Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11132
Gene name
LocationContig_97:3844..5744
Strand+
Gene length (bp)1900
Transcript length (bp)1587
Coding sequence length (bp)1587
Protein length (aa) 529

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 2.2E-86 58 508
PF07690 MFS_1 Major Facilitator Superfamily 6.7E-29 64 452
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 9.2E-06 95 174

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P07921|LACP_KLULA Lactose permease OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LAC12 PE=3 SV=1 47 520 2.0E-88
sp|P49374|HGT1_KLULA High-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HGT1 PE=3 SV=1 25 513 2.0E-54
sp|O74713|HGT1_CANAX High-affinity glucose transporter OS=Candida albicans GN=HGT1 PE=3 SV=1 52 513 6.0E-47
sp|P53387|KHT2_KLULC Hexose transporter 2 OS=Kluyveromyces lactis GN=KHT2 PE=3 SV=1 51 514 4.0E-39
sp|Q4U3U4|QAY_NEUTR Quinate permease OS=Neurospora terricola GN=qa-y PE=3 SV=1 52 511 1.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P07921|LACP_KLULA Lactose permease OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LAC12 PE=3 SV=1 47 520 2.0E-88
sp|P49374|HGT1_KLULA High-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HGT1 PE=3 SV=1 25 513 2.0E-54
sp|O74713|HGT1_CANAX High-affinity glucose transporter OS=Candida albicans GN=HGT1 PE=3 SV=1 52 513 6.0E-47
sp|P53387|KHT2_KLULC Hexose transporter 2 OS=Kluyveromyces lactis GN=KHT2 PE=3 SV=1 51 514 4.0E-39
sp|Q4U3U4|QAY_NEUTR Quinate permease OS=Neurospora terricola GN=qa-y PE=3 SV=1 52 511 1.0E-37
sp|Q4U3U6|QAY_NEUAF Quinate permease OS=Neurospora africana GN=qa-y PE=3 SV=1 52 508 3.0E-37
sp|P32465|HXT1_YEAST Low-affinity glucose transporter HXT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT1 PE=1 SV=1 19 508 6.0E-36
sp|O74969|GHT2_SCHPO High-affinity glucose transporter ght2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght2 PE=1 SV=1 55 514 1.0E-35
sp|P11636|QAY_NEUCR Quinate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qa-y PE=3 SV=2 52 511 2.0E-35
sp|Q39228|STP4_ARATH Sugar transport protein 4 OS=Arabidopsis thaliana GN=STP4 PE=1 SV=1 48 519 2.0E-35
sp|P40886|HXT8_YEAST Hexose transporter HXT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT8 PE=1 SV=1 1 528 2.0E-35
sp|P23585|HXT2_YEAST High-affinity glucose transporter HXT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT2 PE=1 SV=1 56 514 4.0E-35
sp|P15325|QUTD_EMENI Quinate permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=qutD PE=1 SV=2 52 511 5.0E-35
sp|O74849|GHT6_SCHPO High-affinity fructose transporter ght6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght6 PE=1 SV=1 97 514 8.0E-35
sp|P43581|HXT10_YEAST Hexose transporter HXT10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT10 PE=1 SV=1 17 514 3.0E-34
sp|A2QQV6|QUTD_ASPNC Probable quinate permease OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=qutD PE=3 SV=1 52 527 5.0E-34
sp|P18631|RAG1_KLULA Low-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAG1 PE=1 SV=1 15 514 3.0E-33
sp|Q8VZ80|PLT5_ARATH Polyol transporter 5 OS=Arabidopsis thaliana GN=PLT5 PE=1 SV=2 58 521 8.0E-33
sp|P46333|CSBC_BACSU Probable metabolite transport protein CsbC OS=Bacillus subtilis (strain 168) GN=csbC PE=1 SV=3 48 505 1.0E-32
sp|P13181|GAL2_YEAST Galactose transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL2 PE=1 SV=3 10 514 3.0E-32
sp|P40885|HXT9_YEAST Hexose transporter HXT9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT9 PE=1 SV=1 15 513 4.0E-32
sp|P38695|HXT5_YEAST Probable glucose transporter HXT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT5 PE=1 SV=1 96 514 6.0E-32
sp|P32466|HXT3_YEAST Low-affinity glucose transporter HXT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT3 PE=1 SV=1 51 508 7.0E-32
sp|Q8TFG1|GHT7_SCHPO Probable high-affinity hexose transporter ght7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght7 PE=3 SV=1 94 514 8.0E-32
sp|Q10710|STA_RICCO Sugar carrier protein A OS=Ricinus communis GN=STA PE=2 SV=1 48 504 1.0E-31
sp|Q9FMX3|STP11_ARATH Sugar transport protein 11 OS=Arabidopsis thaliana GN=STP11 PE=1 SV=1 30 509 2.0E-31
sp|Q12300|RGT2_YEAST High-affinity glucose transporter RGT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGT2 PE=1 SV=1 14 508 2.0E-31
sp|P54862|HXT11_YEAST Hexose transporter HXT11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT11 PE=1 SV=1 15 513 3.0E-31
sp|Q2U2Y9|QUTD_ASPOR Probable quinate permease OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=qutD PE=3 SV=1 52 511 6.0E-31
sp|B8NIM7|QUTD_ASPFN Probable quinate permease OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=qutD PE=3 SV=1 52 511 6.0E-31
sp|Q6MYX6|QUTD_ASPFU Probable quinate permease OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=qutD PE=3 SV=1 52 511 6.0E-31
sp|O04249|STP7_ARATH Sugar transport protein 7 OS=Arabidopsis thaliana GN=STP7 PE=2 SV=1 48 527 1.0E-30
sp|P39932|STL1_YEAST Sugar transporter STL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STL1 PE=1 SV=2 35 508 1.0E-29
sp|Q92253|RCO3_NEUCR Probable glucose transporter rco-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-3 PE=3 SV=2 68 520 1.0E-29
sp|A1D2R3|QUTD_NEOFI Probable quinate permease OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=qutD PE=3 SV=1 52 511 1.0E-29
sp|Q9XIH7|PLT1_ARATH Putative polyol transporter 1 OS=Arabidopsis thaliana GN=PLT1 PE=3 SV=1 58 527 2.0E-29
sp|Q9P3U6|GHT1_SCHPO High-affinity glucose transporter ght1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght1 PE=1 SV=1 56 514 2.0E-29
sp|P0AE24|ARAE_ECOLI Arabinose-proton symporter OS=Escherichia coli (strain K12) GN=araE PE=1 SV=1 105 506 6.0E-29
sp|P0AE25|ARAE_ECO57 Arabinose-proton symporter OS=Escherichia coli O157:H7 GN=araE PE=3 SV=1 105 506 6.0E-29
sp|Q39525|HUP3_PARKE H(+)/hexose cotransporter 3 OS=Parachlorella kessleri GN=HUP3 PE=2 SV=1 55 508 7.0E-29
sp|P23586|STP1_ARATH Sugar transport protein 1 OS=Arabidopsis thaliana GN=STP1 PE=1 SV=2 58 512 1.0E-28
sp|Q9LT15|STP10_ARATH Sugar transport protein 10 OS=Arabidopsis thaliana GN=STP10 PE=2 SV=1 58 509 1.0E-28
sp|O59932|GHT4_SCHPO High-affinity hexose transporter ght4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght4 PE=3 SV=2 106 525 1.0E-28
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 47 506 3.0E-28
sp|Q92339|GHT3_SCHPO High-affinity gluconate transporter ght3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght3 PE=3 SV=1 106 525 3.0E-28
sp|Q0D135|QUTD_ASPTN Probable quinate permease OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=qutD PE=3 SV=1 52 527 4.0E-28
sp|Q8GXR2|PLT6_ARATH Probable polyol transporter 6 OS=Arabidopsis thaliana GN=PLT6 PE=2 SV=2 58 509 5.0E-28
sp|Q93Y91|STP5_ARATH Sugar transport protein 5 OS=Arabidopsis thaliana GN=STP5 PE=2 SV=1 47 509 7.0E-28
sp|A1CPX0|QUTD_ASPCL Probable quinate permease OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=qutD PE=3 SV=1 52 511 7.0E-28
sp|Q41144|STC_RICCO Sugar carrier protein C OS=Ricinus communis GN=STC PE=2 SV=1 58 512 1.0E-27
sp|P45598|ARAE_KLEOX Arabinose-proton symporter OS=Klebsiella oxytoca GN=araE PE=3 SV=1 105 506 1.0E-27
sp|P53631|HXT17_YEAST Hexose transporter HXT17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT17 PE=3 SV=1 9 514 1.0E-27
sp|O34718|IOLT_BACSU Major myo-inositol transporter IolT OS=Bacillus subtilis (strain 168) GN=iolT PE=2 SV=1 53 510 1.0E-27
sp|P94493|YNCC_BACSU Putative metabolite transport protein YncC OS=Bacillus subtilis (strain 168) GN=yncC PE=3 SV=2 52 511 2.0E-27
sp|Q8GW61|STP14_ARATH Sugar transport protein 14 OS=Arabidopsis thaliana GN=STP14 PE=2 SV=2 121 504 3.0E-27
sp|Q0WVE9|PLST1_ARATH Probable plastidic glucose transporter 1 OS=Arabidopsis thaliana GN=At1g05030 PE=2 SV=2 97 511 4.0E-27
sp|Q9XIH6|PLT2_ARATH Putative polyol transporter 2 OS=Arabidopsis thaliana GN=PLT2 PE=3 SV=1 98 526 5.0E-27
sp|B0XQS8|QUTD_ASPFC Probable quinate permease OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=qutD PE=3 SV=1 52 511 7.0E-27
sp|Q01440|GTR1_LEIDO Membrane transporter D1 OS=Leishmania donovani PE=3 SV=1 56 515 8.0E-27
sp|P39924|HXT13_YEAST Hexose transporter HXT13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT13 PE=1 SV=1 11 514 9.0E-27
sp|P39003|HXT6_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT6 PE=1 SV=2 30 514 3.0E-26
sp|P39004|HXT7_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT7 PE=1 SV=1 30 514 3.0E-26
sp|P32467|HXT4_YEAST Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT4 PE=1 SV=1 51 514 3.0E-26
sp|P54854|HXT15_YEAST Hexose transporter HXT15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT15 PE=1 SV=1 53 514 4.0E-26
sp|A6ZT02|HXT4_YEAS7 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain YJM789) GN=HXT4 PE=3 SV=1 51 514 5.0E-26
sp|Q94AZ2|STP13_ARATH Sugar transport protein 13 OS=Arabidopsis thaliana GN=STP13 PE=1 SV=2 108 506 9.0E-26
sp|P47185|HXT16_YEAST Hexose transporter HXT16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT16 PE=3 SV=1 53 514 1.0E-25
sp|P15686|HUP1_PARKE H(+)/hexose cotransporter 1 OS=Parachlorella kessleri GN=HUP1 PE=2 SV=2 105 508 1.0E-25
sp|Q9P3U7|GHT8_SCHPO Probable high-affinity hexose transporter ght8, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght8 PE=1 SV=1 97 526 2.0E-25
sp|Q0WUU6|PLT4_ARATH Probable polyol transporter 4 OS=Arabidopsis thaliana GN=PLT4 PE=2 SV=1 21 509 2.0E-25
sp|Q9ZNS0|PLT3_ARATH Probable polyol transporter 3 OS=Arabidopsis thaliana GN=PLT3 PE=3 SV=1 108 508 2.0E-25
sp|P0AEP1|GALP_ECOLI Galactose-proton symporter OS=Escherichia coli (strain K12) GN=galP PE=1 SV=1 54 506 4.0E-25
sp|P0AEP2|GALP_ECOL6 Galactose-proton symporter OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=galP PE=3 SV=1 54 506 4.0E-25
sp|C7GWV6|HXT4_YEAS2 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain JAY291) GN=HXT4 PE=3 SV=1 51 514 5.0E-25
sp|Q8VZR6|INT1_ARATH Inositol transporter 1 OS=Arabidopsis thaliana GN=INT1 PE=1 SV=1 117 511 8.0E-25
sp|Q9SX48|STP9_ARATH Sugar transport protein 9 OS=Arabidopsis thaliana GN=STP9 PE=1 SV=1 49 518 8.0E-25
sp|P10870|SNF3_YEAST High-affinity glucose transporter SNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF3 PE=1 SV=3 44 508 1.0E-24
sp|P78831|GHT5_SCHPO High-affinity glucose transporter ght5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght5 PE=1 SV=2 97 508 7.0E-24
sp|P21906|GLF_ZYMMO Glucose facilitated diffusion protein OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=glf PE=3 SV=2 58 511 7.0E-24
sp|P54723|YFIG_BACSU Putative metabolite transport protein YfiG OS=Bacillus subtilis (strain 168) GN=yfiG PE=3 SV=1 53 509 1.0E-23
sp|P15729|GLCP_SYNY3 Glucose transport protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gtr PE=3 SV=2 47 504 1.0E-23
sp|Q56ZZ7|PLST4_ARATH Plastidic glucose transporter 4 OS=Arabidopsis thaliana GN=At5g16150 PE=1 SV=2 42 505 1.0E-23
sp|Q9SFG0|STP6_ARATH Sugar transport protein 6 OS=Arabidopsis thaliana GN=STP6 PE=1 SV=1 47 506 2.0E-23
sp|P40441|HXT12_YEAST Putative hexose transporter 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT12 PE=5 SV=1 97 513 3.0E-23
sp|Q9C757|INT2_ARATH Probable inositol transporter 2 OS=Arabidopsis thaliana GN=INT2 PE=1 SV=1 119 389 4.0E-23
sp|O65413|STP12_ARATH Sugar transport protein 12 OS=Arabidopsis thaliana GN=STP12 PE=2 SV=1 48 512 2.0E-22
sp|Q39524|HUP2_PARKE H(+)/hexose cotransporter 2 OS=Parachlorella kessleri GN=HUP2 PE=2 SV=1 103 508 2.0E-22
sp|Q96QE2|MYCT_HUMAN Proton myo-inositol cotransporter OS=Homo sapiens GN=SLC2A13 PE=1 SV=3 53 378 3.0E-22
sp|P96710|ARAE_BACSU Arabinose-proton symporter OS=Bacillus subtilis (strain 168) GN=araE PE=2 SV=2 117 508 7.0E-22
sp|P53048|MAL11_YEAST General alpha-glucoside permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL11 PE=1 SV=1 67 515 1.0E-21
sp|Q9LNV3|STP2_ARATH Sugar transport protein 2 OS=Arabidopsis thaliana GN=STP2 PE=1 SV=3 30 378 1.0E-21
sp|Q921A2|MYCT_RAT Proton myo-inositol cotransporter OS=Rattus norvegicus GN=Slc2a13 PE=1 SV=2 121 378 2.0E-21
sp|Q5J316|GTR12_BOVIN Solute carrier family 2, facilitated glucose transporter member 12 OS=Bos taurus GN=SLC2A12 PE=1 SV=1 42 384 3.0E-21
sp|Q3UHK1|MYCT_MOUSE Proton myo-inositol cotransporter OS=Mus musculus GN=Slc2a13 PE=1 SV=2 121 378 5.0E-21
sp|Q9SBA7|STP8_ARATH Sugar transport protein 8 OS=Arabidopsis thaliana GN=STP8 PE=2 SV=2 47 506 5.0E-21
sp|Q7XA64|ERDL9_ARATH Sugar transporter ERD6-like 9 OS=Arabidopsis thaliana GN=At3g05155 PE=2 SV=1 102 373 6.0E-21
sp|Q93YP9|ERDL4_ARATH Sugar transporter ERD6-like 4 OS=Arabidopsis thaliana GN=At1g19450 PE=2 SV=1 105 509 7.0E-21
sp|P38156|MAL31_YEAST Maltose permease MAL31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAL31 PE=1 SV=1 25 515 7.0E-21
sp|P30605|ITR1_YEAST Myo-inositol transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR1 PE=1 SV=2 4 376 8.0E-21
sp|P0AGF4|XYLE_ECOLI D-xylose-proton symporter OS=Escherichia coli (strain K12) GN=xylE PE=1 SV=1 53 521 1.0E-20
sp|P0AGF5|XYLE_ECO57 D-xylose-proton symporter OS=Escherichia coli O157:H7 GN=xylE PE=3 SV=1 53 521 1.0E-20
sp|Q07423|HEX6_RICCO Hexose carrier protein HEX6 OS=Ricinus communis GN=HEX6 PE=2 SV=1 55 509 5.0E-20
sp|P15685|MAL61_YEASX Maltose permease MAL61 OS=Saccharomyces cerevisiae GN=MAL61 PE=3 SV=1 25 515 6.0E-20
sp|O52733|XYLT_LACBR D-xylose-proton symporter OS=Lactobacillus brevis GN=xylT PE=3 SV=1 61 522 1.0E-19
sp|Q9FRL3|ERDL6_ARATH Sugar transporter ERD6-like 6 OS=Arabidopsis thaliana GN=At1g75220 PE=1 SV=1 48 509 1.0E-19
sp|Q9BE72|GTR12_MACFA Solute carrier family 2, facilitated glucose transporter member 12 OS=Macaca fascicularis GN=SLC2A12 PE=2 SV=1 27 384 2.0E-19
sp|Q9SD00|MSSP3_ARATH Monosaccharide-sensing protein 3 OS=Arabidopsis thaliana GN=MSSP3 PE=2 SV=1 55 264 3.0E-19
sp|Q32NG5|GTR12_XENLA Solute carrier family 2, facilitated glucose transporter member 12 OS=Xenopus laevis GN=slc2a12 PE=2 SV=1 98 417 5.0E-19
sp|Q8TD20|GTR12_HUMAN Solute carrier family 2, facilitated glucose transporter member 12 OS=Homo sapiens GN=SLC2A12 PE=2 SV=1 45 384 9.0E-19
sp|P87110|ITR2_SCHPO Myo-inositol transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr2 PE=2 SV=1 2 470 1.0E-18
sp|B5VF36|MPH3_YEAS6 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=MPH3 PE=3 SV=1 58 509 1.0E-18
sp|P0CE00|MPH3_YEAST Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPH3 PE=1 SV=1 58 509 1.0E-18
sp|A6ZX88|MPH3_YEAS7 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain YJM789) GN=MPH3 PE=3 SV=1 58 509 1.0E-18
sp|P0CD99|MPH2_YEAST Alpha-glucosides permease MPH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPH2 PE=2 SV=1 58 509 1.0E-18
sp|Q9ZQP6|INT3_ARATH Probable inositol transporter 3 OS=Arabidopsis thaliana GN=INT3 PE=2 SV=1 98 388 2.0E-18
sp|C8Z6M6|MPH3_YEAS8 Alpha-glucosides permease MPH3 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=MPH3 PE=3 SV=1 58 509 2.0E-18
sp|Q8BFW9|GTR12_MOUSE Solute carrier family 2, facilitated glucose transporter member 12 OS=Mus musculus GN=Slc2a12 PE=2 SV=1 88 384 2.0E-18
sp|P28568|GTR3_CHICK Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus GN=SLC2A3 PE=2 SV=1 59 527 3.0E-18
sp|Q9WV38|GTR5_MOUSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Mus musculus GN=Slc2a5 PE=1 SV=2 102 511 3.0E-18
sp|Q8WMN1|GTR5_SHEEP Solute carrier family 2, facilitated glucose transporter member 5 OS=Ovis aries GN=SLC2A5 PE=2 SV=1 42 508 6.0E-18
sp|P47842|GTR3_CANLF Solute carrier family 2, facilitated glucose transporter member 3 OS=Canis lupus familiaris GN=SLC2A3 PE=2 SV=1 102 527 7.0E-18
sp|P42833|HXT14_YEAST Hexose transporter HXT14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT14 PE=1 SV=2 55 509 1.0E-17
sp|P11169|GTR3_HUMAN Solute carrier family 2, facilitated glucose transporter member 3 OS=Homo sapiens GN=SLC2A3 PE=1 SV=1 102 511 2.0E-17
sp|Q5R608|GTR3_PONAB Solute carrier family 2, facilitated glucose transporter member 3 OS=Pongo abelii GN=SLC2A3 PE=2 SV=1 102 511 3.0E-17
sp|Q8TDB8|GTR14_HUMAN Solute carrier family 2, facilitated glucose transporter member 14 OS=Homo sapiens GN=SLC2A14 PE=2 SV=1 102 511 4.0E-17
sp|P43427|GTR5_RAT Solute carrier family 2, facilitated glucose transporter member 5 OS=Rattus norvegicus GN=Slc2a5 PE=1 SV=1 52 511 8.0E-17
sp|B4QBN3|TRE12_DROSI Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila simulans GN=Tret1-2 PE=3 SV=1 90 519 1.0E-16
sp|Q8L6Z8|XYLL1_ARATH D-xylose-proton symporter-like 1 OS=Arabidopsis thaliana GN=At3g03090 PE=2 SV=1 106 505 1.0E-16
sp|O23492|INT4_ARATH Inositol transporter 4 OS=Arabidopsis thaliana GN=INT4 PE=1 SV=1 117 391 1.0E-16
sp|P11166|GTR1_HUMAN Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens GN=SLC2A1 PE=1 SV=2 102 509 2.0E-16
sp|P58353|GTR5_BOVIN Solute carrier family 2, facilitated glucose transporter member 5 OS=Bos taurus GN=SLC2A5 PE=1 SV=2 42 508 2.0E-16
sp|P0C6A1|GTR7_MOUSE Solute carrier family 2, facilitated glucose transporter member 7 OS=Mus musculus GN=Slc2a7 PE=3 SV=1 102 511 2.0E-16
sp|Q12407|YD199_YEAST Putative metabolite transport protein YDL199C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDL199C PE=1 SV=1 56 506 2.0E-16
sp|O04036|ERD6_ARATH Sugar transporter ERD6 OS=Arabidopsis thaliana GN=ERD6 PE=1 SV=3 102 509 2.0E-16
sp|Q8L7R8|STP3_ARATH Sugar transport protein 3 OS=Arabidopsis thaliana GN=STP3 PE=2 SV=2 105 378 3.0E-16
sp|P30606|ITR2_YEAST Myo-inositol transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR2 PE=1 SV=2 50 376 3.0E-16
sp|Q8MKK4|TRE12_DROME Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila melanogaster GN=Tret1-2 PE=2 SV=1 90 513 3.0E-16
sp|Q9SCW7|ERDL1_ARATH Sugar transporter ERD6-like 1 OS=Arabidopsis thaliana GN=SUGTL4 PE=2 SV=2 104 506 3.0E-16
sp|P27674|GTR1_BOVIN Solute carrier family 2, facilitated glucose transporter member 1 OS=Bos taurus GN=SLC2A1 PE=1 SV=1 102 509 4.0E-16
sp|Q4F7G0|ERDL2_ARATH Sugar transporter ERD6-like 2 OS=Arabidopsis thaliana GN=SUGTL3 PE=2 SV=1 102 505 4.0E-16
sp|Q8VZT3|EDL12_ARATH Sugar transporter ERD6-like 12 OS=Arabidopsis thaliana GN=SUGTL5 PE=2 SV=1 104 381 6.0E-16
sp|B4HNS1|TRE12_DROSE Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila sechellia GN=Tret1-2 PE=3 SV=1 90 519 9.0E-16
sp|P20303|GTR1_PIG Solute carrier family 2, facilitated glucose transporter member 1 OS=Sus scrofa GN=SLC2A1 PE=2 SV=2 102 509 1.0E-15
sp|Q6AWX0|XYLL2_ARATH D-xylose-proton symporter-like 2 OS=Arabidopsis thaliana GN=At5g17010 PE=1 SV=1 106 505 1.0E-15
sp|Q6PXP3|GTR7_HUMAN Solute carrier family 2, facilitated glucose transporter member 7 OS=Homo sapiens GN=SLC2A7 PE=2 SV=2 119 511 1.0E-15
sp|P12336|GTR2_RAT Solute carrier family 2, facilitated glucose transporter member 2 OS=Rattus norvegicus GN=Slc2a2 PE=2 SV=1 103 517 2.0E-15
sp|P93051|ERDL7_ARATH Sugar transporter ERD6-like 7 OS=Arabidopsis thaliana GN=At2g48020 PE=2 SV=2 102 509 2.0E-15
sp|Q0P4G6|GTR10_XENTR Solute carrier family 2, facilitated glucose transporter member 10 OS=Xenopus tropicalis GN=slc2a10 PE=2 SV=1 106 380 2.0E-15
sp|Q9FYG3|PLST2_ARATH Probable plastidic glucose transporter 2 OS=Arabidopsis thaliana GN=At1g67300 PE=2 SV=1 95 505 2.0E-15
sp|P17809|GTR1_MOUSE Solute carrier family 2, facilitated glucose transporter member 1 OS=Mus musculus GN=Slc2a1 PE=1 SV=4 102 509 2.0E-15
sp|P14246|GTR2_MOUSE Solute carrier family 2, facilitated glucose transporter member 2 OS=Mus musculus GN=Slc2a2 PE=1 SV=3 60 517 3.0E-15
sp|A4ZYQ5|GTR7_RAT Solute carrier family 2, facilitated glucose transporter member 7 OS=Rattus norvegicus GN=Slc2a7 PE=2 SV=1 119 511 3.0E-15
sp|Q8GXK5|EDL14_ARATH Sugar transporter ERD6-like 14 OS=Arabidopsis thaliana GN=At4g04750 PE=2 SV=2 102 509 4.0E-15
sp|P47843|GTR3_SHEEP Solute carrier family 2, facilitated glucose transporter member 3 OS=Ovis aries GN=SLC2A3 PE=2 SV=1 102 527 4.0E-15
sp|P11167|GTR1_RAT Solute carrier family 2, facilitated glucose transporter member 1 OS=Rattus norvegicus GN=Slc2a1 PE=1 SV=1 102 509 4.0E-15
sp|B0WC46|TRET1_CULQU Facilitated trehalose transporter Tret1 OS=Culex quinquefasciatus GN=Tret1 PE=3 SV=1 44 511 4.0E-15
sp|Q6GN01|GTR10_XENLA Solute carrier family 2, facilitated glucose transporter member 10 OS=Xenopus laevis GN=slc2a10 PE=2 SV=1 91 380 1.0E-14
sp|Q10286|ITR1_SCHPO Myo-inositol transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr1 PE=3 SV=1 104 527 1.0E-14
sp|Q291H8|TRET1_DROPS Facilitated trehalose transporter Tret1 OS=Drosophila pseudoobscura pseudoobscura GN=Tret1 PE=3 SV=3 116 511 1.0E-14
sp|B4GAP7|TRET1_DROPE Facilitated trehalose transporter Tret1 OS=Drosophila persimilis GN=Tret1 PE=3 SV=2 116 511 1.0E-14
sp|A5LGM7|TRET1_POLVA Facilitated trehalose transporter Tret1 OS=Polypedilum vanderplanki GN=Tret1 PE=1 SV=1 116 511 2.0E-14
sp|P46896|GTR1_CHICK Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus GN=SLC2A1 PE=2 SV=1 82 504 2.0E-14
sp|P13355|GTR1_RABIT Solute carrier family 2, facilitated glucose transporter member 1 OS=Oryctolagus cuniculus GN=SLC2A1 PE=2 SV=1 102 509 3.0E-14
sp|Q0WWW9|XYLL3_ARATH D-xylose-proton symporter-like 3, chloroplastic OS=Arabidopsis thaliana GN=At5g59250 PE=2 SV=2 106 506 4.0E-14
sp|Q04162|YD387_YEAST Probable metabolite transport protein YDR387C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR387C PE=1 SV=1 89 509 7.0E-14
sp|Q90592|GTR2_CHICK Solute carrier family 2, facilitated glucose transporter member 2 OS=Gallus gallus GN=SLC2A2 PE=2 SV=1 102 520 8.0E-14
sp|Q2V4B9|PLST3_ARATH Probable plastidic glucose transporter 3 OS=Arabidopsis thaliana GN=At1g79820 PE=2 SV=2 106 505 9.0E-14
sp|B3NSE1|TRET1_DROER Facilitated trehalose transporter Tret1 OS=Drosophila erecta GN=Tret1 PE=3 SV=1 116 511 9.0E-14
sp|P58352|GTR3_BOVIN Solute carrier family 2, facilitated glucose transporter member 3 OS=Bos taurus GN=SLC2A3 PE=2 SV=1 102 527 1.0E-13
sp|B4MYA4|TRET1_DROWI Facilitated trehalose transporter Tret1 OS=Drosophila willistoni GN=Tret1 PE=3 SV=1 116 511 2.0E-13
sp|P43562|YFE0_YEAST Probable metabolite transport protein YFL040W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YFL040W PE=1 SV=1 105 509 4.0E-13
sp|Q9LTP6|EDL13_ARATH Putative sugar transporter ERD6-like 13 OS=Arabidopsis thaliana GN=At3g20460 PE=3 SV=2 102 394 5.0E-13
sp|Q6NWF1|GTR12_DANRE Solute carrier family 2, facilitated glucose transporter member 12 OS=Danio rerio GN=slc2a12 PE=2 SV=2 117 388 5.0E-13
sp|A9ZSY3|TRET1_BOMMO Facilitated trehalose transporter Tret1 OS=Bombyx mori GN=Tret1 PE=1 SV=1 108 505 5.0E-13
sp|Q96290|MSSP1_ARATH Monosaccharide-sensing protein 1 OS=Arabidopsis thaliana GN=MSSP1 PE=1 SV=2 94 264 6.0E-13
sp|Q0WQ63|ERDL8_ARATH Sugar transporter ERD6-like 8 OS=Arabidopsis thaliana GN=At3g05150 PE=2 SV=1 102 505 6.0E-13
sp|B4J913|TRET1_DROGR Facilitated trehalose transporter Tret1 OS=Drosophila grimshawi GN=Tret1 PE=3 SV=1 116 511 8.0E-13
sp|B4HNS0|TRE11_DROSE Facilitated trehalose transporter Tret1-1 OS=Drosophila sechellia GN=Tret1-1 PE=3 SV=1 108 511 1.0E-12
sp|Q94KE0|ERDL3_ARATH Sugar transporter ERD6-like 3 OS=Arabidopsis thaliana GN=SUGTL2 PE=2 SV=1 102 373 2.0E-12
sp|B4LPX5|TRET1_DROVI Facilitated trehalose transporter Tret1 OS=Drosophila virilis GN=Tret1 PE=3 SV=2 116 511 2.0E-12
sp|O44616|FGTH1_CAEEL Facilitated glucose transporter homolog OS=Caenorhabditis elegans GN=R09B5.11 PE=1 SV=2 78 447 2.0E-12
sp|Q9M0Z9|EDL15_ARATH Sugar transporter ERD6-like 15 OS=Arabidopsis thaliana GN=At4g04760 PE=3 SV=2 102 373 2.0E-12
sp|B4QBN2|TRE11_DROSI Facilitated trehalose transporter Tret1-1 OS=Drosophila simulans GN=Tret1-1 PE=3 SV=2 116 511 2.0E-12
sp|A9ZSY2|TRET1_APILI Facilitated trehalose transporter Tret1 OS=Apis mellifera ligustica GN=Tret1 PE=1 SV=1 116 508 2.0E-12
sp|Q07647|GTR3_RAT Solute carrier family 2, facilitated glucose transporter member 3 OS=Rattus norvegicus GN=Slc2a3 PE=1 SV=1 102 511 3.0E-12
sp|B3MG58|TRET1_DROAN Facilitated trehalose transporter Tret1 OS=Drosophila ananassae GN=Tret1 PE=3 SV=2 116 511 3.0E-12
sp|B4P624|TRET1_DROYA Facilitated trehalose transporter Tret1 OS=Drosophila yakuba GN=Tret1 PE=3 SV=1 116 511 4.0E-12
sp|Q8LBI9|EDL16_ARATH Sugar transporter ERD6-like 16 OS=Arabidopsis thaliana GN=At5g18840 PE=2 SV=2 54 505 4.0E-12
sp|Q5RET7|GTR5_PONAB Solute carrier family 2, facilitated glucose transporter member 5 OS=Pongo abelii GN=SLC2A5 PE=2 SV=1 102 336 4.0E-12
sp|Q27994|GTR4_BOVIN Solute carrier family 2, facilitated glucose transporter member 4 OS=Bos taurus GN=SLC2A4 PE=2 SV=2 102 386 5.0E-12
sp|O44827|FGT1_CAEEL Facilitated glucose transporter protein 1 OS=Caenorhabditis elegans GN=fgt-1 PE=1 SV=2 102 511 5.0E-12
sp|Q8LPQ8|MSSP2_ARATH Monosaccharide-sensing protein 2 OS=Arabidopsis thaliana GN=MSSP2 PE=1 SV=2 84 264 9.0E-12
sp|P32037|GTR3_MOUSE Solute carrier family 2, facilitated glucose transporter member 3 OS=Mus musculus GN=Slc2a3 PE=1 SV=1 102 511 1.0E-11
sp|P38142|YB91_YEAST Probable metabolite transport protein YBR241C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBR241C PE=1 SV=1 94 383 1.0E-11
sp|Q94AF9|EDL11_ARATH Sugar transporter ERD6-like 11 OS=Arabidopsis thaliana GN=At3g05165 PE=2 SV=2 105 505 1.0E-11
sp|B4KR05|TRET1_DROMO Facilitated trehalose transporter Tret1 OS=Drosophila mojavensis GN=Tret1 PE=3 SV=2 116 511 2.0E-11
sp|Q94CI6|EDL18_ARATH Sugar transporter ERD6-like 18 OS=Arabidopsis thaliana GN=SFP2 PE=2 SV=1 104 373 2.0E-11
sp|Q8IRI6|GTR1_DROME Glucose transporter type 1 OS=Drosophila melanogaster GN=Glut1 PE=2 SV=4 117 508 3.0E-11
sp|Q9NRM0|GTR9_HUMAN Solute carrier family 2, facilitated glucose transporter member 9 OS=Homo sapiens GN=SLC2A9 PE=1 SV=2 57 519 3.0E-11
sp|A1Z8N1|TRE11_DROME Facilitated trehalose transporter Tret1-1 OS=Drosophila melanogaster GN=Tret1-1 PE=1 SV=1 116 511 4.0E-11
sp|Q863Y9|GTR5_HORSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Equus caballus GN=SLC2A5 PE=2 SV=1 59 336 4.0E-11
sp|P58351|GTR2_BOVIN Solute carrier family 2, facilitated glucose transporter member 2 OS=Bos taurus GN=SLC2A2 PE=2 SV=2 103 336 5.0E-11
sp|P19357|GTR4_RAT Solute carrier family 2, facilitated glucose transporter member 4 OS=Rattus norvegicus GN=Slc2a4 PE=1 SV=1 102 386 5.0E-11
sp|Q3ECP7|ERDL5_ARATH Sugar transporter ERD6-like 5 OS=Arabidopsis thaliana GN=At1g54730 PE=2 SV=2 102 373 7.0E-11
sp|Q17NV8|TRET1_AEDAE Facilitated trehalose transporter Tret1 OS=Aedes aegypti GN=Tret1 PE=3 SV=1 121 511 8.0E-11
sp|Q5RB09|GTR9_PONAB Solute carrier family 2, facilitated glucose transporter member 9 OS=Pongo abelii GN=SLC2A9 PE=2 SV=1 57 519 1.0E-10
sp|A7MBE0|S22A1_BOVIN Solute carrier family 22 member 1 OS=Bos taurus GN=SLC22A1 PE=2 SV=1 105 506 1.0E-10
sp|Q93Z80|EDL10_ARATH Sugar transporter ERD6-like 10 OS=Arabidopsis thaliana GN=At3g05160 PE=2 SV=1 105 373 1.0E-10
sp|Q5R5T8|SVOP_PONAB Synaptic vesicle 2-related protein OS=Pongo abelii GN=SVOP PE=2 SV=1 96 503 2.0E-10
sp|Q9BYW1|GTR11_HUMAN Solute carrier family 2, facilitated glucose transporter member 11 OS=Homo sapiens GN=SLC2A11 PE=2 SV=1 62 516 2.0E-10
sp|P11168|GTR2_HUMAN Solute carrier family 2, facilitated glucose transporter member 2 OS=Homo sapiens GN=SLC2A2 PE=1 SV=1 103 519 2.0E-10
sp|Q8N4V2|SVOP_HUMAN Synaptic vesicle 2-related protein OS=Homo sapiens GN=SVOP PE=2 SV=1 96 503 2.0E-10
sp|Q9Y226|S22AD_HUMAN Solute carrier family 22 member 13 OS=Homo sapiens GN=SLC22A13 PE=2 SV=2 81 527 6.0E-10
sp|Q7PIR5|TRET1_ANOGA Facilitated trehalose transporter Tret1 OS=Anopheles gambiae GN=Tret1 PE=1 SV=3 116 511 9.0E-10
sp|Q9XSC2|GTR3_RABIT Solute carrier family 2, facilitated glucose transporter member 3 (Fragment) OS=Oryctolagus cuniculus GN=SLC2A3 PE=2 SV=1 134 527 1.0E-09
sp|P79365|GTR1_SHEEP Solute carrier family 2, facilitated glucose transporter member 1 (Fragment) OS=Ovis aries GN=SLC2A1 PE=2 SV=1 150 509 1.0E-09
sp|P22732|GTR5_HUMAN Solute carrier family 2, facilitated glucose transporter member 5 OS=Homo sapiens GN=SLC2A5 PE=1 SV=1 102 336 2.0E-09
sp|P46408|GTR5_RABIT Solute carrier family 2, facilitated glucose transporter member 5 OS=Oryctolagus cuniculus GN=SLC2A5 PE=2 SV=1 102 326 2.0E-09
sp|Q1JP63|SVOP_BOVIN Synaptic vesicle 2-related protein OS=Bos taurus GN=SVOP PE=2 SV=1 96 503 2.0E-09
sp|P14142|GTR4_MOUSE Solute carrier family 2, facilitated glucose transporter member 4 OS=Mus musculus GN=Slc2a4 PE=1 SV=3 102 386 2.0E-09
sp|Q6A4L0|S22AD_MOUSE Solute carrier family 22 member 13 OS=Mus musculus GN=Slc22a13 PE=1 SV=3 63 527 4.0E-09
sp|Q9UGQ3|GTR6_HUMAN Solute carrier family 2, facilitated glucose transporter member 6 OS=Homo sapiens GN=SLC2A6 PE=1 SV=2 102 509 6.0E-09
sp|Q2KIV1|S22A9_BOVIN Solute carrier family 22 member 9 OS=Bos taurus GN=SLC22A9 PE=2 SV=1 69 311 9.0E-09
sp|Q9VCA2|ORCT_DROME Organic cation transporter protein OS=Drosophila melanogaster GN=Orct PE=1 SV=1 102 383 1.0E-08
sp|Q5R9C4|S22A8_PONAB Solute carrier family 22 member 8 OS=Pongo abelii GN=SLC22A8 PE=2 SV=1 63 318 1.0E-08
sp|P14672|GTR4_HUMAN Solute carrier family 2, facilitated glucose transporter member 4 OS=Homo sapiens GN=SLC2A4 PE=1 SV=1 102 386 1.0E-08
sp|Q94CI7|EDL17_ARATH Sugar transporter ERD6-like 17 OS=Arabidopsis thaliana GN=SFP1 PE=2 SV=2 104 373 1.0E-08
sp|P30638|SVOP_CAEEL Putative transporter svop-1 OS=Caenorhabditis elegans GN=svop-1 PE=3 SV=5 106 295 4.0E-08
sp|O77504|S22A1_RABIT Solute carrier family 22 member 1 OS=Oryctolagus cuniculus GN=SLC22A1 PE=1 SV=1 105 506 4.0E-08
sp|O15244|S22A2_HUMAN Solute carrier family 22 member 2 OS=Homo sapiens GN=SLC22A2 PE=1 SV=2 104 454 6.0E-08
sp|Q63089|S22A1_RAT Solute carrier family 22 member 1 OS=Rattus norvegicus GN=Slc22a1 PE=1 SV=1 105 369 9.0E-08
sp|Q8BG39|SV2B_MOUSE Synaptic vesicle glycoprotein 2B OS=Mus musculus GN=Sv2b PE=1 SV=1 94 322 9.0E-08
sp|Q63564|SV2B_RAT Synaptic vesicle glycoprotein 2B OS=Rattus norvegicus GN=Sv2b PE=1 SV=1 94 322 1.0E-07
sp|Q2XWK0|SVOP_XENLA Synaptic vesicle 2-related protein OS=Xenopus laevis GN=svop PE=2 SV=1 96 503 1.0E-07
sp|P76230|YDJK_ECOLI Putative metabolite transport protein YdjK OS=Escherichia coli (strain K12) GN=ydjK PE=3 SV=1 94 469 2.0E-07
sp|Q5R5H7|S22A2_PONAB Solute carrier family 22 member 2 OS=Pongo abelii GN=SLC22A2 PE=2 SV=1 105 454 3.0E-07
sp|Q69ZS6|SV2C_MOUSE Synaptic vesicle glycoprotein 2C OS=Mus musculus GN=Sv2c PE=1 SV=2 94 290 3.0E-07
sp|Q496J9|SV2C_HUMAN Synaptic vesicle glycoprotein 2C OS=Homo sapiens GN=SV2C PE=1 SV=1 94 290 3.0E-07
sp|Q8TCC7|S22A8_HUMAN Solute carrier family 22 member 8 OS=Homo sapiens GN=SLC22A8 PE=1 SV=1 63 282 3.0E-07
sp|Q9Z2I6|SV2C_RAT Synaptic vesicle glycoprotein 2C OS=Rattus norvegicus GN=Sv2c PE=1 SV=1 94 290 3.0E-07
sp|Q8MJI6|S22A2_RABIT Solute carrier family 22 member 2 OS=Oryctolagus cuniculus GN=SLC22A2 PE=1 SV=1 105 525 5.0E-07
sp|O08966|S22A1_MOUSE Solute carrier family 22 member 1 OS=Mus musculus GN=Slc22a1 PE=1 SV=2 105 288 5.0E-07
sp|Q46909|YGCS_ECOLI Inner membrane metabolite transport protein YgcS OS=Escherichia coli (strain K12) GN=ygcS PE=1 SV=2 105 261 8.0E-07
sp|Q8BFT9|SVOP_MOUSE Synaptic vesicle 2-related protein OS=Mus musculus GN=Svop PE=1 SV=1 96 503 8.0E-07
sp|P31679|YAAU_ECOLI Putative metabolite transport protein YaaU OS=Escherichia coli (strain K12) GN=yaaU PE=3 SV=2 106 503 1.0E-06
sp|O64515|OCT2_ARATH Organic cation/carnitine transporter 2 OS=Arabidopsis thaliana GN=OCT2 PE=2 SV=1 103 258 2.0E-06
sp|Q7L1I2|SV2B_HUMAN Synaptic vesicle glycoprotein 2B OS=Homo sapiens GN=SV2B PE=1 SV=1 94 322 2.0E-06
sp|Q8WUG5|S22AH_HUMAN Solute carrier family 22 member 17 OS=Homo sapiens GN=SLC22A17 PE=2 SV=1 69 447 2.0E-06
sp|Q4W8A2|S22A8_MACFA Solute carrier family 22 member 8 OS=Macaca fascicularis GN=SLC22A8 PE=2 SV=1 69 282 2.0E-06
sp|Q863T6|S22A1_PIG Solute carrier family 22 member 1 OS=Sus scrofa GN=SLC22A1 PE=2 SV=1 180 506 4.0E-06
sp|P53142|VPS73_YEAST Vacuolar protein sorting-associated protein 73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS73 PE=1 SV=1 97 435 6.0E-06
sp|P58354|GTR8_BOVIN Solute carrier family 2, facilitated glucose transporter member 8 OS=Bos taurus GN=SLC2A8 PE=2 SV=2 117 511 7.0E-06
sp|O15245|S22A1_HUMAN Solute carrier family 22 member 1 OS=Homo sapiens GN=SLC22A1 PE=1 SV=2 106 392 7.0E-06
sp|Q27115|HT1_TRYVI Glucose transporter HT1 OS=Trypanosoma vivax GN=HT1 PE=3 SV=1 96 212 7.0E-06
sp|O02713|S22A2_PIG Solute carrier family 22 member 2 OS=Sus scrofa GN=SLC22A2 PE=2 SV=1 105 525 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.5

Transmembrane Domains

Domain # Start End Length
1 55 77 22
2 92 114 22
3 121 140 19
4 155 177 22
5 184 206 22
6 221 243 22
7 305 327 22
8 342 361 19
9 373 395 22
10 410 432 22
11 445 467 22
12 472 494 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11132
MDKSPHFAEGHDADPSLGKTAHESINEVQGDARFYESTHVAPLDPWSKTSIQLYLILLVAALNATASGFDGSIFS
SINAMSQYQEYFHQKELGSSTGIIFMMFTVGNMVGSLFTGPICDKFGRRVGMISGSVLIIVGAIVQTAARDEAYL
LGGRFVLGFGVAIGTSSAPTYALELAPPQWRARIVGYYNTFFYTGSILATGVAYASNKAQGELAFRLPLSLQIVP
PIFIATGAIFIPESPRWLTMWGRKDEAVRILAKYHGAGDPNHPTVQLEIREFEANIELQKASSVWNYWALVNTHN
ARWRFAMMAFMSIFAQLSGNSVLTYYLPSMYKLLGIVSTERRLLLTFMNSIVSCAGAIAGSATNDRIGRRTKLWM
GSLVLAGLLGAVTGFSSQFGDGKTNVSTSLSNGGVAFIFLFGCAYSFVYTPLTATYCAEVLDNPTRAKGMGVHVI
LSNCANLYNSYVTAIALEAIDWRYYLIFVGLNLLYGALWYIFGVETRGRTLEEMDEVFNARFPPRAALQKTTVVE
KDG*
Coding >Hirsu2|11132
ATGGACAAATCACCGCACTTCGCCGAGGGCCATGACGCCGACCCGTCGCTCGGCAAGACGGCCCACGAGAGCATC
AACGAGGTGCAGGGCGACGCTCGCTTCTACGAATCCACCCATGTCGCCCCTCTGGACCCTTGGTCCAAGACGAGC
ATCCAGCTGTATCTGATCCTGCTCGTCGCCGCCCTCAATGCGACGGCGTCGGGCTTCGATGGCTCCATCTTCAGC
TCCATCAACGCCATGAGCCAATACCAGGAATACTTCCACCAGAAGGAGCTCGGCTCGAGCACCGGCATCATATTC
ATGATGTTCACCGTCGGCAACATGGTCGGCTCCCTCTTCACCGGCCCCATCTGCGACAAGTTCGGCCGTCGGGTC
GGCATGATCTCCGGATCCGTCCTGATCATTGTTGGGGCCATCGTCCAGACGGCCGCTCGGGATGAGGCCTACCTC
CTGGGCGGTCGCTTCGTCCTCGGCTTCGGCGTCGCCATCGGCACCTCCTCTGCCCCGACGTACGCGCTCGAGCTG
GCGCCGCCGCAGTGGCGGGCTCGCATTGTCGGCTACTACAATACCTTCTTCTACACGGGATCCATCCTCGCCACC
GGCGTTGCCTATGCCTCCAACAAGGCCCAGGGCGAGTTGGCCTTCCGCCTCCCTCTCTCGCTCCAGATAGTTCCC
CCCATCTTCATCGCCACGGGAGCCATCTTCATCCCGGAATCGCCCCGCTGGCTCACCATGTGGGGGAGGAAGGAC
GAGGCCGTACGCATCCTGGCAAAGTATCATGGCGCCGGCGACCCGAACCATCCCACCGTCCAGCTCGAGATACGC
GAGTTCGAGGCCAACATTGAGCTGCAGAAGGCGTCTAGCGTCTGGAACTACTGGGCACTCGTCAATACGCATAAT
GCTCGATGGCGCTTTGCCATGATGGCCTTCATGTCCATCTTCGCCCAGCTGTCCGGGAACTCAGTTCTGACGTAC
TACCTGCCGTCTATGTACAAGCTGCTGGGAATCGTCTCGACCGAGCGCCGTCTCCTTCTCACCTTCATGAACTCG
ATCGTGTCCTGCGCCGGTGCGATCGCTGGCTCGGCCACAAACGATCGAATTGGACGACGCACCAAGCTGTGGATG
GGCAGCCTCGTGCTCGCCGGTCTCCTCGGCGCCGTGACGGGCTTCTCGAGCCAGTTCGGGGATGGAAAGACCAAC
GTTAGCACCAGTCTCTCTAACGGCGGCGTCGCTTTTATCTTCCTCTTCGGTTGCGCGTACTCCTTTGTCTACACG
CCGCTGACCGCCACCTATTGCGCCGAGGTGTTGGACAACCCGACTCGGGCCAAGGGAATGGGTGTGCATGTGATT
CTTTCCAACTGCGCCAATCTTTACAACTCATACGTGACGGCTATTGCGCTTGAGGCCATAGACTGGAGATACTAT
CTCATATTCGTCGGCTTGAACCTCCTGTACGGCGCCCTGTGGTATATCTTTGGTGTTGAGACTCGAGGACGCACG
CTGGAAGAAATGGACGAAGTCTTCAACGCAAGGTTCCCGCCGCGAGCGGCGCTACAGAAGACGACCGTGGTTGAA
AAGGACGGCTAA
Transcript >Hirsu2|11132
ATGGACAAATCACCGCACTTCGCCGAGGGCCATGACGCCGACCCGTCGCTCGGCAAGACGGCCCACGAGAGCATC
AACGAGGTGCAGGGCGACGCTCGCTTCTACGAATCCACCCATGTCGCCCCTCTGGACCCTTGGTCCAAGACGAGC
ATCCAGCTGTATCTGATCCTGCTCGTCGCCGCCCTCAATGCGACGGCGTCGGGCTTCGATGGCTCCATCTTCAGC
TCCATCAACGCCATGAGCCAATACCAGGAATACTTCCACCAGAAGGAGCTCGGCTCGAGCACCGGCATCATATTC
ATGATGTTCACCGTCGGCAACATGGTCGGCTCCCTCTTCACCGGCCCCATCTGCGACAAGTTCGGCCGTCGGGTC
GGCATGATCTCCGGATCCGTCCTGATCATTGTTGGGGCCATCGTCCAGACGGCCGCTCGGGATGAGGCCTACCTC
CTGGGCGGTCGCTTCGTCCTCGGCTTCGGCGTCGCCATCGGCACCTCCTCTGCCCCGACGTACGCGCTCGAGCTG
GCGCCGCCGCAGTGGCGGGCTCGCATTGTCGGCTACTACAATACCTTCTTCTACACGGGATCCATCCTCGCCACC
GGCGTTGCCTATGCCTCCAACAAGGCCCAGGGCGAGTTGGCCTTCCGCCTCCCTCTCTCGCTCCAGATAGTTCCC
CCCATCTTCATCGCCACGGGAGCCATCTTCATCCCGGAATCGCCCCGCTGGCTCACCATGTGGGGGAGGAAGGAC
GAGGCCGTACGCATCCTGGCAAAGTATCATGGCGCCGGCGACCCGAACCATCCCACCGTCCAGCTCGAGATACGC
GAGTTCGAGGCCAACATTGAGCTGCAGAAGGCGTCTAGCGTCTGGAACTACTGGGCACTCGTCAATACGCATAAT
GCTCGATGGCGCTTTGCCATGATGGCCTTCATGTCCATCTTCGCCCAGCTGTCCGGGAACTCAGTTCTGACGTAC
TACCTGCCGTCTATGTACAAGCTGCTGGGAATCGTCTCGACCGAGCGCCGTCTCCTTCTCACCTTCATGAACTCG
ATCGTGTCCTGCGCCGGTGCGATCGCTGGCTCGGCCACAAACGATCGAATTGGACGACGCACCAAGCTGTGGATG
GGCAGCCTCGTGCTCGCCGGTCTCCTCGGCGCCGTGACGGGCTTCTCGAGCCAGTTCGGGGATGGAAAGACCAAC
GTTAGCACCAGTCTCTCTAACGGCGGCGTCGCTTTTATCTTCCTCTTCGGTTGCGCGTACTCCTTTGTCTACACG
CCGCTGACCGCCACCTATTGCGCCGAGGTGTTGGACAACCCGACTCGGGCCAAGGGAATGGGTGTGCATGTGATT
CTTTCCAACTGCGCCAATCTTTACAACTCATACGTGACGGCTATTGCGCTTGAGGCCATAGACTGGAGATACTAT
CTCATATTCGTCGGCTTGAACCTCCTGTACGGCGCCCTGTGGTATATCTTTGGTGTTGAGACTCGAGGACGCACG
CTGGAAGAAATGGACGAAGTCTTCAACGCAAGGTTCCCGCCGCGAGCGGCGCTACAGAAGACGACCGTGGTTGAA
AAGGACGGCTAA
Gene >Hirsu2|11132
ATGGACAAATCACCGCACTTCGCCGAGGGCCATGACGCCGACCCGTCGCTCGGCAAGACGGCCCACGAGAGCATC
AACGAGGTGCAGGGCGACGCTCGCTTCTACGAATCCACCCATGTCGCCCCTCTGGACCCTTGGTCCAAGACGAGC
ATCCAGCTGTATCTGATCCTGCTCGTCGCCGCCCTCAATGCGACGGCGTCGGGCTTCGATGGCGTAGGTGCGCTG
CCGTCGCCCGCGGCTGAGCAGGTCGCTGATGTTCGCCCGTGCAGTCCATCTTCAGCTCCATCAACGCCATGAGCC
AATACCAGGAATACTTCCACCAGAAGGAGCTCGGCTCGAGCACCGGCATGTGAGTGCAAGCAGCAGCAGGCCCTG
TCACTCGTCCTGACTCTCGCCCCGCGCCAGCATATTCATGATGTTCACCGTCGGCAACATGGTCGGCTCCCTCTT
CACCGGCCCCATCTGCGACAAGTTCGGCCGTCGGGTCGGCATGATCTCCGGATCCGTCCTGATCATTGTTGGGGC
CATCGTCCAGACGGCCGCTCGGGATGAGGCCTACCTCCTGGGCGGTCGCTTCGTCCTCGGCTTCGGCGTCGCCAT
CGGCACCTCCTCTGCCCCGACGTACGCGCTCGAGCTGGCGCCGCCGCAGTGGCGGGCTCGCATTGTCGGCTACTA
CAATACCTGTAGGCGCCCCGTTGCAGAGGATCGAGCTCGTCTGACGCTGTTTGCTCACCACATACGACGGCAGTC
TTCTACACGGGATCCATCCTCGCCACCGGCGTTGCCTATGCCTCCAACAAGGCCCAGGGCGAGTTGGCCTTCCGC
CTCCCTCTCTCGCTCCAGATAGTTCCCCCCATCTTCATCGCCACGGGAGCCATCTTCATCCCGGAATCGCCCCGC
TGGCTCACCATGTGGGGGAGGAAGGACGAGGCCGTACGCATCCTGGCAAAGTATCATGGCGCCGGCGACCCGAAC
CATCCCACCGTCCAGCTCGAGATACGCGAGTTCGAGGCCAACATTGAGCTGCAGAAGGCGTCTAGCGTCTGGAAC
TACTGGGCACTCGTCAATACGCATAATGCTCGATGGCGCTTTGCCATGATGGCCTTCATGTCCATCTTCGCCCAG
CTGTCCGGGAACTCAGTTCTGACGTACTACCTGCCGTCTATGTACAAGCTGCTGGGAATCGTCTCGACCGAGCGC
CGTCTCCTTCTCACCTTCATGAACTCGATCGTGTCCTGCGCCGGTGCGATCGCTGGCTCGGCCACAAACGATCGA
ATTGGACGACGCACCAAGCTGTGGATGGGCAGCCTCGTGCTCGCCGGTCTCCTCGGCGCCGTGACGGGCTTCTCG
AGCCAGTTCGGGGATGGAAAGACCAACGTTAGCACCAGTCTCTCTAACGGCGGCGTCGCTTTTGTGAGTCGCCCA
TTGCGCCGAGCTTCTCGGAGGCCCCCTACGCGTGTGCTACTGACGAAAGCTAACCGATTCCCCAGATCTTCCTCT
TCGGTTGCGCGTACTCCTTTGTCTACACGCCGCTGACCGCCACCTATTGCGCCGAGGTGTTGGACAACCCGACTC
GGGCCAAGGGAATGGGTGTGGTAAGTAGCAAATCACTCTCGCCGCCCATACGTGCTGAGCTTCGGACTGACTGTT
GCAGCATGTGATTCTTTCCAACTGCGCCAATCTTTACAACTCATACGTGACGGCTATTGCGCTTGAGGCCATAGA
CTGGAGATACTATCTCATATTCGTCGGCTTGAACCTCCTGTACGGCGCCCTGTGGTATATCTTTGGTGTTGAGAC
TCGAGGACGCACGCTGGAAGAAATGGACGAAGTCTTCAACGCAAGGTTCCCGCCGCGAGCGGCGCTACAGAAGAC
GACCGTGGTTGAAAAGGACGGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail