beta-1 OS=Homo sapiens GN=GABPB1 PE=1 SV=2 339 484 3.0E-09
sp|Q2QLA4|ASZ1_HORSE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Equus caballus GN=ASZ1 PE=3 SV=1 439 601 3.0E-09
sp|Q8WWH4|ASZ1_HUMAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Homo sapiens GN=ASZ1 PE=2 SV=1 439 590 3.0E-09
sp|Q8WMX6|ASZ1_PANTR Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pan troglodytes GN=ASZ1 PE=2 SV=1 439 590 3.0E-09
sp|Q2QLH1|ASZ1_OTOGA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Otolemur garnettii GN=ASZ1 PE=3 SV=1 439 590 3.0E-09
sp|Q2IBF5|ASZ1_GORGO Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Gorilla gorilla gorilla GN=ASZ1 PE=3 SV=1 439 632 3.0E-09
sp|Q8R560|ANKR1_RAT Ankyrin repeat domain-containing protein 1 OS=Rattus norvegicus GN=Ankrd1 PE=1 SV=1 472 635 3.0E-09
sp|O60733|PLPL9_HUMAN 85/88 kDa calcium-independent phospholipase A2 OS=Homo sapiens GN=PLA2G6 PE=1 SV=2 352 560 3.0E-09
sp|Q9D2J7|ANKE1_MOUSE Ankyrin repeat and EF-hand domain-containing protein 1 OS=Mus musculus GN=Ankef1 PE=2 SV=1 342 601 3.0E-09
sp|Q9D2J7|ANKE1_MOUSE Ankyrin repeat and EF-hand domain-containing protein 1 OS=Mus musculus GN=Ankef1 PE=2 SV=1 414 523 3.0E-09
sp|Q6TNT2|ANR46_DANRE Ankyrin repeat domain-containing protein 46 OS=Danio rerio GN=ankrd46 PE=2 SV=1 567 689 3.0E-09
sp|Q86AT8|SPKA_DICDI Stress-activated protein kinase alpha OS=Dictyostelium discoideum GN=spkA-1 PE=1 SV=1 352 507 3.0E-09
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 490 675 4.0E-09
sp|Q5JPF3|AN36C_HUMAN Ankyrin repeat domain-containing protein 36C OS=Homo sapiens GN=ANKRD36C PE=2 SV=3 325 494 4.0E-09
sp|Q8VD46|ASZ1_MOUSE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mus musculus GN=Asz1 PE=1 SV=2 439 601 4.0E-09
sp|A6QL64|AN36A_HUMAN Ankyrin repeat domain-containing protein 36A OS=Homo sapiens GN=ANKRD36 PE=2 SV=3 533 717 4.0E-09
sp|Q9HYV6|Y3287_PSEAE Putative ankyrin repeat protein PA3287 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA3287 PE=3 SV=1 569 672 4.0E-09
sp|Q2IBF7|CTTB2_GORGO Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 463 620 4.0E-09
sp|Q7S3M5|AKR1_NEUCR Palmitoyltransferase akr1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-1 PE=3 SV=2 353 545 4.0E-09
sp|Q07DZ7|ASZ1_ORNAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ornithorhynchus anatinus GN=ASZ1 PE=3 SV=1 348 502 4.0E-09
sp|Q07DW4|CTTB2_MUNRE Cortactin-binding protein 2 OS=Muntiacus reevesi GN=CTTNBP2 PE=3 SV=1 463 622 4.0E-09
sp|P14368|V234_FOWPN Putative ankyrin repeat protein FPV234 OS=Fowlpox virus (strain NVSL) GN=FPV234 PE=3 SV=2 342 576 4.0E-09
sp|Q09YM8|CTTB2_RABIT Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 439 666 4.0E-09
sp|Q9M8S6|SKOR_ARATH Potassium channel SKOR OS=Arabidopsis thaliana GN=SKOR PE=1 SV=1 339 484 4.0E-09
sp|Q96T49|PP16B_HUMAN Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Homo sapiens GN=PPP1R16B PE=1 SV=1 513 683 4.0E-09
sp|Q96T49|PP16B_HUMAN Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Homo sapiens GN=PPP1R16B PE=1 SV=1 337 552 4.0E-09
sp|Q6P9K8|CSKI1_MOUSE Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 524 686 4.0E-09
sp|Q865U8|ANKR1_PIG Ankyrin repeat domain-containing protein 1 OS=Sus scrofa GN=ANKRD1 PE=2 SV=1 472 635 4.0E-09
sp|Q8HYY4|UACA_BOVIN Uveal autoantigen with coiled-coil domains and ankyrin repeats protein OS=Bos taurus GN=UACA PE=1 SV=1 497 686 4.0E-09
sp|Q8R560|ANKR1_RAT Ankyrin repeat domain-containing protein 1 OS=Rattus norvegicus GN=Ankrd1 PE=1 SV=1 313 476 4.0E-09
sp|O70445|BARD1_MOUSE BRCA1-associated RING domain protein 1 OS=Mus musculus GN=Bard1 PE=2 SV=1 519 635 4.0E-09
sp|Q90623|MYPT1_CHICK Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus GN=PPP1R12A PE=1 SV=1 341 553 4.0E-09
sp|Q9DBR7|MYPT1_MOUSE Protein phosphatase 1 regulatory subunit 12A OS=Mus musculus GN=Ppp1r12a PE=1 SV=2 511 683 4.0E-09
sp|Q5DW34|EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 342 506 5.0E-09
sp|O35516|NOTC2_MOUSE Neurogenic locus notch homolog protein 2 OS=Mus musculus GN=Notch2 PE=1 SV=1 338 554 5.0E-09
sp|Q8C6Y6|ASB14_MOUSE Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 531 683 5.0E-09
sp|Q68DC2|ANKS6_HUMAN Ankyrin repeat and SAM domain-containing protein 6 OS=Homo sapiens GN=ANKS6 PE=1 SV=2 499 673 5.0E-09
sp|Q9ET47|ESPN_MOUSE Espin OS=Mus musculus GN=Espn PE=1 SV=2 351 584 5.0E-09
sp|Q63618|ESPN_RAT Espin OS=Rattus norvegicus GN=Espn PE=1 SV=2 351 584 5.0E-09
sp|Q99PE2|ANRA2_MOUSE Ankyrin repeat family A protein 2 OS=Mus musculus GN=Ankra2 PE=1 SV=1 358 487 5.0E-09
sp|Q804S5|MIB1_DANRE E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 524 671 5.0E-09
sp|Q6GPE5|FEM1B_XENLA Protein fem-1 homolog B OS=Xenopus laevis GN=fem1b PE=2 SV=1 363 594 5.0E-09
sp|Q07DV1|CTTB2_AOTNA Cortactin-binding protein 2 OS=Aotus nancymaae GN=CTTNBP2 PE=3 SV=1 463 620 5.0E-09
sp|Q8WZ74|CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 463 620 5.0E-09
sp|Q7S3M5|AKR1_NEUCR Palmitoyltransferase akr1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-1 PE=3 SV=2 530 671 5.0E-09
sp|Q2QLA2|CTTB2_HORSE Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 362 620 5.0E-09
sp|Q2IBE6|CTTB2_PONAB Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 463 620 5.0E-09
sp|Q8CGB3|UACA_MOUSE Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Mus musculus GN=Uaca PE=1 SV=2 358 524 5.0E-09
sp|Q86SG2|ANR23_HUMAN Ankyrin repeat domain-containing protein 23 OS=Homo sapiens GN=ANKRD23 PE=1 SV=1 513 653 5.0E-09
sp|Q108U1|ASZ1_LOXAF Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Loxodonta africana GN=ASZ1 PE=3 SV=1 348 518 5.0E-09
sp|Q8VHK2|CSKI1_RAT Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 524 686 5.0E-09
sp|Q69ZU8|ANKR6_MOUSE Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 336 520 5.0E-09
sp|O60237|MYPT2_HUMAN Protein phosphatase 1 regulatory subunit 12B OS=Homo sapiens GN=PPP1R12B PE=1 SV=2 398 650 5.0E-09
sp|Q9BZF9|UACA_HUMAN Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens GN=UACA PE=1 SV=2 511 686 5.0E-09
sp|Q10728|MYPT1_RAT Protein phosphatase 1 regulatory subunit 12A OS=Rattus norvegicus GN=Ppp1r12a PE=1 SV=2 511 683 5.0E-09
sp|O14974|MYPT1_HUMAN Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens GN=PPP1R12A PE=1 SV=1 511 683 5.0E-09
sp|Q3UMR0|ANR27_MOUSE Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 399 683 6.0E-09
sp|Q5DW34|EHMT1_MOUSE Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 339 536 6.0E-09
sp|Q7Z020|TRPA1_DROME Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=4 336 551 6.0E-09
sp|A6NK59|ASB14_HUMAN Ankyrin repeat and SOCS box protein 14 OS=Homo sapiens GN=ASB14 PE=2 SV=2 563 685 6.0E-09
sp|Q9CZK6|ANKS3_MOUSE Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 339 487 6.0E-09
sp|Q8GXE6|AKT6_ARATH Potassium channel AKT6 OS=Arabidopsis thaliana GN=AKT6 PE=1 SV=2 344 487 6.0E-09
sp|Q9CQM6|ANR61_MOUSE Ankyrin repeat domain-containing protein 61 OS=Mus musculus GN=Ankrd61 PE=2 SV=1 468 687 6.0E-09
sp|Q07DX4|CTTB2_NOMLE Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 463 620 6.0E-09
sp|Q07E41|CTTB2_DASNO Cortactin-binding protein 2 OS=Dasypus novemcinctus GN=CTTNBP2 PE=3 SV=1 349 489 6.0E-09
sp|Q2QLB3|CTTB2_CALMO Cortactin-binding protein 2 OS=Callicebus moloch GN=CTTNBP2 PE=3 SV=1 463 620 6.0E-09
sp|Q8CGB3|UACA_MOUSE Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Mus musculus GN=Uaca PE=1 SV=2 511 686 6.0E-09
sp|Q07DX6|ASZ1_NOMLE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Nomascus leucogenys GN=ASZ1 PE=3 SV=1 439 590 6.0E-09
sp|A1X157|CTTB2_ECHTE Cortactin-binding protein 2 OS=Echinops telfairi GN=CTTNBP2 PE=3 SV=1 463 622 6.0E-09
sp|Q29RM5|FEM1A_BOVIN Protein fem-1 homolog A OS=Bos taurus GN=FEM1A PE=2 SV=1 535 736 6.0E-09
sp|Q8WXK4|ASB12_HUMAN Ankyrin repeat and SOCS box protein 12 OS=Homo sapiens GN=ASB12 PE=1 SV=2 567 660 6.0E-09
sp|Q8WXK4|ASB12_HUMAN Ankyrin repeat and SOCS box protein 12 OS=Homo sapiens GN=ASB12 PE=1 SV=2 387 557 6.0E-09
sp|Q05753|AKRP_ARATH Ankyrin repeat domain-containing protein, chloroplastic OS=Arabidopsis thaliana GN=AKRP PE=1 SV=2 415 554 6.0E-09
sp|Q86U10|LPP60_HUMAN 60 kDa lysophospholipase OS=Homo sapiens GN=ASPG PE=2 SV=3 539 697 6.0E-09
sp|Q99728|BARD1_HUMAN BRCA1-associated RING domain protein 1 OS=Homo sapiens GN=BARD1 PE=1 SV=2 528 651 6.0E-09
sp|Q1RJR6|Y317_RICBR Putative ankyrin repeat protein RBE_0317 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0317 PE=3 SV=1 336 521 6.0E-09
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 327 523 7.0E-09
sp|P07207|NOTCH_DROME Neurogenic locus Notch protein OS=Drosophila melanogaster GN=N PE=1 SV=3 349 487 7.0E-09
sp|Q5TYW2|A20A1_HUMAN Ankyrin repeat domain-containing protein 20A1 OS=Homo sapiens GN=ANKRD20A1 PE=2 SV=1 555 683 7.0E-09
sp|Q3ZBX7|ANKR1_BOVIN Ankyrin repeat domain-containing protein 1 OS=Bos taurus GN=ANKRD1 PE=2 SV=1 553 683 7.0E-09
sp|Q09YI3|ASZ1_SHEEP Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ovis aries GN=ASZ1 PE=3 SV=1 431 601 7.0E-09
sp|Q09YM8|CTTB2_RABIT Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 463 622 7.0E-09
sp|Q8WXD9|CSKI1_HUMAN Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 524 686 7.0E-09
sp|Q15327|ANKR1_HUMAN Ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=ANKRD1 PE=1 SV=2 467 635 7.0E-09
sp|Q91ZT8|ASB9_MOUSE Ankyrin repeat and SOCS box protein 9 OS=Mus musculus GN=Asb9 PE=1 SV=2 336 585 7.0E-09
sp|Q9TU71|ANKR1_RABIT Ankyrin repeat domain-containing protein 1 OS=Oryctolagus cuniculus GN=ANKRD1 PE=2 SV=1 472 635 7.0E-09
sp|Q6DRG7|MYPT1_DANRE Protein phosphatase 1 regulatory subunit 12A OS=Danio rerio GN=ppp1r12a PE=2 SV=2 341 560 7.0E-09
sp|Q6C520|AKR1_YARLI Palmitoyltransferase AKR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=AKR1 PE=3 SV=1 456 673 7.0E-09
sp|Q3SX00|ANR46_BOVIN Ankyrin repeat domain-containing protein 46 OS=Bos taurus GN=ANKRD46 PE=2 SV=1 567 689 7.0E-09
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 528 673 8.0E-09
sp|A6NI47|POTEM_HUMAN Putative POTE ankyrin domain family member M OS=Homo sapiens GN=POTEM PE=3 SV=2 532 703 8.0E-09
sp|P59672|ANS1A_MOUSE Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus GN=Anks1a PE=1 SV=3 522 683 8.0E-09
sp|Q86YR6|POTED_HUMAN POTE ankyrin domain family member D OS=Homo sapiens GN=POTED PE=2 SV=2 532 683 8.0E-09
sp|Q96DX5|ASB9_HUMAN Ankyrin repeat and SOCS box protein 9 OS=Homo sapiens GN=ASB9 PE=1 SV=1 363 587 8.0E-09
sp|Q2QLA2|CTTB2_HORSE Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 463 622 8.0E-09
sp|Q9NU02|ANKE1_HUMAN Ankyrin repeat and EF-hand domain-containing protein 1 OS=Homo sapiens GN=ANKEF1 PE=2 SV=2 414 523 8.0E-09
sp|Q09YJ3|CTTB2_MUNMU Cortactin-binding protein 2 OS=Muntiacus muntjak GN=CTTNBP2 PE=3 SV=1 362 525 8.0E-09
sp|Q2IBG0|ASZ1_EULMM Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Eulemur macaco macaco GN=ASZ1 PE=3 SV=1 439 590 8.0E-09
sp|Q8IVF6|AN18A_HUMAN Ankyrin repeat domain-containing protein 18A OS=Homo sapiens GN=ANKRD18A PE=2 SV=3 512 672 8.0E-09
sp|Q8T2Q0|ZDHC6_DICDI Putative ZDHHC-type palmitoyltransferase 6 OS=Dictyostelium discoideum GN=DDB_G0275149 PE=2 SV=1 381 568 9.0E-09
sp|Q09YN0|ASZ1_RABIT Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Oryctolagus cuniculus GN=ASZ1 PE=3 SV=1 344 518 9.0E-09
sp|Q9VFD5|FEM1A_DROME Protein fem-1 homolog CG6966 OS=Drosophila melanogaster GN=CG6966 PE=2 SV=2 565 683 9.0E-09
sp|Q5VUR7|A20A3_HUMAN Ankyrin repeat domain-containing protein 20A3 OS=Homo sapiens GN=ANKRD20A3 PE=3 SV=1 555 683 9.0E-09
sp|Q2QL84|ASZ1_MICMU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Microcebus murinus GN=ASZ1 PE=3 SV=1 439 590 9.0E-09
sp|Q9Y2G4|ANKR6_HUMAN Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 336 520 9.0E-09
sp|P0CS66|AKR1_CRYNJ Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=AKR1 PE=3 SV=1 353 568 9.0E-09
sp|P0CS67|AKR1_CRYNB Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=AKR1 PE=3 SV=1 353 568 9.0E-09
sp|Q38898|AKT2_ARATH Potassium channel AKT2/3 OS=Arabidopsis thaliana GN=AKT2 PE=1 SV=1 382 569 9.0E-09
sp|Q5R8C8|ANR46_PONAB Ankyrin repeat domain-containing protein 46 OS=Pongo abelii GN=ANKRD46 PE=2 SV=1 567 689 9.0E-09
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 534 673 1.0E-08
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 478 683 1.0E-08
sp|Q3UMR0|ANR27_MOUSE Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 351 491 1.0E-08
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 528 699 1.0E-08
sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 327 523 1.0E-08
sp|Q4R3S3|ANKR7_MACFA Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 272 465 1.0E-08
sp|Q7Z020|TRPA1_DROME Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=4 425 683 1.0E-08
sp|Q8H569|AKT3_ORYSJ Potassium channel AKT3 OS=Oryza sativa subsp. japonica GN=Os07g0175400 PE=3 SV=1 339 471 1.0E-08
sp|Q6DCL5|HACE1_XENLA E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 339 521 1.0E-08
sp|Q28BK1|HACE1_XENTR E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 339 521 1.0E-08
sp|Q92625|ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 555 690 1.0E-08
sp|Q80SY4|MIB1_MOUSE E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 490 683 1.0E-08
sp|Q86YT6|MIB1_HUMAN E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 490 683 1.0E-08
sp|A0M8T5|CTTB2_FELCA Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 401 662 1.0E-08
sp|Q3UYR4|ESPNL_MOUSE Espin-like protein OS=Mus musculus GN=Espnl PE=2 SV=1 372 652 1.0E-08
sp|Q2T9W8|ANR61_BOVIN Ankyrin repeat domain-containing protein 61 OS=Bos taurus GN=ANKRD61 PE=2 SV=1 468 684 1.0E-08
sp|Q2QLF8|CTTB2_CALJA Cortactin-binding protein 2 OS=Callithrix jacchus GN=CTTNBP2 PE=3 SV=1 349 487 1.0E-08
sp|A6NC57|ANR62_HUMAN Ankyrin repeat domain-containing protein 62 OS=Homo sapiens GN=ANKRD62 PE=2 SV=4 350 528 1.0E-08
sp|Q09YG9|CTTB2_SAIBB Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 349 487 1.0E-08
sp|Q2QLA2|CTTB2_HORSE Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 349 496 1.0E-08
sp|Q2QL82|CTTB2_MICMU Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 349 504 1.0E-08
sp|Q8VHS5|ASB16_MOUSE Ankyrin repeat and SOCS box protein 16 OS=Mus musculus GN=Asb16 PE=2 SV=1 534 698 1.0E-08
sp|Q6S8J7|POTEA_HUMAN POTE ankyrin domain family member A OS=Homo sapiens GN=POTEA PE=2 SV=1 339 507 1.0E-08
sp|Q812A3|ANR23_MOUSE Ankyrin repeat domain-containing protein 23 OS=Mus musculus GN=Ankrd23 PE=2 SV=1 432 605 1.0E-08
sp|Q5SQ80|A20A2_HUMAN Ankyrin repeat domain-containing protein 20A2 OS=Homo sapiens GN=ANKRD20A2 PE=3 SV=1 555 683 1.0E-08
sp|Q8WMX8|ASZ1_BOVIN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Bos taurus GN=ASZ1 PE=2 SV=1 431 601 1.0E-08
sp|Q07E15|CTTB2_MUSPF Cortactin-binding protein 2 OS=Mustela putorius furo GN=CTTNBP2 PE=3 SV=1 349 489 1.0E-08
sp|Q07E15|CTTB2_MUSPF Cortactin-binding protein 2 OS=Mustela putorius furo GN=CTTNBP2 PE=3 SV=1 463 622 1.0E-08
sp|Q09YJ5|ASZ1_MUNMU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Muntiacus muntjak GN=ASZ1 PE=3 SV=1 431 601 1.0E-08
sp|Q2IBA2|CTTB2_CHLAE Cortactin-binding protein 2 OS=Chlorocebus aethiops GN=CTTNBP2 PE=3 SV=1 362 600 1.0E-08
sp|A0M8S4|CTTB2_PAPAN Cortactin-binding protein 2 OS=Papio anubis GN=CTTNBP2 PE=3 SV=1 362 620 1.0E-08
sp|Q07DY4|CTTB2_COLGU Cortactin-binding protein 2 OS=Colobus guereza GN=CTTNBP2 PE=3 SV=1 362 600 1.0E-08
sp|Q07E43|ASZ1_DASNO Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Dasypus novemcinctus GN=ASZ1 PE=3 SV=1 348 518 1.0E-08
sp|Q95N27|PP16B_BOVIN Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Bos taurus GN=PPP1R16B PE=1 SV=1 337 552 1.0E-08
sp|Q54BA2|Y3800_DICDI Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 484 635 1.0E-08
sp|Q865U8|ANKR1_PIG Ankyrin repeat domain-containing protein 1 OS=Sus scrofa GN=ANKRD1 PE=2 SV=1 313 476 1.0E-08
sp|Q54KH3|ANR39_DICDI Ankyrin repeat domain-containing protein 39 homolog OS=Dictyostelium discoideum GN=ankrd39 PE=3 SV=2 429 536 1.0E-08
sp|Q54KH3|ANR39_DICDI Ankyrin repeat domain-containing protein 39 homolog OS=Dictyostelium discoideum GN=ankrd39 PE=3 SV=2 516 635 1.0E-08
sp|Q9CR42|ANKR1_MOUSE Ankyrin repeat domain-containing protein 1 OS=Mus musculus GN=Ankrd1 PE=1 SV=1 469 635 1.0E-08
sp|Q9D738|ASB12_MOUSE Ankyrin repeat and SOCS box protein 12 OS=Mus musculus GN=Asb12 PE=2 SV=1 387 557 1.0E-08
sp|Q4R690|ZDH13_MACFA Palmitoyltransferase ZDHHC13 OS=Macaca fascicularis GN=ZDHHC13 PE=2 SV=1 482 684 1.0E-08
sp|Q9BZF9|UACA_HUMAN Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens GN=UACA PE=1 SV=2 445 624 1.0E-08
sp|Q9SQK3|EM506_ARATH Ankyrin repeat domain-containing protein EMB506, chloroplastic OS=Arabidopsis thaliana GN=EMB506 PE=1 SV=1 568 683 1.0E-08
sp|Q86W74|ANR46_HUMAN Ankyrin repeat domain-containing protein 46 OS=Homo sapiens GN=ANKRD46 PE=1 SV=1 567 689 1.0E-08
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 427 652 2.0E-08
sp|O75832|PSD10_HUMAN 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 339 491 2.0E-08
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 334 523 2.0E-08
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 334 523 2.0E-08
sp|Q1RI12|Y921_RICBR Putative ankyrin repeat protein RBE_0921 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0921 PE=3 SV=1 324 506 2.0E-08
sp|Q1RI12|Y921_RICBR Putative ankyrin repeat protein RBE_0921 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0921 PE=3 SV=1 413 655 2.0E-08
sp|P0C0T2|ANKS6_RAT Ankyrin repeat and SAM domain-containing protein 6 OS=Rattus norvegicus GN=Anks6 PE=1 SV=2 536 686 2.0E-08
sp|Q6P6B7|ANR16_HUMAN Ankyrin repeat domain-containing protein 16 OS=Homo sapiens GN=ANKRD16 PE=1 SV=1 339 570 2.0E-08
sp|Q91ZU0|ASB7_MOUSE Ankyrin repeat and SOCS box protein 7 OS=Mus musculus GN=Asb7 PE=2 SV=2 481 683 2.0E-08
sp|Q9H672|ASB7_HUMAN Ankyrin repeat and SOCS box protein 7 OS=Homo sapiens GN=ASB7 PE=1 SV=2 484 683 2.0E-08
sp|Q6S545|POTEH_HUMAN POTE ankyrin domain family member H OS=Homo sapiens GN=POTEH PE=2 SV=3 532 703 2.0E-08
sp|Q5M9H0|ANKS3_RAT Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 324 487 2.0E-08
sp|F1N6G5|HACE1_BOVIN E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 348 521 2.0E-08
sp|Q6S5H5|POTEG_HUMAN POTE ankyrin domain family member G OS=Homo sapiens GN=POTEG PE=2 SV=5 532 703 2.0E-08
sp|Q8VD46|ASZ1_MOUSE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mus musculus GN=Asz1 PE=1 SV=2 344 518 2.0E-08
sp|Q6ZW76|ANKS3_HUMAN Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens GN=ANKS3 PE=1 SV=1 324 465 2.0E-08
sp|Q8N2N9|AN36B_HUMAN Ankyrin repeat domain-containing protein 36B OS=Homo sapiens GN=ANKRD36B PE=1 SV=4 339 494 2.0E-08
sp|Q09YK4|CTTB2_ATEGE Cortactin-binding protein 2 OS=Ateles geoffroyi GN=CTTNBP2 PE=3 SV=1 463 620 2.0E-08
sp|Q80SY4|MIB1_MOUSE E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 501 686 2.0E-08
sp|Q80SY4|MIB1_MOUSE E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 517 671 2.0E-08
sp|A4D7T3|ASZ1_MACEU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Macropus eugenii GN=ASZ1 PE=3 SV=1 439 590 2.0E-08
sp|Q86YT6|MIB1_HUMAN E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 501 686 2.0E-08
sp|Q86YT6|MIB1_HUMAN E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 517 671 2.0E-08
sp|Q8T2Q0|ZDHC6_DICDI Putative ZDHHC-type palmitoyltransferase 6 OS=Dictyostelium discoideum GN=DDB_G0275149 PE=2 SV=1 344 471 2.0E-08
sp|Q4X251|AKR1_ASPFU Palmitoyltransferase akr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=akr1 PE=3 SV=2 357 643 2.0E-08
sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 401 662 2.0E-08
sp|Q07DV1|CTTB2_AOTNA Cortactin-binding protein 2 OS=Aotus nancymaae GN=CTTNBP2 PE=3 SV=1 362 521 2.0E-08
sp|Q07DV1|CTTB2_AOTNA Cortactin-binding protein 2 OS=Aotus nancymaae GN=CTTNBP2 PE=3 SV=1 349 487 2.0E-08
sp|Q09YI1|CTTB2_SHEEP Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 339 456 2.0E-08
sp|B9EJA2|CTTB2_MOUSE Cortactin-binding protein 2 OS=Mus musculus GN=Cttnbp2 PE=1 SV=2 349 487 2.0E-08
sp|B9EJA2|CTTB2_MOUSE Cortactin-binding protein 2 OS=Mus musculus GN=Cttnbp2 PE=1 SV=2 463 620 2.0E-08
sp|Q2IBF7|CTTB2_GORGO Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 349 487 2.0E-08
sp|Q8WZ74|CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 349 487 2.0E-08
sp|Q5TYW2|A20A1_HUMAN Ankyrin repeat domain-containing protein 20A1 OS=Homo sapiens GN=ANKRD20A1 PE=2 SV=1 513 683 2.0E-08
sp|Q07DZ5|CTTB2_ORNAN Cortactin-binding protein 2 OS=Ornithorhynchus anatinus GN=CTTNBP2 PE=3 SV=1 483 622 2.0E-08
sp|Q2QLB3|CTTB2_CALMO Cortactin-binding protein 2 OS=Callicebus moloch GN=CTTNBP2 PE=3 SV=1 349 487 2.0E-08
sp|Q09YJ3|CTTB2_MUNMU Cortactin-binding protein 2 OS=Muntiacus muntjak GN=CTTNBP2 PE=3 SV=1 349 489 2.0E-08
sp|Q108T9|CTTB2_LOXAF Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 349 489 2.0E-08
sp|Q4UJ75|A20A4_HUMAN Ankyrin repeat domain-containing protein 20A4 OS=Homo sapiens GN=ANKRD20A4 PE=3 SV=1 555 683 2.0E-08
sp|Q6GNY1|MIB1_XENLA E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis GN=mib1 PE=2 SV=1 501 686 2.0E-08
sp|Q07DW4|CTTB2_MUNRE Cortactin-binding protein 2 OS=Muntiacus reevesi GN=CTTNBP2 PE=3 SV=1 362 525 2.0E-08
sp|P14368|V234_FOWPN Putative ankyrin repeat protein FPV234 OS=Fowlpox virus (strain NVSL) GN=FPV234 PE=3 SV=2 528 673 2.0E-08
sp|Q9SCX5|AKT5_ARATH Probable potassium channel AKT5 OS=Arabidopsis thaliana GN=AKT5 PE=2 SV=2 569 658 2.0E-08
sp|Q2QLG9|CTTB2_OTOGA Cortactin-binding protein 2 OS=Otolemur garnettii GN=CTTNBP2 PE=3 SV=1 463 622 2.0E-08
sp|Q2QLG9|CTTB2_OTOGA Cortactin-binding protein 2 OS=Otolemur garnettii GN=CTTNBP2 PE=3 SV=1 349 504 2.0E-08
sp|Q7ZT11|ANKR1_CHICK Ankyrin repeat domain-containing protein 1 OS=Gallus gallus GN=ANKRD1 PE=2 SV=1 315 476 2.0E-08
sp|Q9GL21|UACA_CANLF Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Canis lupus familiaris GN=UACA PE=2 SV=2 358 529 2.0E-08
sp|Q15327|ANKR1_HUMAN Ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=ANKRD1 PE=1 SV=2 313 476 2.0E-08
sp|Q8R516|MIB2_MOUSE E3 ubiquitin-protein ligase MIB2 OS=Mus musculus GN=Mib2 PE=1 SV=2 534 693 2.0E-08
sp|Q91974|IKBA_CHICK NF-kappa-B inhibitor alpha OS=Gallus gallus GN=NFKBIA PE=2 SV=1 409 584 2.0E-08
sp|Q96I34|PP16A_HUMAN Protein phosphatase 1 regulatory subunit 16A OS=Homo sapiens GN=PPP1R16A PE=1 SV=1 513 670 2.0E-08
sp|Q876L5|AKR1_SACU7 Palmitoyltransferase AKR1 OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=AKR1 PE=3 SV=2 436 591 2.0E-08
sp|Q6AFL2|Y958_LEIXX Putative ankyrin-containing lipoprotein Lxx09580 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=Lxx09580 PE=3 SV=2 441 605 2.0E-08
sp|P14585|LIN12_CAEEL Protein lin-12 OS=Caenorhabditis elegans GN=lin-12 PE=1 SV=1 512 723 2.0E-08
sp|Q8WXI3|ASB10_HUMAN Ankyrin repeat and SOCS box protein 10 OS=Homo sapiens GN=ASB10 PE=1 SV=2 467 692 2.0E-08
sp|Q9Z2G1|FM1AA_MOUSE Protein fem-1 homolog A-A OS=Mus musculus GN=Fem1aa PE=2 SV=1 496 668 2.0E-08
sp|Q08DV6|ASB3_BOVIN Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 336 526 3.0E-08
sp|Q71S21|INVSB_XENLA Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 334 523 3.0E-08
sp|Q9J513|V222_FOWPN Putative ankyrin repeat protein FPV222 OS=Fowlpox virus (strain NVSL) GN=FPV222 PE=3 SV=1 367 692 3.0E-08
sp|Q9J502|V233_FOWPN Putative ankyrin repeat protein FPV233 OS=Fowlpox virus (strain NVSL) GN=FPV233 PE=3 SV=1 345 493 3.0E-08
sp|A6NGH8|ANR61_HUMAN Ankyrin repeat domain-containing protein 61 OS=Homo sapiens GN=ANKRD61 PE=3 SV=2 338 487 3.0E-08
sp|Q7Z6G8|ANS1B_HUMAN Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens GN=ANKS1B PE=1 SV=2 337 529 3.0E-08
sp|A0M8T3|ASZ1_FELCA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Felis catus GN=ASZ1 PE=3 SV=1 348 518 3.0E-08
sp|Q499M5|ANR16_RAT Ankyrin repeat domain-containing protein 16 OS=Rattus norvegicus GN=Ankrd16 PE=2 SV=1 339 588 3.0E-08
sp|Q00PJ3|ASZ1_ATEAB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Atelerix albiventris GN=ASZ1 PE=3 SV=1 348 518 3.0E-08
sp|Q2IBE6|CTTB2_PONAB Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 349 487 3.0E-08
sp|Q5TYW2|A20A1_HUMAN Ankyrin repeat domain-containing protein 20A1 OS=Homo sapiens GN=ANKRD20A1 PE=2 SV=1 522 683 3.0E-08
sp|Q07E41|CTTB2_DASNO Cortactin-binding protein 2 OS=Dasypus novemcinctus GN=CTTNBP2 PE=3 SV=1 362 523 3.0E-08
sp|Q07E17|ASZ1_MUSPF Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mustela putorius furo GN=ASZ1 PE=3 SV=1 348 518 3.0E-08
sp|Q5VUR7|A20A3_HUMAN Ankyrin repeat domain-containing protein 20A3 OS=Homo sapiens GN=ANKRD20A3 PE=3 SV=1 513 683 3.0E-08
sp|A2A2Z9|AN18B_HUMAN Ankyrin repeat domain-containing protein 18B OS=Homo sapiens GN=ANKRD18B PE=1 SV=1 565 683 3.0E-08
sp|Q07E15|CTTB2_MUSPF Cortactin-binding protein 2 OS=Mustela putorius furo GN=CTTNBP2 PE=3 SV=1 401 673 3.0E-08
sp|Q8WWH4|ASZ1_HUMAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Homo sapiens GN=ASZ1 PE=2 SV=1 348 490 3.0E-08
sp|Q00PJ1|CTTB2_ATEAB Cortactin-binding protein 2 OS=Atelerix albiventris GN=CTTNBP2 PE=3 SV=1 362 620 3.0E-08
sp|Q6ZVZ8|ASB18_HUMAN Ankyrin repeat and SOCS box protein 18 OS=Homo sapiens GN=ASB18 PE=2 SV=2 467 692 3.0E-08
sp|Q6ZVZ8|ASB18_HUMAN Ankyrin repeat and SOCS box protein 18 OS=Homo sapiens GN=ASB18 PE=2 SV=2 339 523 3.0E-08
sp|Q8VHA6|ASB18_MOUSE Ankyrin repeat and SOCS box protein 18 OS=Mus musculus GN=Asb18 PE=2 SV=1 253 523 3.0E-08
sp|Q2QLB5|ASZ1_CALMO Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Callicebus moloch GN=ASZ1 PE=3 SV=1 348 490 3.0E-08
sp|Q90623|MYPT1_CHICK Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus GN=PPP1R12A PE=1 SV=1 512 683 3.0E-08
sp|Q9TZC4|ILKH_CAEEL Integrin-linked protein kinase homolog pat-4 OS=Caenorhabditis elegans GN=pat-4 PE=1 SV=1 521 660 3.0E-08
sp|Q5REW9|ANR27_PONAB Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 528 679 4.0E-08
sp|Q9Z2X2|PSD10_MOUSE 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 339 508 4.0E-08
sp|O35516|NOTC2_MOUSE Neurogenic locus notch homolog protein 2 OS=Mus musculus GN=Notch2 PE=1 SV=1 518 683 4.0E-08
sp|Q54HW1|PSD10_DICDI 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 579 683 4.0E-08
sp|Q4ULZ2|Y580_RICFE Putative ankyrin repeat protein RF_0580 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0580 PE=3 SV=1 515 692 4.0E-08
sp|F8W2M1|HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 339 521 4.0E-08
sp|Q9ET47|ESPN_MOUSE Espin OS=Mus musculus GN=Espn PE=1 SV=2 356 611 4.0E-08
sp|Q09701|AKR1_SCHPO Palmitoyltransferase akr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=akr1 PE=3 SV=1 524 685 4.0E-08
sp|Q2QLF8|CTTB2_CALJA Cortactin-binding protein 2 OS=Callithrix jacchus GN=CTTNBP2 PE=3 SV=1 362 521 4.0E-08
sp|Q2IBF7|CTTB2_GORGO Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 362 521 4.0E-08
sp|Q07E30|ASZ1_NEONE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Neofelis nebulosa GN=ASZ1 PE=3 SV=1 348 518 4.0E-08
sp|Q8WZ74|CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 362 521 4.0E-08
sp|Q2QL82|CTTB2_MICMU Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 401 666 4.0E-08
sp|Q6S8J7|POTEA_HUMAN POTE ankyrin domain family member A OS=Homo sapiens GN=POTEA PE=2 SV=1 532 694 4.0E-08
sp|Q07DX4|CTTB2_NOMLE Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 349 487 4.0E-08
sp|Q07E41|CTTB2_DASNO Cortactin-binding protein 2 OS=Dasypus novemcinctus GN=CTTNBP2 PE=3 SV=1 339 452 4.0E-08
sp|Q5VUR7|A20A3_HUMAN Ankyrin repeat domain-containing protein 20A3 OS=Homo sapiens GN=ANKRD20A3 PE=3 SV=1 522 683 4.0E-08
sp|Q5SQ80|A20A2_HUMAN Ankyrin repeat domain-containing protein 20A2 OS=Homo sapiens GN=ANKRD20A2 PE=3 SV=1 513 683 4.0E-08
sp|Q5SQ80|A20A2_HUMAN Ankyrin repeat domain-containing protein 20A2 OS=Homo sapiens GN=ANKRD20A2 PE=3 SV=1 522 683 4.0E-08
sp|Q2IBE3|ASZ1_PONAB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pongo abelii GN=ASZ1 PE=3 SV=1 348 490 4.0E-08
sp|Q1RMI3|GABP1_BOVIN GA-binding protein subunit beta-1 OS=Bos taurus GN=GABPB1 PE=2 SV=1 399 551 4.0E-08
sp|Q06547|GABP1_HUMAN GA-binding protein subunit beta-1 OS=Homo sapiens GN=GABPB1 PE=1 SV=2 399 551 4.0E-08
sp|Q3V096|ANR42_MOUSE Ankyrin repeat domain-containing protein 42 OS=Mus musculus GN=Ankrd42 PE=2 SV=1 489 737 4.0E-08
sp|Q07DW4|CTTB2_MUNRE Cortactin-binding protein 2 OS=Muntiacus reevesi GN=CTTNBP2 PE=3 SV=1 349 489 4.0E-08
sp|Q2QLC6|ASZ1_CARPS Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Carollia perspicillata GN=ASZ1 PE=3 SV=1 439 590 4.0E-08
sp|Q8WMX6|ASZ1_PANTR Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pan troglodytes GN=ASZ1 PE=2 SV=1 348 490 4.0E-08
sp|Q00PJ1|CTTB2_ATEAB Cortactin-binding protein 2 OS=Atelerix albiventris GN=CTTNBP2 PE=3 SV=1 349 491 4.0E-08
sp|Q2IBF5|ASZ1_GORGO Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Gorilla gorilla gorilla GN=ASZ1 PE=3 SV=1 348 490 4.0E-08
sp|O90760|V031_FOWPN Putative ankyrin repeat protein FPV031 OS=Fowlpox virus (strain NVSL) GN=ANK3 PE=3 SV=1 339 487 4.0E-08
sp|Q9D2J7|ANKE1_MOUSE Ankyrin repeat and EF-hand domain-containing protein 1 OS=Mus musculus GN=Ankef1 PE=2 SV=1 367 489 4.0E-08
sp|Q96I34|PP16A_HUMAN Protein phosphatase 1 regulatory subunit 16A OS=Homo sapiens GN=PPP1R16A PE=1 SV=1 337 528 4.0E-08
sp|Q8TAK5|GABP2_HUMAN GA-binding protein subunit beta-2 OS=Homo sapiens GN=GABPB2 PE=1 SV=1 481 626 4.0E-08
sp|Q9BZF9|UACA_HUMAN Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens GN=UACA PE=1 SV=2 374 529 4.0E-08
sp|Q6NSI1|AR26L_HUMAN Putative ankyrin repeat domain-containing protein 26-like protein OS=Homo sapiens GN=ANKRD26P1 PE=5 SV=2 533 690 4.0E-08
sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 434 683 5.0E-08
sp|Q8VD46|ASZ1_MOUSE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mus musculus GN=Asz1 PE=1 SV=2 415 568 5.0E-08
sp|Q2IBB2|CTTB2_RHIFE Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 339 452 5.0E-08
sp|Q8BIZ1|ANS1B_MOUSE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus GN=Anks1b PE=1 SV=3 337 529 5.0E-08
sp|Q9WV06|ANKR2_MOUSE Ankyrin repeat domain-containing protein 2 OS=Mus musculus GN=Ankrd2 PE=1 SV=3 313 471 5.0E-08
sp|Q09YG9|CTTB2_SAIBB Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 362 521 5.0E-08
sp|Q07E41|CTTB2_DASNO Cortactin-binding protein 2 OS=Dasypus novemcinctus GN=CTTNBP2 PE=3 SV=1 463 622 5.0E-08
sp|Q9M8S6|SKOR_ARATH Potassium channel SKOR OS=Arabidopsis thaliana GN=SKOR PE=1 SV=1 415 584 5.0E-08
sp|P21783|NOTC1_XENLA Neurogenic locus notch homolog protein 1 OS=Xenopus laevis GN=notch1 PE=1 SV=3 424 653 5.0E-08
sp|Q9SQK3|EM506_ARATH Ankyrin repeat domain-containing protein EMB506, chloroplastic OS=Arabidopsis thaliana GN=EMB506 PE=1 SV=1 435 561 5.0E-08
sp|Q2QLG0|ASZ1_CALJA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Callithrix jacchus GN=ASZ1 PE=3 SV=1 439 590 5.0E-08
sp|O14593|RFXK_HUMAN DNA-binding protein RFXANK OS=Homo sapiens GN=RFXANK PE=1 SV=2 454 620 5.0E-08
sp|Q3TPE9|ANKY2_MOUSE Ankyrin repeat and MYND domain-containing protein 2 OS=Mus musculus GN=Ankmy2 PE=1 SV=1 536 650 5.0E-08
sp|Q5UPE2|YL063_MIMIV Putative ankyrin repeat protein L63 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L63 PE=3 SV=1 339 526 5.0E-08
sp|Q8IYU2|HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 339 521 6.0E-08
sp|Q804S5|MIB1_DANRE E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 567 676 6.0E-08
sp|B9EJA2|CTTB2_MOUSE Cortactin-binding protein 2 OS=Mus musculus GN=Cttnbp2 PE=1 SV=2 362 600 6.0E-08
sp|Q7S3M5|AKR1_NEUCR Palmitoyltransferase akr1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-1 PE=3 SV=2 345 512 6.0E-08
sp|Q2QLA2|CTTB2_HORSE Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 339 452 6.0E-08
sp|Q2QLB3|CTTB2_CALMO Cortactin-binding protein 2 OS=Callicebus moloch GN=CTTNBP2 PE=3 SV=1 362 521 6.0E-08
sp|Q108T9|CTTB2_LOXAF Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 339 452 6.0E-08
sp|Q07DX6|ASZ1_NOMLE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Nomascus leucogenys GN=ASZ1 PE=3 SV=1 348 490 6.0E-08
sp|Q8WMX7|ASZ1_PAPAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Papio anubis GN=ASZ1 PE=2 SV=1 348 490 6.0E-08
sp|Q2IBB1|ASZ1_CHLAE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Chlorocebus aethiops GN=ASZ1 PE=3 SV=1 348 490 6.0E-08
sp|Q2QLG9|CTTB2_OTOGA Cortactin-binding protein 2 OS=Otolemur garnettii GN=CTTNBP2 PE=3 SV=1 362 600 6.0E-08
sp|Q91974|IKBA_CHICK NF-kappa-B inhibitor alpha OS=Gallus gallus GN=NFKBIA PE=2 SV=1 511 658 6.0E-08
sp|Q5NVB9|ZDH13_PONAB Palmitoyltransferase ZDHHC13 OS=Pongo abelii GN=ZDHHC13 PE=2 SV=1 413 569 6.0E-08
sp|Q8IUH4|ZDH13_HUMAN Palmitoyltransferase ZDHHC13 OS=Homo sapiens GN=ZDHHC13 PE=1 SV=3 413 569 6.0E-08
sp|Q0V8G2|GABP2_BOVIN GA-binding protein subunit beta-2 OS=Bos taurus GN=GABPB2 PE=2 SV=2 339 486 6.0E-08
sp|Q0V8G2|GABP2_BOVIN GA-binding protein subunit beta-2 OS=Bos taurus GN=GABPB2 PE=2 SV=2 515 711 6.0E-08
sp|Q8VHQ3|PP16B_MOUSE Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Mus musculus GN=Ppp1r16b PE=1 SV=1 337 552 6.0E-08
sp|Q96NS5|ASB16_HUMAN Ankyrin repeat and SOCS box protein 16 OS=Homo sapiens GN=ASB16 PE=1 SV=2 363 569 6.0E-08
sp|Q9Z2G1|FM1AA_MOUSE Protein fem-1 homolog A-A OS=Mus musculus GN=Fem1aa PE=2 SV=1 534 683 6.0E-08
sp|Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 339 536 7.0E-08
sp|Q54HW1|PSD10_DICDI 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 336 486 7.0E-08
sp|Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 348 535 7.0E-08
sp|Q6S8J3|POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 532 694 7.0E-08
sp|P0CG39|POTEJ_HUMAN POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 532 703 7.0E-08
sp|Q63618|ESPN_RAT Espin OS=Rattus norvegicus GN=Espn PE=1 SV=2 356 611 7.0E-08
sp|A6QL64|AN36A_HUMAN Ankyrin repeat domain-containing protein 36A OS=Homo sapiens GN=ANKRD36 PE=2 SV=3 339 494 7.0E-08
sp|Q8T2Q0|ZDHC6_DICDI Putative ZDHHC-type palmitoyltransferase 6 OS=Dictyostelium discoideum GN=DDB_G0275149 PE=2 SV=1 494 691 7.0E-08
sp|A0M8T5|CTTB2_FELCA Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 339 452 7.0E-08
sp|Q2KI79|ANRA2_BOVIN Ankyrin repeat family A protein 2 OS=Bos taurus GN=ANKRA2 PE=2 SV=1 595 683 7.0E-08
sp|Q07DX4|CTTB2_NOMLE Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 362 521 7.0E-08
sp|Q9VFD5|FEM1A_DROME Protein fem-1 homolog CG6966 OS=Drosophila melanogaster GN=CG6966 PE=2 SV=2 564 683 7.0E-08
sp|Q3ZBX7|ANKR1_BOVIN Ankyrin repeat domain-containing protein 1 OS=Bos taurus GN=ANKRD1 PE=2 SV=1 313 476 7.0E-08
sp|Q8WWH4|ASZ1_HUMAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Homo sapiens GN=ASZ1 PE=2 SV=1 410 568 7.0E-08
sp|Q15327|ANKR1_HUMAN Ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=ANKRD1 PE=1 SV=2 565 672 7.0E-08
sp|Q9TU71|ANKR1_RABIT Ankyrin repeat domain-containing protein 1 OS=Oryctolagus cuniculus GN=ANKRD1 PE=2 SV=1 565 672 7.0E-08
sp|Q9SQK3|EM506_ARATH Ankyrin repeat domain-containing protein EMB506, chloroplastic OS=Arabidopsis thaliana GN=EMB506 PE=1 SV=1 546 672 7.0E-08
sp|Q9J4Z8|V242_FOWPN Putative ankyrin repeat protein FPV242 OS=Fowlpox virus (strain NVSL) GN=FPV242 PE=3 SV=1 377 588 7.0E-08
sp|P0CG38|POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 532 703 8.0E-08
sp|P0C6S7|ANS1B_RAT Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus GN=Anks1b PE=1 SV=1 337 529 8.0E-08
sp|Q9H9E1|ANRA2_HUMAN Ankyrin repeat family A protein 2 OS=Homo sapiens GN=ANKRA2 PE=1 SV=1 595 683 8.0E-08
sp|Q07E41|CTTB2_DASNO Cortactin-binding protein 2 OS=Dasypus novemcinctus GN=CTTNBP2 PE=3 SV=1 401 662 8.0E-08
sp|Q5BKI6|ANKR1_XENTR Ankyrin repeat domain-containing protein 1 OS=Xenopus tropicalis GN=ankrd1 PE=2 SV=1 339 479 8.0E-08
sp|Q4UJ75|A20A4_HUMAN Ankyrin repeat domain-containing protein 20A4 OS=Homo sapiens GN=ANKRD20A4 PE=3 SV=1 513 683 8.0E-08
sp|Q2IBA2|CTTB2_CHLAE Cortactin-binding protein 2 OS=Chlorocebus aethiops GN=CTTNBP2 PE=3 SV=1 463 620 8.0E-08
sp|Q8WMX6|ASZ1_PANTR Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pan troglodytes GN=ASZ1 PE=2 SV=1 410 568 8.0E-08
sp|Q00PJ1|CTTB2_ATEAB Cortactin-binding protein 2 OS=Atelerix albiventris GN=CTTNBP2 PE=3 SV=1 463 624 8.0E-08
sp|Q8WXH4|ASB11_HUMAN Ankyrin repeat and SOCS box protein 11 OS=Homo sapiens GN=ASB11 PE=1 SV=1 343 575 8.0E-08
sp|Q8HYY4|UACA_BOVIN Uveal autoantigen with coiled-coil domains and ankyrin repeats protein OS=Bos taurus GN=UACA PE=1 SV=1 358 529 8.0E-08
sp|Q91ZT8|ASB9_MOUSE Ankyrin repeat and SOCS box protein 9 OS=Mus musculus GN=Asb9 PE=1 SV=2 496 658 8.0E-08
sp|O90760|V031_FOWPN Putative ankyrin repeat protein FPV031 OS=Fowlpox virus (strain NVSL) GN=ANK3 PE=3 SV=1 545 672 8.0E-08
sp|Q9D738|ASB12_MOUSE Ankyrin repeat and SOCS box protein 12 OS=Mus musculus GN=Asb12 PE=2 SV=1 567 660 8.0E-08
sp|Q07DV3|ASZ1_AOTNA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Aotus nancymaae GN=ASZ1 PE=3 SV=1 439 590 8.0E-08
sp|O14593|RFXK_HUMAN DNA-binding protein RFXANK OS=Homo sapiens GN=RFXANK PE=1 SV=2 358 487 8.0E-08
sp|Q9Y575|ASB3_HUMAN Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 342 526 9.0E-08
sp|A5A3E0|POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2 532 703 9.0E-08
sp|P46530|NOTC1_DANRE Neurogenic locus notch homolog protein 1 OS=Danio rerio GN=notch1a PE=2 SV=1 349 487 9.0E-08
sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 339 452 9.0E-08
sp|A6NC57|ANR62_HUMAN Ankyrin repeat domain-containing protein 62 OS=Homo sapiens GN=ANKRD62 PE=2 SV=4 346 502 9.0E-08
sp|Q2IBE3|ASZ1_PONAB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pongo abelii GN=ASZ1 PE=3 SV=1 410 568 9.0E-08
sp|Q07DY4|CTTB2_COLGU Cortactin-binding protein 2 OS=Colobus guereza GN=CTTNBP2 PE=3 SV=1 463 620 9.0E-08
sp|Q2IBF5|ASZ1_GORGO Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Gorilla gorilla gorilla GN=ASZ1 PE=3 SV=1 410 568 9.0E-08
sp|A1X154|ASZ1_ECHTE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Echinops telfairi GN=ASZ1 PE=3 SV=1 348 502 9.0E-08
sp|Q09YK6|ASZ1_ATEGE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ateles geoffroyi GN=ASZ1 PE=3 SV=1 348 490 9.0E-08
sp|Q8IVF6|AN18A_HUMAN Ankyrin repeat domain-containing protein 18A OS=Homo sapiens GN=ANKRD18A PE=2 SV=3 565 683 9.0E-08
sp|Q8TAK5|GABP2_HUMAN GA-binding protein subunit beta-2 OS=Homo sapiens GN=GABPB2 PE=1 SV=1 339 486 9.0E-08
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 391 683 1.0E-07
sp|Q9J5H7|V024_FOWPN Putative ankyrin repeat protein FPV024 OS=Fowlpox virus (strain NVSL) GN=FPV024 PE=3 SV=1 339 560 1.0E-07
sp|Q5RCK5|ASB7_PONAB Ankyrin repeat and SOCS box protein 7 OS=Pongo abelii GN=ASB7 PE=2 SV=1 338 475 1.0E-07
sp|A5PMU4|ANS1B_DANRE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 336 529 1.0E-07
sp|Q5JPF3|AN36C_HUMAN Ankyrin repeat domain-containing protein 36C OS=Homo sapiens GN=ANKRD36C PE=2 SV=3 533 717 1.0E-07
sp|E1C656|HACE1_CHICK E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 339 521 1.0E-07
sp|Q09YK4|CTTB2_ATEGE Cortactin-binding protein 2 OS=Ateles geoffroyi GN=CTTNBP2 PE=3 SV=1 349 487 1.0E-07
sp|Q9CQM6|ANR61_MOUSE Ankyrin repeat domain-containing protein 61 OS=Mus musculus GN=Ankrd61 PE=2 SV=1 337 479 1.0E-07
sp|Q00PJ3|ASZ1_ATEAB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Atelerix albiventris GN=ASZ1 PE=3 SV=1 415 568 1.0E-07
sp|Q07DV1|CTTB2_AOTNA Cortactin-binding protein 2 OS=Aotus nancymaae GN=CTTNBP2 PE=3 SV=1 339 452 1.0E-07
sp|Q2IBD4|CTTB2_RAT Cortactin-binding protein 2 OS=Rattus norvegicus GN=Cttnbp2 PE=1 SV=1 362 521 1.0E-07
sp|Q2IBE6|CTTB2_PONAB Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 362 521 1.0E-07
sp|Q8VHS5|ASB16_MOUSE Ankyrin repeat and SOCS box protein 16 OS=Mus musculus GN=Asb16 PE=2 SV=1 410 623 1.0E-07
sp|Q2QLB3|CTTB2_CALMO Cortactin-binding protein 2 OS=Callicebus moloch GN=CTTNBP2 PE=3 SV=1 339 452 1.0E-07
sp|Q00420|GABP1_MOUSE GA-binding protein subunit beta-1 OS=Mus musculus GN=Gabpb1 PE=1 SV=2 399 551 1.0E-07
sp|Q09YJ3|CTTB2_MUNMU Cortactin-binding protein 2 OS=Muntiacus muntjak GN=CTTNBP2 PE=3 SV=1 339 452 1.0E-07
sp|Q4UJ75|A20A4_HUMAN Ankyrin repeat domain-containing protein 20A4 OS=Homo sapiens GN=ANKRD20A4 PE=3 SV=1 522 683 1.0E-07
sp|Q7XUW4|KOR2_ORYSJ Potassium channel KOR2 OS=Oryza sativa subsp. japonica GN=Os04g0445000 PE=2 SV=2 572 685 1.0E-07
sp|Q07DX6|ASZ1_NOMLE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Nomascus leucogenys GN=ASZ1 PE=3 SV=1 410 568 1.0E-07
sp|Q86SG2|ANR23_HUMAN Ankyrin repeat domain-containing protein 23 OS=Homo sapiens GN=ANKRD23 PE=1 SV=1 337 494 1.0E-07
sp|Q8WMX7|ASZ1_PAPAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Papio anubis GN=ASZ1 PE=2 SV=1 410 568 1.0E-07
sp|Q2IBB1|ASZ1_CHLAE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Chlorocebus aethiops GN=ASZ1 PE=3 SV=1 410 568 1.0E-07
sp|Q2QLC6|ASZ1_CARPS Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Carollia perspicillata GN=ASZ1 PE=3 SV=1 348 490 1.0E-07
sp|Q00PJ1|CTTB2_ATEAB Cortactin-binding protein 2 OS=Atelerix albiventris GN=CTTNBP2 PE=3 SV=1 339 458 1.0E-07
sp|Q7ZT11|ANKR1_CHICK Ankyrin repeat domain-containing protein 1 OS=Gallus gallus GN=ANKRD1 PE=2 SV=1 378 536 1.0E-07
sp|Q755Y0|AKR1_ASHGO Palmitoyltransferase AKR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AKR1 PE=3 SV=1 476 648 1.0E-07
sp|Q9BSK4|FEM1A_HUMAN Protein fem-1 homolog A OS=Homo sapiens GN=FEM1A PE=1 SV=1 535 668 1.0E-07
sp|Q865U8|ANKR1_PIG Ankyrin repeat domain-containing protein 1 OS=Sus scrofa GN=ANKRD1 PE=2 SV=1 565 672 1.0E-07
sp|Q9D2J7|ANKE1_MOUSE Ankyrin repeat and EF-hand domain-containing protein 1 OS=Mus musculus GN=Ankef1 PE=2 SV=1 479 637 1.0E-07
sp|Q05753|AKRP_ARATH Ankyrin repeat domain-containing protein, chloroplastic OS=Arabidopsis thaliana GN=AKRP PE=1 SV=2 514 652 1.0E-07
sp|Q6AFL2|Y958_LEIXX Putative ankyrin-containing lipoprotein Lxx09580 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=Lxx09580 PE=3 SV=2 543 672 1.0E-07
sp|P81069|GABP2_MOUSE GA-binding protein subunit beta-2 OS=Mus musculus GN=Gabpb2 PE=1 SV=2 515 624 1.0E-07
sp|P81069|GABP2_MOUSE GA-binding protein subunit beta-2 OS=Mus musculus GN=Gabpb2 PE=1 SV=2 481 619 1.0E-07
sp|Q86U10|LPP60_HUMAN 60 kDa lysophospholipase OS=Homo sapiens GN=ASPG PE=2 SV=3 564 663 1.0E-07
sp|Q4UKJ3|Y1087_RICFE Putative ankyrin repeat protein RF_1087 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_1087 PE=3 SV=1 569 659 1.0E-07
sp|Q8C6Y6|ASB14_MOUSE Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 334 557 2.0E-07
sp|Q8K0L0|ASB2_MOUSE Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 483 685 2.0E-07
sp|Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 363 568 2.0E-07
sp|Q5RCK5|ASB7_PONAB Ankyrin repeat and SOCS box protein 7 OS=Pongo abelii GN=ASB7 PE=2 SV=1 539 683 2.0E-07
sp|Q91ZU0|ASB7_MOUSE Ankyrin repeat and SOCS box protein 7 OS=Mus musculus GN=Asb7 PE=2 SV=2 338 475 2.0E-07
sp|Q9H672|ASB7_HUMAN Ankyrin repeat and SOCS box protein 7 OS=Homo sapiens GN=ASB7 PE=1 SV=2 338 475 2.0E-07
sp|Q9BGT9|ASB7_MACFA Ankyrin repeat and SOCS box protein 7 OS=Macaca fascicularis GN=ASB7 PE=2 SV=1 338 475 2.0E-07
sp|Q3U0D9|HACE1_MOUSE E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 348 507 2.0E-07
sp|D3ZBM7|HACE1_RAT E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 339 507 2.0E-07
sp|A2AS55|ANR16_MOUSE Ankyrin repeat domain-containing protein 16 OS=Mus musculus GN=Ankrd16 PE=2 SV=1 337 509 2.0E-07
sp|Q8N283|ANR35_HUMAN Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 336 484 2.0E-07
sp|Q5RFS1|ASB11_PONAB Ankyrin repeat and SOCS box protein 11 OS=Pongo abelii GN=ASB11 PE=2 SV=1 343 551 2.0E-07
sp|Q8IUH5|ZDH17_HUMAN Palmitoyltransferase ZDHHC17 OS=Homo sapiens GN=ZDHHC17 PE=1 SV=2 536 671 2.0E-07
sp|Q2IBB4|ASZ1_RHIFE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Rhinolophus ferrumequinum GN=ASZ1 PE=3 SV=1 344 518 2.0E-07
sp|Q09YK4|CTTB2_ATEGE Cortactin-binding protein 2 OS=Ateles geoffroyi GN=CTTNBP2 PE=3 SV=1 362 521 2.0E-07
sp|Q80TN5|ZDH17_MOUSE Palmitoyltransferase ZDHHC17 OS=Mus musculus GN=Zdhhc17 PE=1 SV=2 536 671 2.0E-07
sp|E9PTT0|ZDH17_RAT Palmitoyltransferase ZDHHC17 OS=Rattus norvegicus GN=Zdhhc17 PE=1 SV=1 536 671 2.0E-07
sp|Q99PE2|ANRA2_MOUSE Ankyrin repeat family A protein 2 OS=Mus musculus GN=Ankra2 PE=1 SV=1 425 543 2.0E-07
sp|A0M8T3|ASZ1_FELCA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Felis catus GN=ASZ1 PE=3 SV=1 415 568 2.0E-07
sp|Q499M5|ANR16_RAT Ankyrin repeat domain-containing protein 16 OS=Rattus norvegicus GN=Ankrd16 PE=2 SV=1 477 686 2.0E-07
sp|Q2KI79|ANRA2_BOVIN Ankyrin repeat family A protein 2 OS=Bos taurus GN=ANKRA2 PE=2 SV=1 425 543 2.0E-07
sp|Q09YG9|CTTB2_SAIBB Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 339 452 2.0E-07
sp|Q2IBD4|CTTB2_RAT Cortactin-binding protein 2 OS=Rattus norvegicus GN=Cttnbp2 PE=1 SV=1 349 487 2.0E-07
sp|B9EJA2|CTTB2_MOUSE Cortactin-binding protein 2 OS=Mus musculus GN=Cttnbp2 PE=1 SV=2 339 452 2.0E-07
sp|Q07E30|ASZ1_NEONE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Neofelis nebulosa GN=ASZ1 PE=3 SV=1 415 568 2.0E-07
sp|Q2QL82|CTTB2_MICMU Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 339 452 2.0E-07
sp|Q2IBF8|CTTB2_EULMM Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 339 456 2.0E-07
sp|Q8CGB3|UACA_MOUSE Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Mus musculus GN=Uaca PE=1 SV=2 543 673 2.0E-07
sp|Q3ZBX7|ANKR1_BOVIN Ankyrin repeat domain-containing protein 1 OS=Bos taurus GN=ANKRD1 PE=2 SV=1 565 672 2.0E-07
sp|Q5BKI6|ANKR1_XENTR Ankyrin repeat domain-containing protein 1 OS=Xenopus tropicalis GN=ankrd1 PE=2 SV=1 400 536 2.0E-07
sp|Q5BKI6|ANKR1_XENTR Ankyrin repeat domain-containing protein 1 OS=Xenopus tropicalis GN=ankrd1 PE=2 SV=1 415 569 2.0E-07
sp|Q68LP1|MIB2_RAT E3 ubiquitin-protein ligase MIB2 OS=Rattus norvegicus GN=Mib2 PE=1 SV=2 351 541 2.0E-07
sp|Q2QL84|ASZ1_MICMU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Microcebus murinus GN=ASZ1 PE=3 SV=1 348 490 2.0E-07
sp|Q4KL97|ANKR1_XENLA Ankyrin repeat domain-containing protein 1 OS=Xenopus laevis GN=ankrd1 PE=2 SV=1 415 569 2.0E-07
sp|Q09YM8|CTTB2_RABIT Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 349 489 2.0E-07
sp|Q2IBA2|CTTB2_CHLAE Cortactin-binding protein 2 OS=Chlorocebus aethiops GN=CTTNBP2 PE=3 SV=1 349 487 2.0E-07
sp|Q54BA2|Y3800_DICDI Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 337 475 2.0E-07
sp|Q9GL21|UACA_CANLF Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Canis lupus familiaris GN=UACA PE=2 SV=2 343 439 2.0E-07
sp|Q17QS6|ASB5_BOVIN Ankyrin repeat and SOCS box protein 5 OS=Bos taurus GN=ASB5 PE=2 SV=1 532 686 2.0E-07
sp|Q15327|ANKR1_HUMAN Ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=ANKRD1 PE=1 SV=2 553 683 2.0E-07
sp|Q8R560|ANKR1_RAT Ankyrin repeat domain-containing protein 1 OS=Rattus norvegicus GN=Ankrd1 PE=1 SV=1 565 672 2.0E-07
sp|Q9CR42|ANKR1_MOUSE Ankyrin repeat domain-containing protein 1 OS=Mus musculus GN=Ankrd1 PE=1 SV=1 565 672 2.0E-07
sp|Q9CR42|ANKR1_MOUSE Ankyrin repeat domain-containing protein 1 OS=Mus musculus GN=Ankrd1 PE=1 SV=1 553 683 2.0E-07
sp|Q96I34|PP16A_HUMAN Protein phosphatase 1 regulatory subunit 16A OS=Homo sapiens GN=PPP1R16A PE=1 SV=1 344 569 2.0E-07
sp|Q6NLQ8|XB32_ARATH E3 ubiquitin-protein ligase XBAT32 OS=Arabidopsis thaliana GN=XBAT32 PE=1 SV=1 585 715 2.0E-07
sp|Q6AFL2|Y958_LEIXX Putative ankyrin-containing lipoprotein Lxx09580 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=Lxx09580 PE=3 SV=2 372 556 2.0E-07
sp|P81069|GABP2_MOUSE GA-binding protein subunit beta-2 OS=Mus musculus GN=Gabpb2 PE=1 SV=2 339 486 2.0E-07
sp|A7E2S9|A30BL_HUMAN Putative ankyrin repeat domain-containing protein 30B-like OS=Homo sapiens GN=ANKRD30BL PE=2 SV=3 513 661 2.0E-07
sp|A7E2S9|A30BL_HUMAN Putative ankyrin repeat domain-containing protein 30B-like OS=Homo sapiens GN=ANKRD30BL PE=2 SV=3 530 683 2.0E-07
sp|Q6DRG7|MYPT1_DANRE Protein phosphatase 1 regulatory subunit 12A OS=Danio rerio GN=ppp1r12a PE=2 SV=2 512 683 2.0E-07
sp|A0JNU3|LPP60_MOUSE 60 kDa lysophospholipase OS=Mus musculus GN=Aspg PE=1 SV=1 524 650 2.0E-07
sp|Q1RJN6|Y347_RICBR Putative ankyrin repeat protein RBE_0347 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0347 PE=3 SV=1 411 559 2.0E-07
sp|Q96NS5|ASB16_HUMAN Ankyrin repeat and SOCS box protein 16 OS=Homo sapiens GN=ASB16 PE=1 SV=2 409 623 2.0E-07
sp|Q96NS5|ASB16_HUMAN Ankyrin repeat and SOCS box protein 16 OS=Homo sapiens GN=ASB16 PE=1 SV=2 420 635 2.0E-07
sp|G0LXV8|LATA_LATHA Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 415 591 3.0E-07
sp|Q68DC2|ANKS6_HUMAN Ankyrin repeat and SAM domain-containing protein 6 OS=Homo sapiens GN=ANKS6 PE=1 SV=2 592 686 3.0E-07
sp|Q91ZT7|ASB10_MOUSE Ankyrin repeat and SOCS box protein 10 OS=Mus musculus GN=Asb10 PE=2 SV=1 339 523 3.0E-07
sp|Q9BXX2|AN30B_HUMAN Ankyrin repeat domain-containing protein 30B OS=Homo sapiens GN=ANKRD30B PE=2 SV=3 513 671 3.0E-07
sp|Q653P0|KOR1_ORYSJ Potassium channel KOR1 OS=Oryza sativa subsp. japonica GN=Os06g0250600 PE=2 SV=1 327 518 3.0E-07
sp|Q9WV71|ASB4_MOUSE Ankyrin repeat and SOCS box protein 4 OS=Mus musculus GN=Asb4 PE=1 SV=1 342 523 3.0E-07
sp|Q18297|TRPA1_CAEEL Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans GN=trpa-1 PE=2 SV=5 357 486 3.0E-07
sp|Q2IBB4|ASZ1_RHIFE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Rhinolophus ferrumequinum GN=ASZ1 PE=3 SV=1 415 568 3.0E-07
sp|A4D7T3|ASZ1_MACEU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Macropus eugenii GN=ASZ1 PE=3 SV=1 348 490 3.0E-07
sp|Q2KI79|ANRA2_BOVIN Ankyrin repeat family A protein 2 OS=Bos taurus GN=ANKRA2 PE=2 SV=1 526 653 3.0E-07
sp|Q2IBD4|CTTB2_RAT Cortactin-binding protein 2 OS=Rattus norvegicus GN=Cttnbp2 PE=1 SV=1 339 452 3.0E-07
sp|Q9NU02|ANKE1_HUMAN Ankyrin repeat and EF-hand domain-containing protein 1 OS=Homo sapiens GN=ANKEF1 PE=2 SV=2 500 634 3.0E-07
sp|Q07DY6|ASZ1_COLGU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Colobus guereza GN=ASZ1 PE=3 SV=1 348 490 3.0E-07
sp|Q07E17|ASZ1_MUSPF Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mustela putorius furo GN=ASZ1 PE=3 SV=1 410 568 3.0E-07
sp|Q86SG2|ANR23_HUMAN Ankyrin repeat domain-containing protein 23 OS=Homo sapiens GN=ANKRD23 PE=1 SV=1 432 605 3.0E-07
sp|A0M8S4|CTTB2_PAPAN Cortactin-binding protein 2 OS=Papio anubis GN=CTTNBP2 PE=3 SV=1 349 487 3.0E-07
sp|Q07DY4|CTTB2_COLGU Cortactin-binding protein 2 OS=Colobus guereza GN=CTTNBP2 PE=3 SV=1 349 487 3.0E-07
sp|Q9BXX3|AN30A_HUMAN Ankyrin repeat domain-containing protein 30A OS=Homo sapiens GN=ANKRD30A PE=2 SV=3 421 624 3.0E-07
sp|Q2QLG9|CTTB2_OTOGA Cortactin-binding protein 2 OS=Otolemur garnettii GN=CTTNBP2 PE=3 SV=1 401 666 3.0E-07
sp|Q865U8|ANKR1_PIG Ankyrin repeat domain-containing protein 1 OS=Sus scrofa GN=ANKRD1 PE=2 SV=1 553 683 3.0E-07
sp|Q8R560|ANKR1_RAT Ankyrin repeat domain-containing protein 1 OS=Rattus norvegicus GN=Ankrd1 PE=1 SV=1 553 683 3.0E-07
sp|O60733|PLPL9_HUMAN 85/88 kDa calcium-independent phospholipase A2 OS=Homo sapiens GN=PLA2G6 PE=1 SV=2 460 683 3.0E-07
sp|P81069|GABP2_MOUSE GA-binding protein subunit beta-2 OS=Mus musculus GN=Gabpb2 PE=1 SV=2 436 603 3.0E-07
sp|Q9TZC4|ILKH_CAEEL Integrin-linked protein kinase homolog pat-4 OS=Caenorhabditis elegans GN=pat-4 PE=1 SV=1 536 668 3.0E-07
sp|Q4P6L3|AKR1_USTMA Palmitoyltransferase AKR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=AKR1 PE=3 SV=1 348 568 3.0E-07
sp|Q9Z205|RFXK_MOUSE DNA-binding protein RFXANK OS=Mus musculus GN=Rfxank PE=2 SV=1 499 620 3.0E-07
sp|Q0VGY8|TANC1_MOUSE Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 505 683 4.0E-07
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 337 484 4.0E-07
sp|Q641X1|ANR61_RAT Ankyrin repeat domain-containing protein 61 OS=Rattus norvegicus GN=Ankrd61 PE=2 SV=1 338 479 4.0E-07
sp|Q94A76|GORK_ARATH Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 572 661 4.0E-07
sp|Q9H9E1|ANRA2_HUMAN Ankyrin repeat family A protein 2 OS=Homo sapiens GN=ANKRA2 PE=1 SV=1 425 543 4.0E-07
sp|Q2QLF8|CTTB2_CALJA Cortactin-binding protein 2 OS=Callithrix jacchus GN=CTTNBP2 PE=3 SV=1 339 452 4.0E-07
sp|Q2IBF7|CTTB2_GORGO Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 339 452 4.0E-07
sp|Q8WZ74|CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 339 452 4.0E-07
sp|Q9NU02|ANKE1_HUMAN Ankyrin repeat and EF-hand domain-containing protein 1 OS=Homo sapiens GN=ANKEF1 PE=2 SV=2 372 489 4.0E-07
sp|Q812A3|ANR23_MOUSE Ankyrin repeat domain-containing protein 23 OS=Mus musculus GN=Ankrd23 PE=2 SV=1 337 477 4.0E-07
sp|P77736|YAHD_ECOLI Putative ankyrin repeat protein YahD OS=Escherichia coli (strain K12) GN=yahD PE=3 SV=1 481 655 4.0E-07
sp|Q9NWX5|ASB6_HUMAN Ankyrin repeat and SOCS box protein 6 OS=Homo sapiens GN=ASB6 PE=1 SV=1 436 669 4.0E-07
sp|Q07E15|CTTB2_MUSPF Cortactin-binding protein 2 OS=Mustela putorius furo GN=CTTNBP2 PE=3 SV=1 339 452 4.0E-07
sp|Q2QLA4|ASZ1_HORSE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Equus caballus GN=ASZ1 PE=3 SV=1 415 568 4.0E-07
sp|Q07E43|ASZ1_DASNO Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Dasypus novemcinctus GN=ASZ1 PE=3 SV=1 410 568 4.0E-07
sp|Q54KH3|ANR39_DICDI Ankyrin repeat domain-containing protein 39 homolog OS=Dictyostelium discoideum GN=ankrd39 PE=3 SV=2 549 656 4.0E-07
sp|Q8R516|MIB2_MOUSE E3 ubiquitin-protein ligase MIB2 OS=Mus musculus GN=Mib2 PE=1 SV=2 351 541 4.0E-07
sp|Q8IVF6|AN18A_HUMAN Ankyrin repeat domain-containing protein 18A OS=Homo sapiens GN=ANKRD18A PE=2 SV=3 539 683 4.0E-07
sp|P81069|GABP2_MOUSE GA-binding protein subunit beta-2 OS=Mus musculus GN=Gabpb2 PE=1 SV=2 399 569 4.0E-07
sp|Q4UJC0|Y2042_RICFE Putative ankyrin repeat protein RF_p42/RF_pd42 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_p42 PE=3 SV=1 486 621 4.0E-07
sp|Q99728|BARD1_HUMAN BRCA1-associated RING domain protein 1 OS=Homo sapiens GN=BARD1 PE=1 SV=2 499 589 4.0E-07
sp|Q9DBR7|MYPT1_MOUSE Protein phosphatase 1 regulatory subunit 12A OS=Mus musculus GN=Ppp1r12a PE=1 SV=2 564 670 4.0E-07
sp|Q6C520|AKR1_YARLI Palmitoyltransferase AKR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=AKR1 PE=3 SV=1 339 482 4.0E-07
sp|Q10728|MYPT1_RAT Protein phosphatase 1 regulatory subunit 12A OS=Rattus norvegicus GN=Ppp1r12a PE=1 SV=2 564 670 4.0E-07
sp|O14974|MYPT1_HUMAN Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens GN=PPP1R12A PE=1 SV=1 564 670 4.0E-07
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 584 683 5.0E-07
sp|Q9C0D5|TANC1_HUMAN Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 505 683 5.0E-07
sp|P07207|NOTCH_DROME Neurogenic locus Notch protein OS=Drosophila melanogaster GN=N PE=1 SV=3 348 521 5.0E-07
sp|Q8H569|AKT3_ORYSJ Potassium channel AKT3 OS=Oryza sativa subsp. japonica GN=Os07g0175400 PE=3 SV=1 564 713 5.0E-07
sp|Q9HYV6|Y3287_PSEAE Putative ankyrin repeat protein PA3287 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA3287 PE=3 SV=1 399 518 5.0E-07
sp|Q6DD51|CSKI2_XENLA Caskin-2 OS=Xenopus laevis GN=caskin2 PE=2 SV=1 557 683 5.0E-07
sp|Q07DY6|ASZ1_COLGU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Colobus guereza GN=ASZ1 PE=3 SV=1 410 568 5.0E-07
sp|Q5R4M7|ASB6_PONAB Ankyrin repeat and SOCS box protein 6 OS=Pongo abelii GN=ASB6 PE=2 SV=1 436 669 5.0E-07
sp|Q8WMX8|ASZ1_BOVIN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Bos taurus GN=ASZ1 PE=2 SV=1 348 518 5.0E-07
sp|Q2IBG0|ASZ1_EULMM Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Eulemur macaco macaco GN=ASZ1 PE=3 SV=1 348 490 5.0E-07
sp|Q2QLH1|ASZ1_OTOGA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Otolemur garnettii GN=ASZ1 PE=3 SV=1 348 490 5.0E-07
sp|Q7ZT11|ANKR1_CHICK Ankyrin repeat domain-containing protein 1 OS=Gallus gallus GN=ANKRD1 PE=2 SV=1 532 683 5.0E-07
sp|Q0V8G2|GABP2_BOVIN GA-binding protein subunit beta-2 OS=Bos taurus GN=GABPB2 PE=2 SV=2 399 567 5.0E-07
sp|Q9SQK3|EM506_ARATH Ankyrin repeat domain-containing protein EMB506, chloroplastic OS=Arabidopsis thaliana GN=EMB506 PE=1 SV=1 512 650 5.0E-07
sp|Q09YH1|ASZ1_SAIBB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Saimiri boliviensis boliviensis GN=ASZ1 PE=3 SV=1 348 490 5.0E-07
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 338 493 6.0E-07
sp|Q5RFS1|ASB11_PONAB Ankyrin repeat and SOCS box protein 11 OS=Pongo abelii GN=ASB11 PE=2 SV=1 532 683 6.0E-07
sp|Q99PE2|ANRA2_MOUSE Ankyrin repeat family A protein 2 OS=Mus musculus GN=Ankra2 PE=1 SV=1 526 642 6.0E-07
sp|Q07DX4|CTTB2_NOMLE Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 339 452 6.0E-07
sp|Q07DZ5|CTTB2_ORNAN Cortactin-binding protein 2 OS=Ornithorhynchus anatinus GN=CTTNBP2 PE=3 SV=1 349 503 6.0E-07
sp|Q7T3P8|FEM1C_DANRE Protein fem-1 homolog C OS=Danio rerio GN=fem1c PE=2 SV=2 333 451 6.0E-07
sp|Q09YI3|ASZ1_SHEEP Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ovis aries GN=ASZ1 PE=3 SV=1 348 518 6.0E-07
sp|Q07DW4|CTTB2_MUNRE Cortactin-binding protein 2 OS=Muntiacus reevesi GN=CTTNBP2 PE=3 SV=1 339 452 6.0E-07
sp|Q9BXX3|AN30A_HUMAN Ankyrin repeat domain-containing protein 30A OS=Homo sapiens GN=ANKRD30A PE=2 SV=3 513 672 6.0E-07
sp|Q8WXH4|ASB11_HUMAN Ankyrin repeat and SOCS box protein 11 OS=Homo sapiens GN=ASB11 PE=1 SV=1 532 683 6.0E-07
sp|Q0V8G2|GABP2_BOVIN GA-binding protein subunit beta-2 OS=Bos taurus GN=GABPB2 PE=2 SV=2 481 619 6.0E-07
sp|O60237|MYPT2_HUMAN Protein phosphatase 1 regulatory subunit 12B OS=Homo sapiens GN=PPP1R12B PE=1 SV=2 569 673 6.0E-07
sp|Q4R690|ZDH13_MACFA Palmitoyltransferase ZDHHC13 OS=Macaca fascicularis GN=ZDHHC13 PE=2 SV=1 413 569 6.0E-07
sp|Q2QLG0|ASZ1_CALJA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Callithrix jacchus GN=ASZ1 PE=3 SV=1 348 490 6.0E-07
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 338 493 7.0E-07
sp|Q9H9E1|ANRA2_HUMAN Ankyrin repeat family A protein 2 OS=Homo sapiens GN=ANKRA2 PE=1 SV=1 526 653 7.0E-07
sp|A6NC57|ANR62_HUMAN Ankyrin repeat domain-containing protein 62 OS=Homo sapiens GN=ANKRD62 PE=2 SV=4 565 683 7.0E-07
sp|P77736|YAHD_ECOLI Putative ankyrin repeat protein YahD OS=Escherichia coli (strain K12) GN=yahD PE=3 SV=1 336 489 7.0E-07
sp|Q8N9B4|ANR42_HUMAN Ankyrin repeat domain-containing protein 42 OS=Homo sapiens GN=ANKRD42 PE=2 SV=2 509 689 7.0E-07
sp|Q8N9B4|ANR42_HUMAN Ankyrin repeat domain-containing protein 42 OS=Homo sapiens GN=ANKRD42 PE=2 SV=2 474 618 7.0E-07
sp|Q9QZH2|BARD1_RAT BRCA1-associated RING domain protein 1 OS=Rattus norvegicus GN=Bard1 PE=2 SV=1 499 623 7.0E-07
sp|Q9D2J7|ANKE1_MOUSE Ankyrin repeat and EF-hand domain-containing protein 1 OS=Mus musculus GN=Ankef1 PE=2 SV=1 317 486 7.0E-07
sp|Q4UJC0|Y2042_RICFE Putative ankyrin repeat protein RF_p42/RF_pd42 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_p42 PE=3 SV=1 503 654 7.0E-07
sp|Q90623|MYPT1_CHICK Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus GN=PPP1R12A PE=1 SV=1 564 670 7.0E-07
sp|Q8BG95|MYPT2_MOUSE Protein phosphatase 1 regulatory subunit 12B OS=Mus musculus GN=Ppp1r12b PE=1 SV=2 569 673 7.0E-07
sp|Q3UMR0|ANR27_MOUSE Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 528 679 8.0E-07
sp|Q59H18|TNI3K_HUMAN Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 523 683 8.0E-07
sp|B1AK53|ESPN_HUMAN Espin OS=Homo sapiens GN=ESPN PE=1 SV=1 389 595 8.0E-07
sp|Q3UYR4|ESPNL_MOUSE Espin-like protein OS=Mus musculus GN=Espnl PE=2 SV=1 349 584 8.0E-07
sp|Q2T9W8|ANR61_BOVIN Ankyrin repeat domain-containing protein 61 OS=Bos taurus GN=ANKRD61 PE=2 SV=1 336 477 8.0E-07
sp|Q5R4M7|ASB6_PONAB Ankyrin repeat and SOCS box protein 6 OS=Pongo abelii GN=ASB6 PE=2 SV=1 535 672 8.0E-07
sp|Q07DZ7|ASZ1_ORNAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ornithorhynchus anatinus GN=ASZ1 PE=3 SV=1 410 568 8.0E-07
sp|Q2QLA4|ASZ1_HORSE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Equus caballus GN=ASZ1 PE=3 SV=1 348 518 8.0E-07
sp|Q07DV3|ASZ1_AOTNA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Aotus nancymaae GN=ASZ1 PE=3 SV=1 361 490 8.0E-07
sp|Q8ZWC4|Y1861_PYRAE Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 598 694 9.0E-07
sp|Q9HYV6|Y3287_PSEAE Putative ankyrin repeat protein PA3287 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA3287 PE=3 SV=1 348 484 9.0E-07
sp|Q2T9K6|FEM1C_XENLA Protein fem-1 homolog C OS=Xenopus laevis GN=fem1c PE=2 SV=1 338 506 9.0E-07
sp|Q07DZ7|ASZ1_ORNAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ornithorhynchus anatinus GN=ASZ1 PE=3 SV=1 439 601 9.0E-07
sp|Q91ZT8|ASB9_MOUSE Ankyrin repeat and SOCS box protein 9 OS=Mus musculus GN=Asb9 PE=1 SV=2 434 635 9.0E-07
sp|Q8TAK5|GABP2_HUMAN GA-binding protein subunit beta-2 OS=Homo sapiens GN=GABPB2 PE=1 SV=1 399 551 9.0E-07
sp|Q9BZF9|UACA_HUMAN Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens GN=UACA PE=1 SV=2 343 439 9.0E-07
sp|Q90623|MYPT1_CHICK Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus GN=PPP1R12A PE=1 SV=1 531 635 9.0E-07
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 569 692 1.0E-06
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 569 692 1.0E-06
sp|Q5REW9|ANR27_PONAB Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 337 484 1.0E-06
sp|Q8N6D5|ANR29_HUMAN Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 334 498 1.0E-06
sp|Q5RF15|TNI3K_PONAB Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 543 683 1.0E-06
sp|P23631|LATA_LATTR Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 342 591 1.0E-06
sp|P0DJE3|LATA_LATHE Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 434 591 1.0E-06
sp|Q9Z148|EHMT2_MOUSE Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 348 535 1.0E-06
sp|Q4ULZ2|Y580_RICFE Putative ankyrin repeat protein RF_0580 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0580 PE=3 SV=1 342 494 1.0E-06
sp|A5PMU4|ANS1B_DANRE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 338 471 1.0E-06
sp|Q653P0|KOR1_ORYSJ Potassium channel KOR1 OS=Oryza sativa subsp. japonica GN=Os06g0250600 PE=2 SV=1 572 658 1.0E-06
sp|P20749|BCL3_HUMAN B-cell lymphoma 3 protein OS=Homo sapiens GN=BCL3 PE=1 SV=2 492 683 1.0E-06
sp|Q2IBF7|CTTB2_GORGO Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 567 684 1.0E-06
sp|Q8WZ74|CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 567 684 1.0E-06
sp|Q2IBE6|CTTB2_PONAB Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 339 452 1.0E-06
sp|Q2QLB3|CTTB2_CALMO Cortactin-binding protein 2 OS=Callicebus moloch GN=CTTNBP2 PE=3 SV=1 567 684 1.0E-06
sp|Q3ZBX7|ANKR1_BOVIN Ankyrin repeat domain-containing protein 1 OS=Bos taurus GN=ANKRD1 PE=2 SV=1 400 536 1.0E-06
sp|Q9NWX5|ASB6_HUMAN Ankyrin repeat and SOCS box protein 6 OS=Homo sapiens GN=ASB6 PE=1 SV=1 535 672 1.0E-06
sp|A2RUV0|NOTC1_XENTR Neurogenic locus notch homolog protein 1 OS=Xenopus tropicalis GN=notch1 PE=1 SV=2 349 487 1.0E-06
sp|Q09YJ5|ASZ1_MUNMU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Muntiacus muntjak GN=ASZ1 PE=3 SV=1 348 502 1.0E-06
sp|Q09YM8|CTTB2_RABIT Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 339 470 1.0E-06
sp|Q108U1|ASZ1_LOXAF Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Loxodonta africana GN=ASZ1 PE=3 SV=1 415 568 1.0E-06
sp|Q80VM7|ANR24_MOUSE Ankyrin repeat domain-containing protein 24 OS=Mus musculus GN=Ankrd24 PE=2 SV=4 358 529 1.0E-06
sp|A7E2S9|A30BL_HUMAN Putative ankyrin repeat domain-containing protein 30B-like OS=Homo sapiens GN=ANKRD30BL PE=2 SV=3 320 462 1.0E-06
sp|Q9TU71|ANKR1_RABIT Ankyrin repeat domain-containing protein 1 OS=Oryctolagus cuniculus GN=ANKRD1 PE=2 SV=1 553 683 1.0E-06
sp|Q9SQK3|EM506_ARATH Ankyrin repeat domain-containing protein EMB506, chloroplastic OS=Arabidopsis thaliana GN=EMB506 PE=1 SV=1 320 478 1.0E-06
sp|Q9SQK3|EM506_ARATH Ankyrin repeat domain-containing protein EMB506, chloroplastic OS=Arabidopsis thaliana GN=EMB506 PE=1 SV=1 380 518 1.0E-06
sp|Q4P6L3|AKR1_USTMA Palmitoyltransferase AKR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=AKR1 PE=3 SV=1 350 486 1.0E-06
sp|A0JNU3|LPP60_MOUSE 60 kDa lysophospholipase OS=Mus musculus GN=Aspg PE=1 SV=1 612 690 1.0E-06
sp|Q6F6B3|TANC1_RAT Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 505 658 2.0E-06
sp|Q3UMR0|ANR27_MOUSE Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 427 656 2.0E-06
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 593 672 2.0E-06
sp|Q9Z148|EHMT2_MOUSE Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 363 568 2.0E-06
sp|A6NK59|ASB14_HUMAN Ankyrin repeat and SOCS box protein 14 OS=Homo sapiens GN=ASB14 PE=2 SV=2 541 688 2.0E-06
sp|Q8N283|ANR35_HUMAN Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 569 672 2.0E-06
sp|Q862Z2|ASB5_RABIT Ankyrin repeat and SOCS box protein 5 OS=Oryctolagus cuniculus GN=ASB5 PE=2 SV=1 554 662 2.0E-06
sp|Q5UPG0|YL086_MIMIV Putative ankyrin repeat protein L86 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L86 PE=3 SV=1 511 670 2.0E-06
sp|Q8IUH5|ZDH17_HUMAN Palmitoyltransferase ZDHHC17 OS=Homo sapiens GN=ZDHHC17 PE=1 SV=2 336 529 2.0E-06
sp|Q8CEF1|FEM1C_MOUSE Protein fem-1 homolog C OS=Mus musculus GN=Fem1c PE=2 SV=1 528 600 2.0E-06
sp|Q09701|AKR1_SCHPO Palmitoyltransferase akr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=akr1 PE=3 SV=1 353 523 2.0E-06
sp|Q6DD51|CSKI2_XENLA Caskin-2 OS=Xenopus laevis GN=caskin2 PE=2 SV=1 524 683 2.0E-06
sp|Q2QLF8|CTTB2_CALJA Cortactin-binding protein 2 OS=Callithrix jacchus GN=CTTNBP2 PE=3 SV=1 567 684 2.0E-06
sp|Q9NU02|ANKE1_HUMAN Ankyrin repeat and EF-hand domain-containing protein 1 OS=Homo sapiens GN=ANKEF1 PE=2 SV=2 343 502 2.0E-06
sp|Q6S8J7|POTEA_HUMAN POTE ankyrin domain family member A OS=Homo sapiens GN=POTEA PE=2 SV=1 351 467 2.0E-06
sp|Q07DX4|CTTB2_NOMLE Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 567 684 2.0E-06
sp|Q09YJ5|ASZ1_MUNMU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Muntiacus muntjak GN=ASZ1 PE=3 SV=1 415 568 2.0E-06
sp|Q4KL97|ANKR1_XENLA Ankyrin repeat domain-containing protein 1 OS=Xenopus laevis GN=ankrd1 PE=2 SV=1 433 635 2.0E-06
sp|Q2IBA2|CTTB2_CHLAE Cortactin-binding protein 2 OS=Chlorocebus aethiops GN=CTTNBP2 PE=3 SV=1 567 686 2.0E-06
sp|A0M8S4|CTTB2_PAPAN Cortactin-binding protein 2 OS=Papio anubis GN=CTTNBP2 PE=3 SV=1 567 686 2.0E-06
sp|Q07DY4|CTTB2_COLGU Cortactin-binding protein 2 OS=Colobus guereza GN=CTTNBP2 PE=3 SV=1 567 686 2.0E-06
sp|Q96T49|PP16B_HUMAN Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Homo sapiens GN=PPP1R16B PE=1 SV=1 569 664 2.0E-06
sp|Q95N27|PP16B_BOVIN Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Bos taurus GN=PPP1R16B PE=1 SV=1 569 664 2.0E-06
sp|Q9GL21|UACA_CANLF Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Canis lupus familiaris GN=UACA PE=2 SV=2 543 673 2.0E-06
sp|P97570|PLPL9_RAT 85/88 kDa calcium-independent phospholipase A2 OS=Rattus norvegicus GN=Pla2g6 PE=1 SV=2 361 598 2.0E-06
sp|Q4I8B6|AKR1_GIBZE Palmitoyltransferase AKR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=AKR1 PE=3 SV=1 407 623 2.0E-06
sp|Q09YK6|ASZ1_ATEGE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ateles geoffroyi GN=ASZ1 PE=3 SV=1 410 568 2.0E-06
sp|O70445|BARD1_MOUSE BRCA1-associated RING domain protein 1 OS=Mus musculus GN=Bard1 PE=2 SV=1 585 683 2.0E-06
sp|Q38898|AKT2_ARATH Potassium channel AKT2/3 OS=Arabidopsis thaliana GN=AKT2 PE=1 SV=1 520 683 2.0E-06
sp|Q96NS5|ASB16_HUMAN Ankyrin repeat and SOCS box protein 16 OS=Homo sapiens GN=ASB16 PE=1 SV=2 336 557 2.0E-06
sp|Q3UMR0|ANR27_MOUSE Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 593 672 3.0E-06
sp|P0C927|ASB14_RAT Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 568 683 3.0E-06
sp|Q4ULZ2|Y580_RICFE Putative ankyrin repeat protein RF_0580 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0580 PE=3 SV=1 338 491 3.0E-06
sp|Q9BXX2|AN30B_HUMAN Ankyrin repeat domain-containing protein 30B OS=Homo sapiens GN=ANKRD30B PE=2 SV=3 325 491 3.0E-06
sp|P0C6P7|FEM1B_RAT Protein fem-1 homolog B OS=Rattus norvegicus GN=Fem1b PE=1 SV=1 339 495 3.0E-06
sp|Q9Z2G0|FEM1B_MOUSE Protein fem-1 homolog B OS=Mus musculus GN=Fem1b PE=1 SV=1 339 495 3.0E-06
sp|Q9UK73|FEM1B_HUMAN Protein fem-1 homolog B OS=Homo sapiens GN=FEM1B PE=1 SV=1 339 495 3.0E-06
sp|Q96DX5|ASB9_HUMAN Ankyrin repeat and SOCS box protein 9 OS=Homo sapiens GN=ASB9 PE=1 SV=1 336 471 3.0E-06
sp|P17221|FEM1_CAEEL Sex-determining protein fem-1 OS=Caenorhabditis elegans GN=fem-1 PE=1 SV=1 339 489 3.0E-06
sp|Q8CEF1|FEM1C_MOUSE Protein fem-1 homolog C OS=Mus musculus GN=Fem1c PE=2 SV=1 338 522 3.0E-06
sp|Q96JP0|FEM1C_HUMAN Protein fem-1 homolog C OS=Homo sapiens GN=FEM1C PE=1 SV=1 528 600 3.0E-06
sp|Q96JP0|FEM1C_HUMAN Protein fem-1 homolog C OS=Homo sapiens GN=FEM1C PE=1 SV=1 338 522 3.0E-06
sp|A7MB89|FEM1C_BOVIN Protein fem-1 homolog C OS=Bos taurus GN=FEM1C PE=2 SV=1 528 600 3.0E-06
sp|A7MB89|FEM1C_BOVIN Protein fem-1 homolog C OS=Bos taurus GN=FEM1C PE=2 SV=1 338 522 3.0E-06
sp|Q2IBE6|CTTB2_PONAB Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 567 684 3.0E-06
sp|Q2QL82|CTTB2_MICMU Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 567 684 3.0E-06
sp|Q8WMX8|ASZ1_BOVIN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Bos taurus GN=ASZ1 PE=2 SV=1 415 568 3.0E-06
sp|Q09YI3|ASZ1_SHEEP Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ovis aries GN=ASZ1 PE=3 SV=1 415 568 3.0E-06
sp|Q2QL84|ASZ1_MICMU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Microcebus murinus GN=ASZ1 PE=3 SV=1 415 568 3.0E-06
sp|Q4KL97|ANKR1_XENLA Ankyrin repeat domain-containing protein 1 OS=Xenopus laevis GN=ankrd1 PE=2 SV=1 348 479 3.0E-06
sp|Q5UR87|YR634_MIMIV Putative ankyrin repeat protein R634 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R634 PE=3 SV=1 410 660 3.0E-06
sp|Q2QLG9|CTTB2_OTOGA Cortactin-binding protein 2 OS=Otolemur garnettii GN=CTTNBP2 PE=3 SV=1 567 684 3.0E-06
sp|Q8VHA6|ASB18_MOUSE Ankyrin repeat and SOCS box protein 18 OS=Mus musculus GN=Asb18 PE=2 SV=1 467 673 3.0E-06
sp|Q9D2J7|ANKE1_MOUSE Ankyrin repeat and EF-hand domain-containing protein 1 OS=Mus musculus GN=Ankef1 PE=2 SV=1 438 556 3.0E-06
sp|Q8VHQ3|PP16B_MOUSE Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Mus musculus GN=Ppp1r16b PE=1 SV=1 569 664 3.0E-06
sp|Q6DRG7|MYPT1_DANRE Protein phosphatase 1 regulatory subunit 12A OS=Danio rerio GN=ppp1r12a PE=2 SV=2 569 670 3.0E-06
sp|Q8WXI3|ASB10_HUMAN Ankyrin repeat and SOCS box protein 10 OS=Homo sapiens GN=ASB10 PE=1 SV=2 361 556 3.0E-06
sp|Q3UMR0|ANR27_MOUSE Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 561 695 4.0E-06
sp|Q09YK4|CTTB2_ATEGE Cortactin-binding protein 2 OS=Ateles geoffroyi GN=CTTNBP2 PE=3 SV=1 339 452 4.0E-06
sp|Q80TN5|ZDH17_MOUSE Palmitoyltransferase ZDHHC17 OS=Mus musculus GN=Zdhhc17 PE=1 SV=2 336 586 4.0E-06
sp|Q4X251|AKR1_ASPFU Palmitoyltransferase akr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=akr1 PE=3 SV=2 344 505 4.0E-06
sp|Q2KI79|ANRA2_BOVIN Ankyrin repeat family A protein 2 OS=Bos taurus GN=ANKRA2 PE=2 SV=1 499 590 4.0E-06
sp|Q09YG9|CTTB2_SAIBB Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 567 684 4.0E-06
sp|Q07DZ5|CTTB2_ORNAN Cortactin-binding protein 2 OS=Ornithorhynchus anatinus GN=CTTNBP2 PE=3 SV=1 339 465 4.0E-06
sp|Q7Z8U2|AKR1_ASPOR Palmitoyltransferase akr1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=akr1 PE=3 SV=2 348 502 4.0E-06
sp|Q86SG2|ANR23_HUMAN Ankyrin repeat domain-containing protein 23 OS=Homo sapiens GN=ANKRD23 PE=1 SV=1 566 675 4.0E-06
sp|Q8WXE0|CSKI2_HUMAN Caskin-2 OS=Homo sapiens GN=CASKIN2 PE=1 SV=2 557 683 4.0E-06
sp|Q8HYY4|UACA_BOVIN Uveal autoantigen with coiled-coil domains and ankyrin repeats protein OS=Bos taurus GN=UACA PE=1 SV=1 338 465 4.0E-06
sp|P0CS66|AKR1_CRYNJ Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=AKR1 PE=3 SV=1 344 476 4.0E-06
sp|P0CS67|AKR1_CRYNB Palmitoyltransferase AKR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=AKR1 PE=3 SV=1 344 476 4.0E-06
sp|Q9BZF9|UACA_HUMAN Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens GN=UACA PE=1 SV=2 338 465 4.0E-06
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 354 491 5.0E-06
sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 362 685 5.0E-06
sp|P0DJE3|LATA_LATHE Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 494 685 5.0E-06
sp|Q8ZWC4|Y1861_PYRAE Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 337 456 5.0E-06
sp|Q502M6|ANR29_DANRE Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 338 535 5.0E-06
sp|Q9BXX2|AN30B_HUMAN Ankyrin repeat domain-containing protein 30B OS=Homo sapiens GN=ANKRD30B PE=2 SV=3 520 685 5.0E-06
sp|Q38998|AKT1_ARATH Potassium channel AKT1 OS=Arabidopsis thaliana GN=AKT1 PE=1 SV=2 348 502 5.0E-06
sp|Q09YK4|CTTB2_ATEGE Cortactin-binding protein 2 OS=Ateles geoffroyi GN=CTTNBP2 PE=3 SV=1 567 684 5.0E-06
sp|Q99PE2|ANRA2_MOUSE Ankyrin repeat family A protein 2 OS=Mus musculus GN=Ankra2 PE=1 SV=1 499 590 5.0E-06
sp|Q07DV1|CTTB2_AOTNA Cortactin-binding protein 2 OS=Aotus nancymaae GN=CTTNBP2 PE=3 SV=1 567 684 5.0E-06
sp|Q1RMI3|GABP1_BOVIN GA-binding protein subunit beta-1 OS=Bos taurus GN=GABPB1 PE=2 SV=1 365 495 5.0E-06
sp|Q06547|GABP1_HUMAN GA-binding protein subunit beta-1 OS=Homo sapiens GN=GABPB1 PE=1 SV=2 365 495 5.0E-06
sp|Q2IBA2|CTTB2_CHLAE Cortactin-binding protein 2 OS=Chlorocebus aethiops GN=CTTNBP2 PE=3 SV=1 339 452 5.0E-06
sp|A0M8S4|CTTB2_PAPAN Cortactin-binding protein 2 OS=Papio anubis GN=CTTNBP2 PE=3 SV=1 339 452 5.0E-06
sp|Q96T49|PP16B_HUMAN Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Homo sapiens GN=PPP1R16B PE=1 SV=1 342 646 5.0E-06
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 560 683 6.0E-06
sp|Q5REW9|ANR27_PONAB Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 593 672 6.0E-06
sp|Q5U312|RAI14_RAT Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 556 671 6.0E-06
sp|Q18297|TRPA1_CAEEL Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans GN=trpa-1 PE=2 SV=5 352 569 6.0E-06
sp|E9PTT0|ZDH17_RAT Palmitoyltransferase ZDHHC17 OS=Rattus norvegicus GN=Zdhhc17 PE=1 SV=1 336 529 6.0E-06
sp|Q2IBG0|ASZ1_EULMM Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Eulemur macaco macaco GN=ASZ1 PE=3 SV=1 415 568 6.0E-06
sp|Q07DY4|CTTB2_COLGU Cortactin-binding protein 2 OS=Colobus guereza GN=CTTNBP2 PE=3 SV=1 339 452 6.0E-06
sp|A1X157|CTTB2_ECHTE Cortactin-binding protein 2 OS=Echinops telfairi GN=CTTNBP2 PE=3 SV=1 567 684 6.0E-06
sp|Q69ZU8|ANKR6_MOUSE Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 304 469 6.0E-06
sp|Q9GL21|UACA_CANLF Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Canis lupus familiaris GN=UACA PE=2 SV=2 338 465 6.0E-06
sp|Q99728|BARD1_HUMAN BRCA1-associated RING domain protein 1 OS=Homo sapiens GN=BARD1 PE=1 SV=2 594 683 6.0E-06
sp|Q9DBR7|MYPT1_MOUSE Protein phosphatase 1 regulatory subunit 12A OS=Mus musculus GN=Ppp1r12a PE=1 SV=2 531 635 6.0E-06
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 325 468 7.0E-06
sp|Q9Y575|ASB3_HUMAN Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 572 683 7.0E-06
sp|O75832|PSD10_HUMAN 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 339 471 7.0E-06
sp|Q8VBX0|ASB13_MOUSE Ankyrin repeat and SOCS box protein 13 OS=Mus musculus GN=Asb13 PE=2 SV=1 334 468 7.0E-06
sp|Q07DZ5|CTTB2_ORNAN Cortactin-binding protein 2 OS=Ornithorhynchus anatinus GN=CTTNBP2 PE=3 SV=1 362 620 7.0E-06
sp|Q5B0V6|AKR1_EMENI Palmitoyltransferase akr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=akr1 PE=3 SV=2 358 559 7.0E-06
sp|Q10728|MYPT1_RAT Protein phosphatase 1 regulatory subunit 12A OS=Rattus norvegicus GN=Ppp1r12a PE=1 SV=2 531 635 7.0E-06
sp|O14974|MYPT1_HUMAN Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens GN=PPP1R12A PE=1 SV=1 531 635 7.0E-06
sp|Q2IBB2|CTTB2_RHIFE Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 543 684 8.0E-06
sp|Q09YI1|CTTB2_SHEEP Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 567 684 8.0E-06
sp|Q108T9|CTTB2_LOXAF Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 567 684 8.0E-06
sp|Q9CWU2|ZDH13_MOUSE Palmitoyltransferase ZDHHC13 OS=Mus musculus GN=Zdhhc13 PE=1 SV=2 336 541 8.0E-06
sp|Q4UKJ3|Y1087_RICFE Putative ankyrin repeat protein RF_1087 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_1087 PE=3 SV=1 398 493 8.0E-06
sp|Q5REW9|ANR27_PONAB Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 561 694 9.0E-06
sp|Q9EP71|RAI14_MOUSE Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 547 672 9.0E-06
sp|Q9NU02|ANKE1_HUMAN Ankyrin repeat and EF-hand domain-containing protein 1 OS=Homo sapiens GN=ANKEF1 PE=2 SV=2 339 543 9.0E-06
sp|Q5ZM55|FEM1B_CHICK Protein fem-1 homolog B OS=Gallus gallus GN=FEM1B PE=2 SV=1 339 488 9.0E-06
sp|Q09YJ3|CTTB2_MUNMU Cortactin-binding protein 2 OS=Muntiacus muntjak GN=CTTNBP2 PE=3 SV=1 567 684 9.0E-06
sp|P40480|HOS4_YEAST Protein HOS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOS4 PE=1 SV=1 528 633 9.0E-06
sp|Q3TPE9|ANKY2_MOUSE Ankyrin repeat and MYND domain-containing protein 2 OS=Mus musculus GN=Ankmy2 PE=1 SV=1 583 671 9.0E-06
sp|Q9TXQ1|TNKS1_CAEEL Tankyrase-like protein OS=Caenorhabditis elegans GN=tank-1 PE=2 SV=1 563 689 9.0E-06
sp|Q00420|GABP1_MOUSE GA-binding protein subunit beta-1 OS=Mus musculus GN=Gabpb1 PE=1 SV=2 365 495 1.0E-05
sp|Q05753|AKRP_ARATH Ankyrin repeat domain-containing protein, chloroplastic OS=Arabidopsis thaliana GN=AKRP PE=1 SV=2 568 683 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11144
MDRIEVYLVTTSLNHRVRTEIFQKSSGIFLWVVLVLDILNSEDAHGTDRIQKMRERLKEMPPKLNGLSASNGSSS
PPACFIRRSFISLSSWAVTGSAQVSGIETTWDSATMENSVRSYTKGLAEVTRNQARQVQVIHESVRDFLLGKYGT
QWAPVSANLVGHCHDLLRNSCLSQITNWADSRPTMPAPGYEISASVSKDEKLNAIRHEYPFLGYAVSHLLRHWVH
ASNLFERFAIRRYSKSVGLLHTCAERNLADLSRIHPERNHCFGLVGKRYGATILAAQARGSREAVFALVNAQVET
TSPTCLLRELCEEYCKDWRQSWPHRRDLNLSRRARTIYGFEDAVRIPLDRGADMEARDHQGLSPLLFAILPGHEA
TVRVLLDRGANIEARDSGAVTGNGRTLLWLCAEQGPGDAIKALLDRGADIGAKNNEGQSPLFFAVQSGREALVGI
LLDRGADIEARDSTGRSPLSIPIELQREAILKLLLEHGADVSSRALVNGQTPLSRAIGIRTIEMVKLLLKHGADA
NCRDHNDLTPLFRAVEIGTTEMVKLLLKYGADANFRDHNDLTPLLRAAVRGATDIAELLLKRGADFDSRDHHDQT
PLSRAAVEGSTDMVELLLEHGADINPREYRGQTPLLRAAAAGTTETVKLLLEHGADVSSRDCDGRTSLSFAVEGR
RVGIARMLERAEHQLENALPHPRRMLMVSTNSETTVGKEDPVEGERSYNTMQATRDKAIVEYKTPTVHVVPEHLN
CVDAAYQPKK*
Coding >Hirsu2|11144
ATGGACCGGATAGAGGTTTACCTTGTCACGACAAGCCTAAACCATCGAGTGCGGACTGAGATCTTCCAAAAATCC
TCCGGCATCTTCCTCTGGGTAGTCCTGGTTCTGGACATCCTGAACTCTGAAGATGCGCATGGAACAGACCGCATC
CAGAAGATGCGCGAGCGGCTGAAGGAGATGCCGCCCAAGCTGAACGGACTCTCTGCCTCCAATGGATCCTCTTCG
CCACCCGCCTGCTTCATCCGGAGGAGCTTTATTTCGCTGTCGAGCTGGGCTGTTACCGGGAGTGCTCAGGTTTCT
GGGATCGAGACGACTTGGGATTCGGCCACCATGGAGAACTCTGTCAGGAGCTACACCAAAGGCCTGGCCGAGGTT
ACGCGGAATCAGGCTCGACAGGTTCAGGTTATCCATGAATCCGTCCGCGACTTCTTGCTGGGCAAATACGGGACT
CAGTGGGCTCCTGTTTCCGCAAACTTGGTTGGCCACTGCCACGACTTGTTGAGGAACAGCTGCTTAAGCCAGATT
ACCAACTGGGCGGATTCACGCCCTACGATGCCTGCGCCGGGGTACGAAATATCAGCCTCCGTGTCAAAGGACGAG
AAGTTGAATGCGATTCGGCACGAATATCCGTTTCTCGGATATGCCGTTTCTCATCTTCTTCGACACTGGGTGCAT
GCCAGCAATCTGTTCGAACGTTTCGCCATTCGGCGATACTCCAAATCGGTCGGTCTCCTTCACACATGTGCTGAG
AGGAACCTGGCCGATCTCAGTCGCATCCACCCCGAGCGAAACCACTGCTTCGGCCTTGTCGGAAAGCGCTATGGT
GCGACCATTCTCGCGGCGCAGGCCAGAGGCAGTCGTGAGGCAGTATTCGCACTCGTGAACGCCCAGGTAGAGACG
ACCTCGCCGACGTGTCTGCTCCGTGAGCTGTGTGAAGAATACTGCAAAGACTGGAGACAGTCGTGGCCACACAGA
CGCGACTTGAATCTCTCGCGACGAGCGAGAACTATCTATGGATTCGAGGACGCAGTCAGGATACCACTCGATCGA
GGTGCCGATATGGAGGCAAGGGACCACCAGGGCCTCAGTCCACTTCTCTTCGCCATTCTTCCAGGGCACGAGGCT
ACGGTCAGGGTCCTTCTCGATCGAGGCGCCAATATCGAGGCAAGGGACTCGGGGGCTGTGACCGGCAACGGCCGC
ACGCTGTTATGGCTGTGCGCTGAGCAGGGACCTGGGGACGCCATCAAGGCACTTCTCGATCGAGGCGCAGATATC
GGGGCGAAGAATAACGAGGGCCAGAGCCCGCTTTTCTTCGCTGTACAGTCAGGGCGCGAGGCTTTAGTCGGGATC
CTTCTCGATCGAGGCGCTGACATCGAGGCAAGGGATTCAACAGGCCGGAGTCCACTCTCCATCCCTATTGAGCTA
CAGAGGGAGGCCATATTAAAGCTGCTCCTCGAGCACGGAGCAGATGTCAGTTCCAGAGCTCTTGTTAATGGGCAG
ACGCCGCTTTCACGGGCGATAGGAATAAGAACCATAGAGATGGTTAAGCTACTCCTTAAGCATGGAGCAGATGCC
AATTGCAGAGATCATAACGACCTAACGCCGCTTTTTCGGGCGGTAGAAATAGGAACCACAGAGATGGTTAAGCTA
CTCCTTAAGTATGGAGCAGATGCCAATTTCAGAGATCACAACGACCTAACGCCGCTTTTACGGGCGGCGGTAAGA
GGAGCCACCGATATAGCCGAGCTACTACTTAAGCGTGGAGCAGATTTCGATTCTAGAGATCACCACGACCAGACG
CCGCTTTCACGGGCGGCAGTAGAAGGATCCACAGATATGGTCGAGCTACTCCTCGAGCACGGAGCGGATATCAAT
CCCAGAGAGTATCGTGGGCAGACGCCGCTTTTGCGGGCGGCAGCTGCAGGAACTACAGAGACAGTCAAGCTGCTC
CTCGAGCACGGAGCAGATGTCAGTTCCAGAGATTGTGATGGCCGGACGTCGCTCTCGTTTGCAGTCGAGGGCAGG
CGCGTGGGCATTGCGAGGATGCTGGAACGGGCCGAGCACCAACTTGAAAACGCCCTCCCGCACCCCAGACGGATG
CTCATGGTGTCGACAAACTCGGAGACGACGGTTGGAAAAGAGGACCCTGTAGAGGGAGAGCGGTCGTACAACACG
ATGCAAGCCACTCGAGACAAGGCGATTGTCGAATACAAGACGCCGACTGTTCATGTGGTTCCTGAACATTTAAAC
TGCGTAGACGCTGCTTATCAGCCGAAGAAATGA
Transcript >Hirsu2|11144
ATGGACCGGATAGAGGTTTACCTTGTCACGACAAGCCTAAACCATCGAGTGCGGACTGAGATCTTCCAAAAATCC
TCCGGCATCTTCCTCTGGGTAGTCCTGGTTCTGGACATCCTGAACTCTGAAGATGCGCATGGAACAGACCGCATC
CAGAAGATGCGCGAGCGGCTGAAGGAGATGCCGCCCAAGCTGAACGGACTCTCTGCCTCCAATGGATCCTCTTCG
CCACCCGCCTGCTTCATCCGGAGGAGCTTTATTTCGCTGTCGAGCTGGGCTGTTACCGGGAGTGCTCAGGTTTCT
GGGATCGAGACGACTTGGGATTCGGCCACCATGGAGAACTCTGTCAGGAGCTACACCAAAGGCCTGGCCGAGGTT
ACGCGGAATCAGGCTCGACAGGTTCAGGTTATCCATGAATCCGTCCGCGACTTCTTGCTGGGCAAATACGGGACT
CAGTGGGCTCCTGTTTCCGCAAACTTGGTTGGCCACTGCCACGACTTGTTGAGGAACAGCTGCTTAAGCCAGATT
ACCAACTGGGCGGATTCACGCCCTACGATGCCTGCGCCGGGGTACGAAATATCAGCCTCCGTGTCAAAGGACGAG
AAGTTGAATGCGATTCGGCACGAATATCCGTTTCTCGGATATGCCGTTTCTCATCTTCTTCGACACTGGGTGCAT
GCCAGCAATCTGTTCGAACGTTTCGCCATTCGGCGATACTCCAAATCGGTCGGTCTCCTTCACACATGTGCTGAG
AGGAACCTGGCCGATCTCAGTCGCATCCACCCCGAGCGAAACCACTGCTTCGGCCTTGTCGGAAAGCGCTATGGT
GCGACCATTCTCGCGGCGCAGGCCAGAGGCAGTCGTGAGGCAGTATTCGCACTCGTGAACGCCCAGGTAGAGACG
ACCTCGCCGACGTGTCTGCTCCGTGAGCTGTGTGAAGAATACTGCAAAGACTGGAGACAGTCGTGGCCACACAGA
CGCGACTTGAATCTCTCGCGACGAGCGAGAACTATCTATGGATTCGAGGACGCAGTCAGGATACCACTCGATCGA
GGTGCCGATATGGAGGCAAGGGACCACCAGGGCCTCAGTCCACTTCTCTTCGCCATTCTTCCAGGGCACGAGGCT
ACGGTCAGGGTCCTTCTCGATCGAGGCGCCAATATCGAGGCAAGGGACTCGGGGGCTGTGACCGGCAACGGCCGC
ACGCTGTTATGGCTGTGCGCTGAGCAGGGACCTGGGGACGCCATCAAGGCACTTCTCGATCGAGGCGCAGATATC
GGGGCGAAGAATAACGAGGGCCAGAGCCCGCTTTTCTTCGCTGTACAGTCAGGGCGCGAGGCTTTAGTCGGGATC
CTTCTCGATCGAGGCGCTGACATCGAGGCAAGGGATTCAACAGGCCGGAGTCCACTCTCCATCCCTATTGAGCTA
CAGAGGGAGGCCATATTAAAGCTGCTCCTCGAGCACGGAGCAGATGTCAGTTCCAGAGCTCTTGTTAATGGGCAG
ACGCCGCTTTCACGGGCGATAGGAATAAGAACCATAGAGATGGTTAAGCTACTCCTTAAGCATGGAGCAGATGCC
AATTGCAGAGATCATAACGACCTAACGCCGCTTTTTCGGGCGGTAGAAATAGGAACCACAGAGATGGTTAAGCTA
CTCCTTAAGTATGGAGCAGATGCCAATTTCAGAGATCACAACGACCTAACGCCGCTTTTACGGGCGGCGGTAAGA
GGAGCCACCGATATAGCCGAGCTACTACTTAAGCGTGGAGCAGATTTCGATTCTAGAGATCACCACGACCAGACG
CCGCTTTCACGGGCGGCAGTAGAAGGATCCACAGATATGGTCGAGCTACTCCTCGAGCACGGAGCGGATATCAAT
CCCAGAGAGTATCGTGGGCAGACGCCGCTTTTGCGGGCGGCAGCTGCAGGAACTACAGAGACAGTCAAGCTGCTC
CTCGAGCACGGAGCAGATGTCAGTTCCAGAGATTGTGATGGCCGGACGTCGCTCTCGTTTGCAGTCGAGGGCAGG
CGCGTGGGCATTGCGAGGATGCTGGAACGGGCCGAGCACCAACTTGAAAACGCCCTCCCGCACCCCAGACGGATG
CTCATGGTGTCGACAAACTCGGAGACGACGGTTGGAAAAGAGGACCCTGTAGAGGGAGAGCGGTCGTACAACACG
ATGCAAGCCACTCGAGACAAGGCGATTGTCGAATACAAGACGCCGACTGTTCATGTGGTTCCTGAACATTTAAAC
TGCGTAGACGCTGCTTATCAGCCGAAGAAATGA
Gene >Hirsu2|11144
ATGGACCGGATAGAGGTTTACCTTGTCACGACAAGCCTAAACCATCGAGTGCGGACTGAGATCTTCCAAAAATCC
TCCGGCATCTTCCTCTGGGTAGTCCTGGTTCTGGACATCCTGAACTCTGAAGATGCGCATGGAACAGACCGCATC
CAGAAGATGCGCGAGCGGCTGAAGGAGATGCCGCCCAAGCTGAACGGACTGTTCGAGATGATTCTGCACCGAGAC
GGAGAGAATCTCGATCGGCTGCAGCTCTGCCTCCAATGGATCCTCTTCGCCACCCGCCTGCTTCATCCGGAGGAG
CTTTATTTCGCTGTCGAGCTGGGCTGTTACCGGGAGTGCTCAGGTTTCTGGGATCGAGACGACTTGGGATTCGGC
CACCATGGAGAACTCTGTCAGGAGCTACACCAAAGGCCTGGCCGAGGTTACGCGGAATCAGGCTCGACAGGTTCA
GGTTATCCATGAATCCGTCCGCGACTTCTTGCTGGGCAAATACGGGACTCAGTGGGCTCCTGTTTCCGCAAACTT
GGTTGGCCACTGCCACGACTTGTTGAGGAACAGCTGCTTAAGCCAGATTACCAACTGGGCGGATTCACGCCCTAC
GATGCCTGCGCCGGGGTACGAAATATCAGCCTCCGTGTCAAAGGACGAGAAGTTGAATGCGATTCGGCACGAATA
TCCGTTTCTCGGATATGCCGTTTCTCATCTTCTTCGACACGTGAATGATGCGTAGCGGAATGGCGTCGAGCAGGC
ATTGTTCCTTGCCGACTTCCCGCTGGCTTAGTGGGTGCATGCCAGCAATCTGTTCGAACGTTTCGCCATTCGGCG
ATACTCCAAATCGGTCGGTCTCCTTCACACATGTGCTGAGAGGAACCTGGCCGATCTCAGTCGCATCCACCCCGA
GCGAAACCACTGCTTCGGCCTTGTCGGAAAGCGCTATGGTGCGACCATTCTCGCGGCGCAGGCCAGAGGCAGTCG
TGAGGCAGTATTCGCACTCGTGAACGCCCAGGTAGAGACGACCTCGCCGACGTGTCTGCTCCGTGAGCTGTGTGA
AGAATACTGCAAAGACTGGAGACAGTCGTGGCCACACAGACGCGACTTGAATCTCTCGCGACGAGCGAGAACTAT
CTATGTACCATTACCTCCGCTCTCTCGCGTTTCGGGGCCATGAATTACTTTTCCTAGTGTTTCTGGTTGCCTGCC
ACAGGACGAATACGAGGCCCTATCCGCTGGTTACGGCTGGTGAGGAGCTCGAATGTAGCACTCTTTCCGAGCTGC
TTCTCGGTGATGGTGTCGACATCAACATGAATTCTGCAGACGAATCGGGTCGAACTTTGCTATCGCGGGCGGTCG
AGCTGAACGTGGGCGTTTTGGTCAATCTGCTTGTTCAAAAAGGGGCTCGTTCCGACTGGAGGGATAAAAAGGGAG
TTGAGTTACTAGCACGAGCTGCTGCCAAACACGAAGGGCTCACTCAGTCTTAGACAGCTTCTGGATCAGGTCACC
GACATTGGGGCTAGGGTAACCGGCAACGGCCGCACTCTATTATCACTACGCGCTGAATAGGGATTCGAGGACGCA
GTCAGGATACCACTCGATCGAGGTGCCGATATGGAGGCAAGGGACCACCAGGGCCTCAGTCCACTTCTCTTCGCC
ATTCTTCCAGGGCACGAGGCTACGGTCAGGGTCCTTCTCGATCGAGGCGCCAATATCGAGGCAAGGGACTCGGGG
GCTGTGACCGGCAACGGCCGCACGCTGTTATGGCTGTGCGCTGAGCAGGGACCTGGGGACGCCATCAAGGCACTT
CTCGATCGAGGCGCAGATATCGGGGCGAAGAATAACGAGGGCCAGAGCCCGCTTTTCTTCGCTGTACAGTCAGGG
CGCGAGGCTTTAGTCGGGATCCTTCTCGATCGAGGCGCTGACATCGAGGCAAGGGATTCAACAGGCCGGAGTCCA
CTCTCCATCCCTATTGAGCTACAGAGGGAGGCCATATTAAAGCTGCTCCTCGAGCACGGAGCAGATGTCAGTTCC
AGAGCTCTTGTTAATGGGCAGACGCCGCTTTCACGGGCGATAGGAATAAGAACCATAGAGATGGTTAAGCTACTC
CTTAAGCATGGAGCAGATGCCAATTGCAGAGATCATAACGACCTAACGCCGCTTTTTCGGGCGGTAGAAATAGGA
ACCACAGAGATGGTTAAGCTACTCCTTAAGTATGGAGCAGATGCCAATTTCAGAGATCACAACGACCTAACGCCG
CTTTTACGGGCGGCGGTAAGAGGAGCCACCGATATAGCCGAGCTACTACTTAAGCGTGGAGCAGATTTCGATTCT
AGAGATCACCACGACCAGACGCCGCTTTCACGGGCGGCAGTAGAAGGATCCACAGATATGGTCGAGCTACTCCTC
GAGCACGGAGCGGATATCAATCCCAGAGAGTATCGTGGGCAGACGCCGCTTTTGCGGGCGGCAGCTGCAGGAACT
ACAGAGACAGTCAAGCTGCTCCTCGAGCACGGAGCAGATGTCAGTTCCAGAGATTGTGATGGCCGGACGTCGCTC
TCGTTTGCAGTCGAGGGCAGGCGCGTGGGCATTGCGAGGATGCTGGAACGGGCCGAGCACCAACTTGAAAACGCC
CTCCCGCACCCCAGACGGATGCTCATGGTGTCGACAAACTCGGAGACGACGGTTGGAAAAGAGGACCCTGTAGAG
GGAGAGCGGTCGTACAACACGATGCAAGCCACTCGAGACAAGGCGATTGTCGAATACAAGACGCCGACTGTTCAT
GTGGTTCCTGAACATTTAAACTGCGTAGACGCTGCTTATCAGCCGAAGAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail