Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11124
Gene name
LocationContig_967:5624..6448
Strand+
Gene length (bp)824
Transcript length (bp)771
Coding sequence length (bp)771
Protein length (aa) 257

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00320 GATA GATA zinc finger 2.2E-10 189 222

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q75JZ0|GTAH_DICDI GATA zinc finger domain-containing protein 8 OS=Dictyostelium discoideum GN=gtaH PE=3 SV=1 76 225 7.0E-07
sp|Q55C49|GTAG_DICDI GATA zinc finger domain-containing protein 7 OS=Dictyostelium discoideum GN=gtaG PE=3 SV=1 147 222 1.0E-06
sp|Q54TE3|GTAJ_DICDI GATA zinc finger domain-containing protein 10 OS=Dictyostelium discoideum GN=gtaJ PE=3 SV=1 189 223 2.0E-06
sp|Q10280|GAF1_SCHPO Transcription factor gaf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gaf1 PE=1 SV=2 135 215 3.0E-06

GO

GO Term Description Terminal node
GO:0043565 sequence-specific DNA binding Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0008270 zinc ion binding Yes
GO:0010468 regulation of gene expression No
GO:0060255 regulation of macromolecule metabolic process No
GO:0003677 DNA binding No
GO:0003674 molecular_function No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0009889 regulation of biosynthetic process No
GO:0051252 regulation of RNA metabolic process No
GO:0008150 biological_process No
GO:0043169 cation binding No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0050794 regulation of cellular process No
GO:0019222 regulation of metabolic process No
GO:0003676 nucleic acid binding No
GO:0031326 regulation of cellular biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:0065007 biological regulation No
GO:0031323 regulation of cellular metabolic process No
GO:0046914 transition metal ion binding No
GO:2000112 regulation of cellular macromolecule biosynthetic process No
GO:0080090 regulation of primary metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0050789 regulation of biological process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0043167 ion binding No
GO:2001141 regulation of RNA biosynthetic process No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
GATA type zinc finger

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11124
LHLRQHRPPSTDRLVTILCPGIDTATFMSVIARSPAAHEVPFATPRAPLLHGGRDLKVSLRKGVALATKSNAMSY
NALQQTESLNKIKGHADELVRIARQFPDRTAVSTNPVCEDELGAMLRLSVDIKTSLDTIASLRRRRENARPPTPA
AAATERQRPKRARPSEAYPAANRLGPTARPPKRSATPTCHNCEANFTPIWRMGPDGSTFCNVCGLIYAKRERRHA
DLRAARRRKTDAWLDEVKSVACRLDPMQRQC*
Coding >Hirsu2|11124
CTGCACCTTCGCCAGCATCGCCCTCCGTCCACCGATCGTCTCGTCACCATCCTCTGCCCGGGCATCGACACGGCC
ACGTTCATGTCTGTGATTGCCAGGTCGCCTGCCGCCCACGAGGTTCCCTTCGCGACGCCCAGAGCCCCGCTTCTC
CATGGCGGCCGGGACCTGAAGGTCAGCCTCCGCAAGGGCGTGGCGCTCGCCACCAAGTCCAACGCCATGTCCTAC
AACGCTCTGCAGCAGACGGAGAGCCTGAACAAGATCAAGGGCCATGCCGACGAGCTGGTGCGCATCGCCCGACAA
TTCCCCGACCGCACCGCCGTCTCGACCAATCCCGTGTGCGAGGACGAGCTGGGCGCCATGCTGCGCCTGTCCGTC
GACATCAAGACGAGCCTCGACACGATTGCGAGCCTGCGCCGGCGGCGGGAAAACGCCCGGCCCCCAACGCCGGCT
GCTGCCGCGACCGAACGCCAGCGGCCGAAGCGGGCCCGCCCGTCCGAAGCCTATCCGGCCGCCAACCGGCTCGGG
CCAACCGCCAGACCGCCCAAGCGGTCCGCCACCCCGACCTGCCACAACTGCGAGGCCAACTTCACGCCCATCTGG
CGCATGGGCCCCGACGGCAGCACCTTCTGCAACGTCTGCGGCCTCATCTACGCAAAGCGTGAGCGCAGGCACGCC
GACCTGCGCGCCGCCCGCCGCCGCAAGACGGACGCCTGGCTCGACGAGGTCAAGTCTGTCGCCTGCCGCCTTGAC
CCCATGCAGCGGCAGTGCTGA
Transcript >Hirsu2|11124
CTGCACCTTCGCCAGCATCGCCCTCCGTCCACCGATCGTCTCGTCACCATCCTCTGCCCGGGCATCGACACGGCC
ACGTTCATGTCTGTGATTGCCAGGTCGCCTGCCGCCCACGAGGTTCCCTTCGCGACGCCCAGAGCCCCGCTTCTC
CATGGCGGCCGGGACCTGAAGGTCAGCCTCCGCAAGGGCGTGGCGCTCGCCACCAAGTCCAACGCCATGTCCTAC
AACGCTCTGCAGCAGACGGAGAGCCTGAACAAGATCAAGGGCCATGCCGACGAGCTGGTGCGCATCGCCCGACAA
TTCCCCGACCGCACCGCCGTCTCGACCAATCCCGTGTGCGAGGACGAGCTGGGCGCCATGCTGCGCCTGTCCGTC
GACATCAAGACGAGCCTCGACACGATTGCGAGCCTGCGCCGGCGGCGGGAAAACGCCCGGCCCCCAACGCCGGCT
GCTGCCGCGACCGAACGCCAGCGGCCGAAGCGGGCCCGCCCGTCCGAAGCCTATCCGGCCGCCAACCGGCTCGGG
CCAACCGCCAGACCGCCCAAGCGGTCCGCCACCCCGACCTGCCACAACTGCGAGGCCAACTTCACGCCCATCTGG
CGCATGGGCCCCGACGGCAGCACCTTCTGCAACGTCTGCGGCCTCATCTACGCAAAGCGTGAGCGCAGGCACGCC
GACCTGCGCGCCGCCCGCCGCCGCAAGACGGACGCCTGGCTCGACGAGGTCAAGTCTGTCGCCTGCCGCCTTGAC
CCCATGCAGCGGCAGTGCTGA
Gene >Hirsu2|11124
CTGCACCTTCGCCAGCATCGCCCTCCGTCCACCGATCGTCTCGTCACCATCCTCTGCCCGGGCATCGACACGGCC
ACGTTCATGTCTGTGATTGCCAGGTCGCCTGCCGCCCACGAGGTTCCCTTCGCGACGCCCAGAGCCCCGCTTCTC
CATGGCGGCCGGGACCTGAAGGTCAGCCTCCGCAAGGGCGTGGCGCTCGCCACCAAGTCCAACGCCATGTCCTAC
AACGCTCTGCAGCAGACGGAGAGCCTGAACAAGGCGAGCTCTCCCCTTCCCTGGGCCTCGCCTGCTCCCGACTGA
CCCGTCGCCAGATCAAGGGCCATGCCGACGAGCTGGTGCGCATCGCCCGACAATTCCCCGACCGCACCGCCGTCT
CGACCAATCCCGTGTGCGAGGACGAGCTGGGCGCCATGCTGCGCCTGTCCGTCGACATCAAGACGAGCCTCGACA
CGATTGCGAGCCTGCGCCGGCGGCGGGAAAACGCCCGGCCCCCAACGCCGGCTGCTGCCGCGACCGAACGCCAGC
GGCCGAAGCGGGCCCGCCCGTCCGAAGCCTATCCGGCCGCCAACCGGCTCGGGCCAACCGCCAGACCGCCCAAGC
GGTCCGCCACCCCGACCTGCCACAACTGCGAGGCCAACTTCACGCCCATCTGGCGCATGGGCCCCGACGGCAGCA
CCTTCTGCAACGTCTGCGGCCTCATCTACGCAAAGCGTGAGCGCAGGCACGCCGACCTGCGCGCCGCCCGCCGCC
GCAAGACGGACGCCTGGCTCGACGAGGTCAAGTCTGTCGCCTGCCGCCTTGACCCCATGCAGCGGCAGTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail