Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11134
Gene name
LocationContig_97:15687..18137
Strand+
Gene length (bp)2450
Transcript length (bp)2241
Coding sequence length (bp)2241
Protein length (aa) 747

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07732 Cu-oxidase_3 Multicopper oxidase 1.3E-38 136 260
PF00394 Cu-oxidase Multicopper oxidase 3.9E-36 270 427
PF07731 Cu-oxidase_2 Multicopper oxidase 1.6E-30 593 712

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q96WM9|LAC2_BOTFU Laccase-2 OS=Botryotinia fuckeliana GN=lcc2 PE=2 SV=1 108 427 5.0E-80
sp|Q03966|LAC1_CRYPA Laccase OS=Cryphonectria parasitica GN=LAC-1 PE=3 SV=1 115 447 1.0E-64
sp|Q12570|LAC1_BOTFU Laccase-1 OS=Botryotinia fuckeliana GN=lcc1 PE=2 SV=3 108 412 8.0E-59
sp|P78722|LAC2_PODAS Laccase-2 OS=Podospora anserina GN=LAC2 PE=2 SV=1 115 452 7.0E-58
sp|P06811|LAC1_NEUCR Laccase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=lacc PE=1 SV=3 122 450 1.0E-57
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q96WM9|LAC2_BOTFU Laccase-2 OS=Botryotinia fuckeliana GN=lcc2 PE=2 SV=1 108 427 5.0E-80
sp|Q03966|LAC1_CRYPA Laccase OS=Cryphonectria parasitica GN=LAC-1 PE=3 SV=1 115 447 1.0E-64
sp|Q12570|LAC1_BOTFU Laccase-1 OS=Botryotinia fuckeliana GN=lcc1 PE=2 SV=3 108 412 8.0E-59
sp|P78722|LAC2_PODAS Laccase-2 OS=Podospora anserina GN=LAC2 PE=2 SV=1 115 452 7.0E-58
sp|P06811|LAC1_NEUCR Laccase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=lacc PE=1 SV=3 122 450 1.0E-57
sp|Q02079|LAC3_THACU Laccase-3 OS=Thanatephorus cucumeris GN=LCC3 PE=2 SV=1 130 428 8.0E-57
sp|Q02075|LAC2_THACU Laccase-2 OS=Thanatephorus cucumeris GN=LCC2 PE=2 SV=1 127 428 1.0E-56
sp|P56193|LAC1_THACU Laccase-1 OS=Thanatephorus cucumeris GN=LCC1 PE=1 SV=1 130 428 8.0E-55
sp|Q70KY3|LAC1_MELAO Laccase-1 OS=Melanocarpus albomyces GN=LAC1 PE=1 SV=1 115 450 6.0E-54
sp|Q99055|LAC4_TRAVI Laccase-4 OS=Trametes villosa GN=LCC4 PE=3 SV=1 131 405 2.0E-53
sp|Q12719|LAC4_TRAVE Laccase-4 OS=Trametes versicolor GN=LCC4 PE=3 SV=1 131 405 1.0E-52
sp|D4APX3|LAC1_ARTBC Laccase ARB_05828 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05828 PE=1 SV=1 119 442 2.0E-52
sp|Q02081|LAC4_THACU Laccase-4 OS=Thanatephorus cucumeris GN=LCC4 PE=1 SV=1 122 426 2.0E-52
sp|Q96UM2|LAC3_BOTFU Laccase-3 (Fragment) OS=Botryotinia fuckeliana GN=lcc3 PE=3 SV=1 156 407 3.0E-52
sp|O59896|LAC1_PYCCI Laccase OS=Pycnoporus cinnabarinus GN=LCC3-1 PE=1 SV=1 131 406 3.0E-51
sp|Q99044|LAC1_TRAVI Laccase-1 OS=Trametes villosa GN=LCC1 PE=3 SV=1 131 406 7.0E-51
sp|Q01679|LAC1_PHLRA Laccase OS=Phlebia radiata GN=LAC PE=1 SV=2 131 406 5.0E-50
sp|D0VWU3|LAC1_TRAMX Laccase OS=Trametes maxima PE=1 SV=1 131 406 1.0E-49
sp|Q12541|LAC1_AGABI Laccase-1 OS=Agaricus bisporus GN=lcc1 PE=1 SV=1 128 408 5.0E-49
sp|Q99056|LAC5_TRAVI Laccase-5 OS=Trametes villosa GN=LCC5 PE=3 SV=2 131 405 9.0E-48
sp|Q02497|LAC1_TRAHI Laccase OS=Trametes hirsuta PE=1 SV=1 131 406 2.0E-47
sp|Q12717|LAC5_TRAVE Laccase-5 OS=Trametes versicolor GN=LCC5 PE=2 SV=1 131 405 4.0E-47
sp|Q12542|LAC2_AGABI Laccase-2 OS=Agaricus bisporus GN=lcc2 PE=1 SV=1 128 408 6.0E-47
sp|Q5N7A3|LAC6_ORYSJ Laccase-6 OS=Oryza sativa subsp. japonica GN=LAC6 PE=2 SV=1 148 707 3.0E-46
sp|Q12718|LAC2_TRAVE Laccase-2 OS=Trametes versicolor GN=LCC2 PE=1 SV=1 132 406 2.0E-44
sp|Q99046|LAC2_TRAVI Laccase-2 OS=Trametes villosa GN=LCC2 PE=3 SV=1 132 406 9.0E-44
sp|Q99049|LAC3_TRAVI Laccase-3 OS=Trametes villosa GN=LCC3 PE=3 SV=1 131 406 2.0E-42
sp|Q12739|LAC2_PLEOS Laccase-2 OS=Pleurotus ostreatus GN=POX2 PE=1 SV=1 139 406 6.0E-41
sp|Q12729|LAC1_PLEOS Laccase-1 OS=Pleurotus ostreatus GN=POX1 PE=2 SV=1 131 406 8.0E-41
sp|Q0IQU1|LAC22_ORYSJ Laccase-22 OS=Oryza sativa subsp. japonica GN=LAC22 PE=2 SV=2 125 710 8.0E-40
sp|Q40588|ASO_TOBAC L-ascorbate oxidase OS=Nicotiana tabacum GN=AAO PE=2 SV=1 140 407 6.0E-39
sp|Q69L99|LAC14_ORYSJ Laccase-14 OS=Oryza sativa subsp. japonica GN=LAC14 PE=3 SV=1 125 707 4.0E-38
sp|P14133|ASO_CUCSA L-ascorbate oxidase OS=Cucumis sativus PE=1 SV=1 127 425 5.0E-38
sp|P24792|ASO_CUCMA L-ascorbate oxidase OS=Cucurbita maxima GN=AAO PE=1 SV=2 127 403 8.0E-37
sp|P37064|ASO_CUCPM L-ascorbate oxidase OS=Cucurbita pepo var. melopepo PE=1 SV=1 127 403 8.0E-37
sp|O81081|LAC2_ARATH Laccase-2 OS=Arabidopsis thaliana GN=LAC2 PE=2 SV=1 125 393 5.0E-35
sp|Q9FLB5|LAC12_ARATH Laccase-12 OS=Arabidopsis thaliana GN=LAC12 PE=2 SV=1 127 411 9.0E-35
sp|Q9FJD5|LAC17_ARATH Laccase-17 OS=Arabidopsis thaliana GN=LAC17 PE=2 SV=1 122 478 3.0E-33
sp|Q6Z8L2|LAC9_ORYSJ Putative laccase-9 OS=Oryza sativa subsp. japonica GN=LAC9 PE=3 SV=1 128 427 4.0E-33
sp|P12374|COPA_PSEUB Copper resistance protein A OS=Pseudomonas syringae pv. tomato GN=copA PE=1 SV=1 130 706 5.0E-33
sp|Q9SIY8|LAC5_ARATH Laccase-5 OS=Arabidopsis thaliana GN=LAC5 PE=2 SV=1 149 445 4.0E-32
sp|Q0IP28|LAC25_ORYSJ Laccase-25 OS=Oryza sativa subsp. japonica GN=LAC25 PE=3 SV=1 145 425 7.0E-32
sp|P59571|COPA_PSESM Copper resistance protein A homolog OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=copA PE=3 SV=1 130 706 1.0E-31
sp|Q2QUN2|LAC24_ORYSJ Laccase-24 OS=Oryza sativa subsp. japonica GN=LAC24 PE=2 SV=1 130 392 1.0E-31
sp|Q8VZA1|LAC11_ARATH Laccase-11 OS=Arabidopsis thaliana GN=LAC11 PE=2 SV=1 117 406 2.0E-31
sp|Q56YT0|LAC3_ARATH Laccase-3 OS=Arabidopsis thaliana GN=LAC3 PE=2 SV=2 149 438 2.0E-31
sp|Q2QZ80|LAC21_ORYSJ Laccase-21 OS=Oryza sativa subsp. japonica GN=LAC21 PE=2 SV=1 128 400 4.0E-31
sp|Q9LYQ2|LAC13_ARATH Laccase-13 OS=Arabidopsis thaliana GN=LAC13 PE=2 SV=1 149 411 1.0E-30
sp|O80434|LAC4_ARATH Laccase-4 OS=Arabidopsis thaliana GN=IRX12 PE=2 SV=2 122 478 2.0E-30
sp|Q9LFD1|LAC9_ARATH Laccase-9 OS=Arabidopsis thaliana GN=LAC9 PE=2 SV=1 138 434 3.0E-30
sp|Q5ZCW1|LAC1_ORYSJ Putative laccase-1 OS=Oryza sativa subsp. japonica GN=LAC1 PE=3 SV=1 128 427 3.0E-30
sp|Q9LFD2|LAC8_ARATH Laccase-8 OS=Arabidopsis thaliana GN=LAC8 PE=2 SV=1 134 405 3.0E-30
sp|Q5N7B4|LAC7_ORYSJ Laccase-7 OS=Oryza sativa subsp. japonica GN=LAC7 PE=2 SV=1 130 425 3.0E-30
sp|Q0DHL2|LAC12_ORYSJ Laccase-12/13 OS=Oryza sativa subsp. japonica GN=LAC12 PE=2 SV=1 125 405 3.0E-30
sp|Q9SR40|LAC7_ARATH Laccase-7 OS=Arabidopsis thaliana GN=LAC7 PE=2 SV=1 127 451 5.0E-30
sp|Q941X2|LAC3_ORYSJ Laccase-3 OS=Oryza sativa subsp. japonica GN=LAC3 PE=2 SV=1 148 410 8.0E-30
sp|Q8RYM9|LAC2_ORYSJ Laccase-2 OS=Oryza sativa subsp. japonica GN=LAC2 PE=2 SV=1 127 403 1.0E-29
sp|Q9FY79|LAC14_ARATH Laccase-14 OS=Arabidopsis thaliana GN=LAC14 PE=2 SV=1 148 411 3.0E-29
sp|Q84J37|LAC15_ARATH Laccase-15 OS=Arabidopsis thaliana GN=TT10 PE=1 SV=1 126 410 3.0E-29
sp|Q9ZPY2|LAC6_ARATH Laccase-6 OS=Arabidopsis thaliana GN=LAC6 PE=2 SV=1 128 411 4.0E-29
sp|Q2RBK2|LAC17_ORYSJ Putative laccase-17 OS=Oryza sativa subsp. japonica GN=LAC17 PE=3 SV=1 130 410 5.0E-29
sp|Q6ID18|LAC10_ARATH Laccase-10 OS=Arabidopsis thaliana GN=LAC10 PE=2 SV=1 125 394 6.0E-29
sp|Q09920|FIO1_SCHPO Iron transport multicopper oxidase fio1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fio1 PE=3 SV=1 139 411 6.0E-29
sp|Q47452|PCOA_ECOLX Copper resistance protein A OS=Escherichia coli GN=pcoA PE=3 SV=1 130 706 9.0E-29
sp|Q5N9X2|LAC4_ORYSJ Laccase-4 OS=Oryza sativa subsp. japonica GN=LAC4 PE=2 SV=1 125 394 1.0E-28
sp|Q0DHL5|LAC11_ORYSJ Putative laccase-11 OS=Oryza sativa subsp. japonica GN=LAC11 PE=5 SV=2 151 463 1.0E-28
sp|Q10ND7|LAC10_ORYSJ Laccase-10 OS=Oryza sativa subsp. japonica GN=LAC10 PE=2 SV=1 128 394 2.0E-28
sp|Q2QYS3|LAC23_ORYSJ Laccase-23 OS=Oryza sativa subsp. japonica GN=LAC23 PE=3 SV=1 130 410 3.0E-28
sp|Q1PDH6|LAC16_ARATH Laccase-16 OS=Arabidopsis thaliana GN=LAC16 PE=2 SV=2 126 403 3.0E-28
sp|Q5N9W4|LAC5_ORYSJ Putative laccase-5 OS=Oryza sativa subsp. japonica GN=LAC5 PE=3 SV=1 125 392 3.0E-28
sp|Q0JHP8|LAC8_ORYSJ Laccase-8 OS=Oryza sativa subsp. japonica GN=LAC8 PE=3 SV=2 152 426 9.0E-28
sp|P38993|FET3_YEAST Iron transport multicopper oxidase FET3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FET3 PE=1 SV=2 146 399 2.0E-26
sp|Q9LMS3|LAC1_ARATH Laccase-1 OS=Arabidopsis thaliana GN=LAC1 PE=2 SV=1 121 395 4.0E-26
sp|P43561|FET5_YEAST Iron transport multicopper oxidase FET5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FET5 PE=1 SV=1 131 411 2.0E-25
sp|Q2R0L2|LAC19_ORYSJ Laccase-19 OS=Oryza sativa subsp. japonica GN=LAC19 PE=2 SV=1 148 403 2.0E-25
sp|A2Y9C5|LAC19_ORYSI Putative laccase-19 OS=Oryza sativa subsp. indica GN=LAC19 PE=3 SV=1 148 403 3.0E-25
sp|Q6CII3|FET3_KLULA Iron transport multicopper oxidase FET3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FET3 PE=3 SV=1 128 431 5.0E-25
sp|Q53LU4|LAC18_ORYSJ Laccase-18 OS=Oryza sativa subsp. japonica GN=LAC18 PE=2 SV=1 148 403 8.0E-25
sp|A2XCN6|LAC18_ORYSI Putative laccase-18 OS=Oryza sativa subsp. indica GN=LAC18 PE=3 SV=1 148 403 1.0E-24
sp|A2Y9C2|LAC20_ORYSI Laccase-20 OS=Oryza sativa subsp. indica GN=LAC20 PE=3 SV=1 148 403 2.0E-24
sp|Q2R0L0|LAC20_ORYSJ Laccase-20 OS=Oryza sativa subsp. japonica GN=LAC20 PE=2 SV=1 148 403 2.0E-24
sp|Q96WT3|FET3_CANGA Iron transport multicopper oxidase FET3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FET3 PE=3 SV=1 125 397 7.0E-24
sp|Q339K6|LAC15_ORYSJ Laccase-15 OS=Oryza sativa subsp. japonica GN=LAC15 PE=2 SV=1 150 396 8.0E-24
sp|P78591|FET3_CANAX Iron transport multicopper oxidase FET3 OS=Candida albicans GN=FET3 PE=3 SV=1 140 422 2.0E-22
sp|Q12570|LAC1_BOTFU Laccase-1 OS=Botryotinia fuckeliana GN=lcc1 PE=2 SV=3 541 746 2.0E-21
sp|Q04399|GMC1_YEAST Putative multicopper oxidase GMC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GMC1 PE=1 SV=1 145 397 4.0E-21
sp|Q96UM2|LAC3_BOTFU Laccase-3 (Fragment) OS=Botryotinia fuckeliana GN=lcc3 PE=3 SV=1 514 707 9.0E-21
sp|Q9SU40|SKU5_ARATH Monocopper oxidase-like protein SKU5 OS=Arabidopsis thaliana GN=SKU5 PE=1 SV=1 130 572 4.0E-20
sp|P78722|LAC2_PODAS Laccase-2 OS=Podospora anserina GN=LAC2 PE=2 SV=1 528 746 8.0E-20
sp|Q9FHN6|SKS2_ARATH Monocopper oxidase-like protein SKS2 OS=Arabidopsis thaliana GN=SKS2 PE=1 SV=1 129 433 1.0E-19
sp|I6WZK7|MMCO_MYCTU Multicopper oxidase MmcO OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mmcO PE=1 SV=1 155 396 1.0E-18
sp|P17489|LAC1_EMENI Laccase-1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=yA PE=2 SV=3 143 404 2.0E-18
sp|Q8VXX5|SKS1_ARATH Monocopper oxidase-like protein SKS1 OS=Arabidopsis thaliana GN=SKS1 PE=1 SV=1 129 433 3.0E-18
sp|D4APX3|LAC1_ARTBC Laccase ARB_05828 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05828 PE=1 SV=1 521 733 4.0E-18
sp|Q96WM9|LAC2_BOTFU Laccase-2 OS=Botryotinia fuckeliana GN=lcc2 PE=2 SV=1 539 746 2.0E-17
sp|Q70KY3|LAC1_MELAO Laccase-1 OS=Melanocarpus albomyces GN=LAC1 PE=1 SV=1 541 746 1.0E-16
sp|Q7XE50|LAC16_ORYSJ Putative laccase-16 OS=Oryza sativa subsp. japonica GN=LAC16 PE=5 SV=1 195 427 1.0E-16
sp|P29162|ASOL_TOBAC L-ascorbate oxidase homolog OS=Nicotiana tabacum PE=2 SV=1 130 427 5.0E-16
sp|P06811|LAC1_NEUCR Laccase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=lacc PE=1 SV=3 541 746 2.0E-15
sp|Q00624|ASOL_BRANA L-ascorbate oxidase homolog OS=Brassica napus GN=Bp10 PE=2 SV=1 134 426 3.0E-15
sp|Q09920|FIO1_SCHPO Iron transport multicopper oxidase fio1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fio1 PE=3 SV=1 621 737 8.0E-14
sp|Q96WT3|FET3_CANGA Iron transport multicopper oxidase FET3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=FET3 PE=3 SV=1 550 731 3.0E-12
sp|Q03966|LAC1_CRYPA Laccase OS=Cryphonectria parasitica GN=LAC-1 PE=3 SV=1 541 715 5.0E-12
sp|Q9LFD1|LAC9_ARATH Laccase-9 OS=Arabidopsis thaliana GN=LAC9 PE=2 SV=1 607 710 3.0E-11
sp|Q9SR40|LAC7_ARATH Laccase-7 OS=Arabidopsis thaliana GN=LAC7 PE=2 SV=1 588 709 3.0E-11
sp|Q9LFD2|LAC8_ARATH Laccase-8 OS=Arabidopsis thaliana GN=LAC8 PE=2 SV=1 607 710 1.0E-10
sp|Q0JHP8|LAC8_ORYSJ Laccase-8 OS=Oryza sativa subsp. japonica GN=LAC8 PE=3 SV=2 606 707 2.0E-10
sp|Q2QUN2|LAC24_ORYSJ Laccase-24 OS=Oryza sativa subsp. japonica GN=LAC24 PE=2 SV=1 608 707 3.0E-10
sp|Q6ID18|LAC10_ARATH Laccase-10 OS=Arabidopsis thaliana GN=LAC10 PE=2 SV=1 620 709 6.0E-10
sp|Q9LYQ2|LAC13_ARATH Laccase-13 OS=Arabidopsis thaliana GN=LAC13 PE=2 SV=1 616 709 9.0E-10
sp|Q941X2|LAC3_ORYSJ Laccase-3 OS=Oryza sativa subsp. japonica GN=LAC3 PE=2 SV=1 616 709 1.0E-09
sp|O80434|LAC4_ARATH Laccase-4 OS=Arabidopsis thaliana GN=IRX12 PE=2 SV=2 633 709 2.0E-09
sp|Q2RBK2|LAC17_ORYSJ Putative laccase-17 OS=Oryza sativa subsp. japonica GN=LAC17 PE=3 SV=1 612 710 2.0E-09
sp|Q0DHL5|LAC11_ORYSJ Putative laccase-11 OS=Oryza sativa subsp. japonica GN=LAC11 PE=5 SV=2 620 720 2.0E-09
sp|Q2QYS3|LAC23_ORYSJ Laccase-23 OS=Oryza sativa subsp. japonica GN=LAC23 PE=3 SV=1 612 710 2.0E-09
sp|Q6CII3|FET3_KLULA Iron transport multicopper oxidase FET3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=FET3 PE=3 SV=1 544 714 2.0E-09
sp|P78591|FET3_CANAX Iron transport multicopper oxidase FET3 OS=Candida albicans GN=FET3 PE=3 SV=1 551 716 3.0E-09
sp|O81081|LAC2_ARATH Laccase-2 OS=Arabidopsis thaliana GN=LAC2 PE=2 SV=1 612 709 4.0E-09
sp|Q9FLB5|LAC12_ARATH Laccase-12 OS=Arabidopsis thaliana GN=LAC12 PE=2 SV=1 616 710 4.0E-09
sp|Q9SIY8|LAC5_ARATH Laccase-5 OS=Arabidopsis thaliana GN=LAC5 PE=2 SV=1 616 709 4.0E-09
sp|Q2R0L2|LAC19_ORYSJ Laccase-19 OS=Oryza sativa subsp. japonica GN=LAC19 PE=2 SV=1 594 709 4.0E-09
sp|A2Y9C5|LAC19_ORYSI Putative laccase-19 OS=Oryza sativa subsp. indica GN=LAC19 PE=3 SV=1 594 709 5.0E-09
sp|Q5N7B4|LAC7_ORYSJ Laccase-7 OS=Oryza sativa subsp. japonica GN=LAC7 PE=2 SV=1 616 707 6.0E-09
sp|Q56YT0|LAC3_ARATH Laccase-3 OS=Arabidopsis thaliana GN=LAC3 PE=2 SV=2 616 709 1.0E-08
sp|Q84J37|LAC15_ARATH Laccase-15 OS=Arabidopsis thaliana GN=TT10 PE=1 SV=1 631 709 1.0E-08
sp|Q5N9W4|LAC5_ORYSJ Putative laccase-5 OS=Oryza sativa subsp. japonica GN=LAC5 PE=3 SV=1 583 710 1.0E-08
sp|A2Y9C2|LAC20_ORYSI Laccase-20 OS=Oryza sativa subsp. indica GN=LAC20 PE=3 SV=1 590 709 1.0E-08
sp|Q2R0L0|LAC20_ORYSJ Laccase-20 OS=Oryza sativa subsp. japonica GN=LAC20 PE=2 SV=1 590 709 1.0E-08
sp|Q02075|LAC2_THACU Laccase-2 OS=Thanatephorus cucumeris GN=LCC2 PE=2 SV=1 579 716 2.0E-08
sp|Q0IP28|LAC25_ORYSJ Laccase-25 OS=Oryza sativa subsp. japonica GN=LAC25 PE=3 SV=1 608 705 2.0E-08
sp|Q8RYM9|LAC2_ORYSJ Laccase-2 OS=Oryza sativa subsp. japonica GN=LAC2 PE=2 SV=1 632 709 3.0E-08
sp|Q5N9X2|LAC4_ORYSJ Laccase-4 OS=Oryza sativa subsp. japonica GN=LAC4 PE=2 SV=1 620 709 3.0E-08
sp|Q10ND7|LAC10_ORYSJ Laccase-10 OS=Oryza sativa subsp. japonica GN=LAC10 PE=2 SV=1 620 710 3.0E-08
sp|Q1PDH6|LAC16_ARATH Laccase-16 OS=Arabidopsis thaliana GN=LAC16 PE=2 SV=2 620 710 3.0E-08
sp|P43561|FET5_YEAST Iron transport multicopper oxidase FET5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FET5 PE=1 SV=1 616 711 4.0E-08
sp|Q53LU4|LAC18_ORYSJ Laccase-18 OS=Oryza sativa subsp. japonica GN=LAC18 PE=2 SV=1 594 709 6.0E-08
sp|Q9ZPY2|LAC6_ARATH Laccase-6 OS=Arabidopsis thaliana GN=LAC6 PE=2 SV=1 621 721 7.0E-08
sp|Q9FJD5|LAC17_ARATH Laccase-17 OS=Arabidopsis thaliana GN=LAC17 PE=2 SV=1 620 709 8.0E-08
sp|Q0DHL2|LAC12_ORYSJ Laccase-12/13 OS=Oryza sativa subsp. japonica GN=LAC12 PE=2 SV=1 632 709 8.0E-08
sp|Q8VZA1|LAC11_ARATH Laccase-11 OS=Arabidopsis thaliana GN=LAC11 PE=2 SV=1 632 709 1.0E-07
sp|Q9FY79|LAC14_ARATH Laccase-14 OS=Arabidopsis thaliana GN=LAC14 PE=2 SV=1 633 709 1.0E-07
sp|P36649|CUEO_ECOLI Blue copper oxidase CueO OS=Escherichia coli (strain K12) GN=cueO PE=1 SV=2 152 395 1.0E-07
sp|Q8X947|CUEO_ECO57 Blue copper oxidase CueO OS=Escherichia coli O157:H7 GN=cueO PE=3 SV=1 152 395 1.0E-07
sp|P38993|FET3_YEAST Iron transport multicopper oxidase FET3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FET3 PE=1 SV=2 606 698 2.0E-07
sp|A2XCN6|LAC18_ORYSI Putative laccase-18 OS=Oryza sativa subsp. indica GN=LAC18 PE=3 SV=1 594 709 2.0E-07
sp|P56193|LAC1_THACU Laccase-1 OS=Thanatephorus cucumeris GN=LCC1 PE=1 SV=1 560 737 4.0E-07
sp|Q2QZ80|LAC21_ORYSJ Laccase-21 OS=Oryza sativa subsp. japonica GN=LAC21 PE=2 SV=1 621 709 4.0E-07
sp|Q6Z8L2|LAC9_ORYSJ Putative laccase-9 OS=Oryza sativa subsp. japonica GN=LAC9 PE=3 SV=1 621 709 5.0E-07
sp|Q339K6|LAC15_ORYSJ Laccase-15 OS=Oryza sativa subsp. japonica GN=LAC15 PE=2 SV=1 616 720 6.0E-07
sp|P37064|ASO_CUCPM L-ascorbate oxidase OS=Cucurbita pepo var. melopepo PE=1 SV=1 612 720 9.0E-07
sp|Q40588|ASO_TOBAC L-ascorbate oxidase OS=Nicotiana tabacum GN=AAO PE=2 SV=1 612 707 1.0E-06
sp|P24792|ASO_CUCMA L-ascorbate oxidase OS=Cucurbita maxima GN=AAO PE=1 SV=2 612 720 1.0E-06
sp|Q69HT9|MCO_STAAU Multicopper oxidase mco OS=Staphylococcus aureus GN=mco PE=1 SV=2 152 372 1.0E-06
sp|Q6GIX3|MCO_STAAR Multicopper oxidase mco OS=Staphylococcus aureus (strain MRSA252) GN=mco PE=3 SV=2 152 372 1.0E-06
sp|Q4LAB0|MCO_STAHJ Multicopper oxidase mco OS=Staphylococcus haemolyticus (strain JCSC1435) GN=mco PE=3 SV=2 152 307 1.0E-06
sp|Q12541|LAC1_AGABI Laccase-1 OS=Agaricus bisporus GN=lcc1 PE=1 SV=1 619 715 2.0E-06
sp|Q12542|LAC2_AGABI Laccase-2 OS=Agaricus bisporus GN=lcc2 PE=1 SV=1 619 716 2.0E-06
sp|Q8CQF6|MCO_STAES Multicopper oxidase mco OS=Staphylococcus epidermidis (strain ATCC 12228) GN=mco PE=3 SV=2 152 307 2.0E-06
sp|Q7XE50|LAC16_ORYSJ Putative laccase-16 OS=Oryza sativa subsp. japonica GN=LAC16 PE=5 SV=1 621 709 3.0E-06
sp|P14133|ASO_CUCSA L-ascorbate oxidase OS=Cucumis sativus PE=1 SV=1 618 707 5.0E-06
sp|Q5ZCW1|LAC1_ORYSJ Putative laccase-1 OS=Oryza sativa subsp. japonica GN=LAC1 PE=3 SV=1 621 709 5.0E-06
sp|Q9LMS3|LAC1_ARATH Laccase-1 OS=Arabidopsis thaliana GN=LAC1 PE=2 SV=1 633 710 5.0E-06
sp|Q12719|LAC4_TRAVE Laccase-4 OS=Trametes versicolor GN=LCC4 PE=3 SV=1 614 720 6.0E-06
sp|Q02079|LAC3_THACU Laccase-3 OS=Thanatephorus cucumeris GN=LCC3 PE=2 SV=1 560 732 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0005507 copper ion binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0046872 metal ion binding No
GO:0008152 metabolic process No
GO:0043169 cation binding No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0046914 transition metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11134
MKFAGAFLFVSGLVASSHAEKTVESDEAGADTLANLSPEFYQAVLGKDGDSIADRWLKEPEDITKKFNTGRRELS
QVISNGLSKLGTLEAKHLPHFLTNNPLPNGYPWSTRNEYTNFYNEYPRTGVIRSYDFTISRGLISPDGYQRPVIL
VNGAFPGPLIECNWGDTIQVTVHNNITEMTVHNNITEMPEGTALHWHGFFQHGTPWEDGVPGISQCPIPPGKSFT
YQFDAQIYGTTWYHSHYSAQWAAGLFGPLIIHGPEHRKYDIDVGPILLTDWYHKDYFNIVEETLEENSPGPVLSD
NNLINGKGNFNCSSLSANDTTPCRSNAGLAKFRFQRGKVHRLRLINAGAEGLQRFSIDGHKMTVIANDIVPVEPF
ETEVVTLGIGQRTDVLVEANGELDSYWMRSNMSESCSLTTQPYALAIIYYENDGEESGSDHGNGSKDNDSGDAKD
PTDNEPEDEDSDAGKDTDKNDSENDENYEGKSDSESREDGEDEGNDQVGVYKRKTPSGTTAGRTPSRTAGNSPSN
RVPSSTPWNVPDPGTCLNDNLNLTVPVMKLKLPKADLTLEVTVNSTVNASQVTVWTMNDIDFRTNYNSPTLLLSN
LGNFSYEKQWHVVNTKNAKSVRVIVNNESNVSHPMHLHGYNMYTLDAGEGRWNGTIVRPSNPNRRDVANMPRKGY
LVMQFDAAANPGLWPFHCHIAWHSSAGLLMQFLTNPKEVVKYRIPHVIAETCRQWGTWTKTNVPDMIDSGL*
Coding >Hirsu2|11134
ATGAAGTTCGCAGGTGCTTTCTTGTTTGTCTCTGGCCTTGTCGCTTCCAGTCATGCAGAGAAAACAGTAGAATCC
GACGAGGCGGGCGCGGACACCCTCGCGAACCTCTCGCCCGAGTTCTATCAGGCTGTCCTAGGCAAGGATGGTGAT
AGTATCGCGGATCGGTGGTTGAAAGAGCCCGAGGACATAACTAAGAAATTTAACACGGGACGGCGCGAATTAAGC
CAGGTTATCAGCAATGGCTTGTCCAAGTTGGGTACACTTGAGGCGAAACACTTGCCCCATTTTCTGACCAACAAT
CCGCTGCCTAACGGTTATCCATGGAGCACGCGCAATGAATACACCAACTTCTATAATGAGTACCCGAGGACCGGC
GTTATCAGGAGCTATGACTTTACCATTAGCCGGGGTCTCATCTCTCCTGATGGCTATCAGAGGCCCGTTATACTG
GTCAATGGCGCGTTTCCGGGCCCTCTCATAGAGTGCAACTGGGGTGATACTATTCAAGTCACAGTTCACAATAAT
ATTACAGAGATGACAGTTCACAATAACATTACAGAGATGCCTGAAGGAACAGCCTTGCACTGGCACGGCTTTTTC
CAGCACGGCACGCCCTGGGAAGACGGTGTTCCTGGCATCTCCCAGTGCCCGATCCCGCCCGGCAAATCCTTTACC
TATCAGTTCGACGCACAGATCTACGGCACAACATGGTATCATTCACACTACTCTGCCCAGTGGGCTGCCGGACTC
TTCGGTCCTCTCATTATCCACGGGCCAGAGCACCGCAAATACGATATCGACGTTGGCCCCATTCTTCTCACTGAT
TGGTATCACAAGGATTACTTTAATATCGTTGAGGAAACCCTAGAAGAAAACTCACCGGGACCTGTTTTATCAGAC
AACAATCTCATCAACGGCAAGGGCAACTTTAACTGCTCATCTCTATCGGCAAACGATACCACACCGTGCCGGAGC
AACGCTGGCTTGGCTAAGTTTAGGTTTCAACGCGGCAAGGTCCACCGCCTCCGTCTTATCAATGCAGGAGCTGAG
GGCTTGCAACGATTCTCAATCGACGGACATAAAATGACGGTCATCGCTAACGACATCGTGCCCGTTGAGCCGTTC
GAGACTGAGGTCGTTACGCTTGGCATTGGCCAAAGAACGGACGTTCTCGTCGAGGCGAACGGCGAGCTGGACTCT
TACTGGATGCGGAGCAATATGTCCGAAAGTTGCAGTCTCACTACCCAGCCTTATGCCCTTGCGATAATCTACTAC
GAGAATGACGGGGAGGAAAGTGGCTCGGATCATGGGAACGGTTCCAAGGACAACGATTCTGGGGACGCAAAGGAC
CCCACCGACAACGAGCCAGAGGATGAGGACAGTGATGCTGGTAAAGACACAGACAAGAACGATTCGGAAAACGAT
GAGAATTACGAAGGCAAGAGCGATTCAGAAAGCCGCGAGGATGGTGAAGATGAAGGAAACGATCAGGTCGGCGTC
TACAAGCGAAAGACTCCGAGCGGGACGACTGCGGGCCGGACTCCAAGCCGAACAGCTGGGAACAGTCCATCCAAC
AGGGTTCCAAGTTCAACACCCTGGAATGTTCCTGATCCCGGTACTTGCCTGAACGACAACCTTAACTTAACGGTG
CCTGTGATGAAACTCAAGCTCCCCAAGGCCGACTTAACACTGGAAGTAACCGTCAACTCTACTGTAAACGCCAGC
CAGGTTACGGTCTGGACAATGAACGATATAGATTTCCGGACAAACTATAACAGCCCGACGCTTCTGCTCAGCAAT
CTTGGAAACTTTTCCTACGAGAAGCAATGGCATGTGGTGAACACCAAAAATGCGAAGAGTGTGAGAGTTATTGTG
AACAATGAGTCTAACGTTTCACACCCGATGCATCTCCACGGTTACAACATGTACACCCTAGACGCAGGCGAGGGC
AGGTGGAATGGAACCATCGTTCGCCCCTCCAATCCCAATAGGCGAGACGTCGCCAATATGCCCCGCAAGGGTTAT
TTGGTCATGCAATTTGATGCAGCAGCAAACCCAGGCCTTTGGCCATTCCATTGTCATATTGCTTGGCACTCGTCA
GCCGGCCTGCTCATGCAATTCCTCACCAACCCCAAGGAAGTTGTCAAGTACCGTATTCCTCACGTCATTGCTGAA
ACTTGCCGACAGTGGGGCACTTGGACAAAAACGAACGTTCCAGACATGATTGATAGTGGTCTGTAG
Transcript >Hirsu2|11134
ATGAAGTTCGCAGGTGCTTTCTTGTTTGTCTCTGGCCTTGTCGCTTCCAGTCATGCAGAGAAAACAGTAGAATCC
GACGAGGCGGGCGCGGACACCCTCGCGAACCTCTCGCCCGAGTTCTATCAGGCTGTCCTAGGCAAGGATGGTGAT
AGTATCGCGGATCGGTGGTTGAAAGAGCCCGAGGACATAACTAAGAAATTTAACACGGGACGGCGCGAATTAAGC
CAGGTTATCAGCAATGGCTTGTCCAAGTTGGGTACACTTGAGGCGAAACACTTGCCCCATTTTCTGACCAACAAT
CCGCTGCCTAACGGTTATCCATGGAGCACGCGCAATGAATACACCAACTTCTATAATGAGTACCCGAGGACCGGC
GTTATCAGGAGCTATGACTTTACCATTAGCCGGGGTCTCATCTCTCCTGATGGCTATCAGAGGCCCGTTATACTG
GTCAATGGCGCGTTTCCGGGCCCTCTCATAGAGTGCAACTGGGGTGATACTATTCAAGTCACAGTTCACAATAAT
ATTACAGAGATGACAGTTCACAATAACATTACAGAGATGCCTGAAGGAACAGCCTTGCACTGGCACGGCTTTTTC
CAGCACGGCACGCCCTGGGAAGACGGTGTTCCTGGCATCTCCCAGTGCCCGATCCCGCCCGGCAAATCCTTTACC
TATCAGTTCGACGCACAGATCTACGGCACAACATGGTATCATTCACACTACTCTGCCCAGTGGGCTGCCGGACTC
TTCGGTCCTCTCATTATCCACGGGCCAGAGCACCGCAAATACGATATCGACGTTGGCCCCATTCTTCTCACTGAT
TGGTATCACAAGGATTACTTTAATATCGTTGAGGAAACCCTAGAAGAAAACTCACCGGGACCTGTTTTATCAGAC
AACAATCTCATCAACGGCAAGGGCAACTTTAACTGCTCATCTCTATCGGCAAACGATACCACACCGTGCCGGAGC
AACGCTGGCTTGGCTAAGTTTAGGTTTCAACGCGGCAAGGTCCACCGCCTCCGTCTTATCAATGCAGGAGCTGAG
GGCTTGCAACGATTCTCAATCGACGGACATAAAATGACGGTCATCGCTAACGACATCGTGCCCGTTGAGCCGTTC
GAGACTGAGGTCGTTACGCTTGGCATTGGCCAAAGAACGGACGTTCTCGTCGAGGCGAACGGCGAGCTGGACTCT
TACTGGATGCGGAGCAATATGTCCGAAAGTTGCAGTCTCACTACCCAGCCTTATGCCCTTGCGATAATCTACTAC
GAGAATGACGGGGAGGAAAGTGGCTCGGATCATGGGAACGGTTCCAAGGACAACGATTCTGGGGACGCAAAGGAC
CCCACCGACAACGAGCCAGAGGATGAGGACAGTGATGCTGGTAAAGACACAGACAAGAACGATTCGGAAAACGAT
GAGAATTACGAAGGCAAGAGCGATTCAGAAAGCCGCGAGGATGGTGAAGATGAAGGAAACGATCAGGTCGGCGTC
TACAAGCGAAAGACTCCGAGCGGGACGACTGCGGGCCGGACTCCAAGCCGAACAGCTGGGAACAGTCCATCCAAC
AGGGTTCCAAGTTCAACACCCTGGAATGTTCCTGATCCCGGTACTTGCCTGAACGACAACCTTAACTTAACGGTG
CCTGTGATGAAACTCAAGCTCCCCAAGGCCGACTTAACACTGGAAGTAACCGTCAACTCTACTGTAAACGCCAGC
CAGGTTACGGTCTGGACAATGAACGATATAGATTTCCGGACAAACTATAACAGCCCGACGCTTCTGCTCAGCAAT
CTTGGAAACTTTTCCTACGAGAAGCAATGGCATGTGGTGAACACCAAAAATGCGAAGAGTGTGAGAGTTATTGTG
AACAATGAGTCTAACGTTTCACACCCGATGCATCTCCACGGTTACAACATGTACACCCTAGACGCAGGCGAGGGC
AGGTGGAATGGAACCATCGTTCGCCCCTCCAATCCCAATAGGCGAGACGTCGCCAATATGCCCCGCAAGGGTTAT
TTGGTCATGCAATTTGATGCAGCAGCAAACCCAGGCCTTTGGCCATTCCATTGTCATATTGCTTGGCACTCGTCA
GCCGGCCTGCTCATGCAATTCCTCACCAACCCCAAGGAAGTTGTCAAGTACCGTATTCCTCACGTCATTGCTGAA
ACTTGCCGACAGTGGGGCACTTGGACAAAAACGAACGTTCCAGACATGATTGATAGTGGTCTGTAG
Gene >Hirsu2|11134
ATGAAGTTCGCAGGTGCTTTCTTGTTTGTCTCTGGCCTTGTCGCTTCCAGTCATGCAGAGAAAACAGTAGAATCC
GACGAGGCGGGCGCGGACACCCTCGCGAACCTCTCGCCCGAGTTCTATCAGGCTGTCCTAGGCAAGGATGGTGAT
AGTATCGCGGATCGGTGGTTGAAAGAGCCCGAGGACATAACTAAGAAATTTAACACGGGACGGCGCGAATTAAGC
CAGGTTATCAGCAATGGGTATGTTTCTTCCCCTCCACAACTCGCGTGTCAATTATCGATCACTAAAGGTTCGGGT
AGCTTGTCCAAGTTGGGTACACTTGAGGCGAAACACTTGCCCCATTTTCTGACCAACAATCCGCTGCCTAACGGT
TATCCATGGAGCACGCGCAATGAATACACCAACTTCTATAATGAGTACCCGAGGACCGGCGTTATCAGGAGCTAT
GACTTTACCATTAGCCGGGGTCTCATCTCTCCTGATGGCTATCAGAGGCCCGTTATACTGGTCAATGGCGCGTTT
CCGGGCCCTCTCATAGAGTGCAACTGGGGTGATACTATTCAAGTCACAGTTCACAATAATATTACAGAGATGACA
GTTCACAATAACATTACAGAGATGCCTGAAGGAACAGCCTTGCACTGGCACGGCTTTTTCCAGCACGGCACGCCC
TGGGAAGACGGTGTTCCTGGCATCTCCCAGTGCCCGATCCCGCCCGGCAAATCCTTTACCTATCAGTTCGACGCA
CAGATCTACGGCACAACATGGTATCATTCACACTACTCTGCCCAGTGGGCTGCCGGACTCTTCGGTCCTCTCATT
ATCCACGGGCCAGAGCACCGCAAATACGATATCGACGTTGGCCCCATTCTTCTCACTGATTGGTATCACAAGGAT
TACTTTAATATCGTTGAGGAAACCCTAGAAGAAAACTCACCGGGACCTGTTTTATCAGACAACAATCTCATCAAC
GGCAAGGGCAACTTTAACTGCTCATCTCTATCGGCAAACGATACCACACCGTGCCGGAGCAACGCTGGCTTGGCT
AAGTTTAGGTTTCAACGCGGCAAGGTCCACCGCCTCCGTCTTATCAATGCAGGAGCTGAGGGCTTGCAACGATTC
TCAATCGACGGACATAAAATGACGGTCATCGCTAACGACATCGTGCCCGTTGAGCCGTTCGAGACTGAGGTCGTT
ACGCTTGGCATTGGCCAAAGAACGGACGTTCTCGTCGAGGCGAACGGCGAGCTGGACTCTTACTGGATGCGGAGC
AATATGTCCGAAAGTTGCAGTCTCACTACCCAGCCTTATGCCCTTGCGATAATCTACTACGAGAATGACGGGGAG
GAAAGTGGCTCGGATCATGGGAACGGTTCCAAGGACAACGATTCTGGGGACGCAAAGGACCCCACCGACAACGAG
CCAGAGGATGAGGACAGTGATGCTGGTAAAGACACAGACAAGAACGATTCGGAAAACGATGAGAATTACGAAGGC
AAGAGCGATTCAGAAAGCCGCGAGGATGGTGAAGATGAAGGAAACGATCAGGTCGGCGTCTACAAGCGAAAGACT
CCGAGCGGGACGACTGCGGGCCGGACTCCAAGCCGAACAGCTGGGAACAGTCCATCCAACAGGGTTCCAAGTTCA
ACACCCTGGAATGTTCCTGATCCCGGTACTTGCCTGAACGACAACCTTAACTTAACGGTGCCTGTGATGAAACTC
AAGCTCCCCAAGGCCGACTTAACACTGGAAGTAACCGTCAACTCTACTGTAAACGCCAGCCAGGTTACGGTCTGG
ACAATGAACGATATAGATTTCCGGACAAACTATAACAGCCCGACGCTTCTGCTCAGCAATCTTGGAAACTTTTCC
TACGAGAAGCAATGGCATGTGGTGAACACCAAAAATGCGAAGAGTGTGAGAGTTATTGTGAACAATGAGTCTAAC
GTTTCGTAAGTGATGCCATAATTCCAGGTGGCTAACTGCCCTACTGACGACCTCATATCCAGACACCCGATGCAT
CTCCACGGTTACAACATGTACACCCTAGACGCAGGCGAGGGCAGGTGGAATGGAACCATCGTTCGCCCCTCCAAT
CCCAATAGGCGAGACGTCGCCAATATGCCCCGCAAGGGTTATTTGGTCATGCAATTTGATGCAGCAGCAAACCCA
GGTAAGCCAGACCCAAATCGTTTCTTCATGCGAGTCATGGAACAACTTAACTGAGCGACTGGTCCGGCATGGATT
GCTGACCCCTACTTACAGGCCTTTGGCCATTCCATTGTCATATTGCTTGGCACTCGTCAGCCGGCCTGCTCATGC
AATTCCTCACCAACCCCAAGGAAGTTGTCAAGTACCGTATTCCTCACGTCATTGCTGAAACTTGCCGACAGTGGG
GCACTTGGACAAAAACGAACGTTCCAGACATGATTGATAGTGGTCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail