Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|1112
Gene name
LocationContig_1233:4565..5536
Strand-
Gene length (bp)971
Transcript length (bp)918
Coding sequence length (bp)918
Protein length (aa) 306

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02045 CBFB_NFYA CCAAT-binding transcription factor (CBF-B/NF-YA) subunit B 6.6E-28 211 266

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P24488|HAP2_SCHPO Transcriptional activator hap2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hap2 PE=3 SV=1 212 304 6.0E-28
sp|P06774|HAP2_YEAST Transcriptional activator HAP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAP2 PE=1 SV=1 198 281 6.0E-27
sp|P53768|HAP2_KLULA Transcriptional activator HAP2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HAP2 PE=3 SV=1 209 283 2.0E-24
sp|Q84JP1|NFYA7_ARATH Nuclear transcription factor Y subunit A-7 OS=Arabidopsis thaliana GN=NFYA7 PE=2 SV=1 202 301 2.0E-22
sp|Q9LNP6|NFYA8_ARATH Nuclear transcription factor Y subunit A-8 OS=Arabidopsis thaliana GN=NFYA8 PE=2 SV=2 182 272 2.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P24488|HAP2_SCHPO Transcriptional activator hap2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hap2 PE=3 SV=1 212 304 6.0E-28
sp|P06774|HAP2_YEAST Transcriptional activator HAP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAP2 PE=1 SV=1 198 281 6.0E-27
sp|P53768|HAP2_KLULA Transcriptional activator HAP2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HAP2 PE=3 SV=1 209 283 2.0E-24
sp|Q84JP1|NFYA7_ARATH Nuclear transcription factor Y subunit A-7 OS=Arabidopsis thaliana GN=NFYA7 PE=2 SV=1 202 301 2.0E-22
sp|Q9LNP6|NFYA8_ARATH Nuclear transcription factor Y subunit A-8 OS=Arabidopsis thaliana GN=NFYA8 PE=2 SV=2 182 272 2.0E-20
sp|Q8VY64|NFYA4_ARATH Nuclear transcription factor Y subunit A-4 OS=Arabidopsis thaliana GN=NFYA4 PE=2 SV=1 194 295 8.0E-19
sp|P23708|NFYA_MOUSE Nuclear transcription factor Y subunit alpha OS=Mus musculus GN=Nfya PE=1 SV=2 208 271 1.0E-18
sp|Q9M9X4|NFYA2_ARATH Nuclear transcription factor Y subunit A-2 OS=Arabidopsis thaliana GN=NFYA2 PE=2 SV=1 208 290 1.0E-18
sp|P23511|NFYA_HUMAN Nuclear transcription factor Y subunit alpha OS=Homo sapiens GN=NFYA PE=1 SV=2 208 271 1.0E-18
sp|P18576|NFYA_RAT Nuclear transcription factor Y subunit alpha OS=Rattus norvegicus GN=Nfya PE=1 SV=1 208 271 2.0E-18
sp|Q5E9S2|NFYA_BOVIN Nuclear transcription factor Y subunit alpha OS=Bos taurus GN=NFYA PE=2 SV=1 208 271 2.0E-18
sp|Q9SYH4|NFYA5_ARATH Nuclear transcription factor Y subunit A-5 OS=Arabidopsis thaliana GN=NFYA5 PE=2 SV=1 202 272 4.0E-18
sp|Q93ZH2|NFYA3_ARATH Nuclear transcription factor Y subunit A-3 OS=Arabidopsis thaliana GN=NFYA3 PE=2 SV=2 176 272 5.0E-18
sp|Q54S29|NFYA_DICDI Nuclear transcription factor Y subunit alpha OS=Dictyostelium discoideum GN=nfyA PE=3 SV=1 209 276 1.0E-16
sp|Q9LXV5|NFYA1_ARATH Nuclear transcription factor Y subunit A-1 OS=Arabidopsis thaliana GN=NFYA1 PE=2 SV=1 202 305 2.0E-16
sp|Q945M9|NFYA9_ARATH Nuclear transcription factor Y subunit A-9 OS=Arabidopsis thaliana GN=NFYA9 PE=2 SV=1 182 266 2.0E-16
sp|Q9LVJ7|NFYA6_ARATH Nuclear transcription factor Y subunit A-6 OS=Arabidopsis thaliana GN=NFYA6 PE=2 SV=1 202 271 5.0E-16
sp|Q8LFU0|NFYAA_ARATH Nuclear transcription factor Y subunit A-10 OS=Arabidopsis thaliana GN=NFYA10 PE=2 SV=2 208 294 1.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0003700 DNA-binding transcription factor activity Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0065007 biological regulation No
GO:0060255 regulation of macromolecule metabolic process No
GO:0003674 molecular_function No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0009889 regulation of biosynthetic process No
GO:0051252 regulation of RNA metabolic process No
GO:0008150 biological_process No
GO:0050794 regulation of cellular process No
GO:0019222 regulation of metabolic process No
GO:0010468 regulation of gene expression No
GO:0031326 regulation of cellular biosynthetic process No
GO:0031323 regulation of cellular metabolic process No
GO:0140110 transcription regulator activity No
GO:2000112 regulation of cellular macromolecule biosynthetic process No
GO:0080090 regulation of primary metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0050789 regulation of biological process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:2001141 regulation of RNA biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
CCAAT-binding TF

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|1112
MMEYAQYPQQQQQNTHSGYAGSAASAGITSPTNHSVTQHAVHSSPLLNSQPPPPPPPQQQQQPPPPQPQQPNQHQ
GHGMYQPQYGVPQQGMQQVPYGMPGIQAAAMAATAAASGSNYPYMHSDPSIGQTSPRMAGDSSKKDTRQSPRINS
MSQIPGRRMSQVTSPGVPSGPAMMNHGGPRPGVAPPQIPPGQAMQHPQSPEMPTGAAEESPLYVNAKQFHRILKR
RVARQRLEEQLRLTSKGRKPYLHESRHNHAMRRPRGPGGRFLTADEVTALEKENKGEDANKTEGADAAAAKAADS
ADKHQ*
Coding >Hirsu2|1112
ATGATGGAATACGCGCAATATCCACAGCAGCAGCAGCAGAACACACATTCGGGTTACGCCGGCTCGGCCGCAAGC
GCCGGTATCACGTCGCCCACCAACCACAGCGTCACCCAGCACGCCGTGCACTCGTCGCCGCTCCTCAACTCGCAG
CCGCCGCCGCCACCGCCGCCCCAGCAGCAGCAGCAACCGCCGCCGCCGCAACCACAGCAGCCGAACCAACACCAG
GGCCACGGCATGTACCAGCCGCAGTACGGCGTGCCCCAGCAGGGCATGCAGCAGGTCCCCTACGGGATGCCGGGC
ATCCAGGCGGCCGCAATGGCCGCCACGGCCGCCGCCTCCGGCTCCAACTACCCCTACATGCACTCGGACCCCAGC
ATCGGCCAGACGTCGCCCAGGATGGCCGGCGACAGCTCCAAGAAGGACACGCGCCAGTCGCCCCGGATAAACAGC
ATGTCGCAAATACCCGGGCGGCGCATGAGCCAAGTGACGAGCCCCGGCGTGCCCAGCGGCCCGGCCATGATGAAC
CACGGCGGGCCGCGCCCCGGCGTCGCGCCCCCGCAGATCCCGCCCGGCCAGGCCATGCAGCACCCCCAATCGCCC
GAGATGCCGACCGGCGCGGCCGAGGAGTCGCCCCTGTACGTCAATGCGAAGCAGTTCCATCGGATCCTCAAGCGG
AGAGTGGCGCGCCAACGGCTGGAGGAGCAGCTGCGGCTGACGTCCAAGGGCCGGAAGCCCTACCTCCATGAGTCG
CGCCACAACCATGCCATGCGCCGGCCTCGCGGCCCGGGCGGCCGCTTCCTGACGGCCGACGAGGTGACGGCGCTG
GAGAAGGAGAACAAGGGCGAGGACGCGAACAAGACGGAGGGCGCAGACGCAGCCGCCGCCAAGGCCGCGGACTCC
GCAGACAAGCACCAATAG
Transcript >Hirsu2|1112
ATGATGGAATACGCGCAATATCCACAGCAGCAGCAGCAGAACACACATTCGGGTTACGCCGGCTCGGCCGCAAGC
GCCGGTATCACGTCGCCCACCAACCACAGCGTCACCCAGCACGCCGTGCACTCGTCGCCGCTCCTCAACTCGCAG
CCGCCGCCGCCACCGCCGCCCCAGCAGCAGCAGCAACCGCCGCCGCCGCAACCACAGCAGCCGAACCAACACCAG
GGCCACGGCATGTACCAGCCGCAGTACGGCGTGCCCCAGCAGGGCATGCAGCAGGTCCCCTACGGGATGCCGGGC
ATCCAGGCGGCCGCAATGGCCGCCACGGCCGCCGCCTCCGGCTCCAACTACCCCTACATGCACTCGGACCCCAGC
ATCGGCCAGACGTCGCCCAGGATGGCCGGCGACAGCTCCAAGAAGGACACGCGCCAGTCGCCCCGGATAAACAGC
ATGTCGCAAATACCCGGGCGGCGCATGAGCCAAGTGACGAGCCCCGGCGTGCCCAGCGGCCCGGCCATGATGAAC
CACGGCGGGCCGCGCCCCGGCGTCGCGCCCCCGCAGATCCCGCCCGGCCAGGCCATGCAGCACCCCCAATCGCCC
GAGATGCCGACCGGCGCGGCCGAGGAGTCGCCCCTGTACGTCAATGCGAAGCAGTTCCATCGGATCCTCAAGCGG
AGAGTGGCGCGCCAACGGCTGGAGGAGCAGCTGCGGCTGACGTCCAAGGGCCGGAAGCCCTACCTCCATGAGTCG
CGCCACAACCATGCCATGCGCCGGCCTCGCGGCCCGGGCGGCCGCTTCCTGACGGCCGACGAGGTGACGGCGCTG
GAGAAGGAGAACAAGGGCGAGGACGCGAACAAGACGGAGGGCGCAGACGCAGCCGCCGCCAAGGCCGCGGACTCC
GCAGACAAGCACCAATAG
Gene >Hirsu2|1112
ATGATGGAATACGCGCAATATCCACAGCAGCAGCAGCAGAACACACATTCGGGTTACGCCGGCTCGGCCGCAAGC
GCCGGTATCACGTCGCCCACCAACCACAGCGTCACCCAGCACGCCGTGCACTCGTCGCCGCTCCTCAACTCGCAG
CCGCCGCCGCCACCGCCGCCCCAGCAGCAGCAGCAACCGCCGCCGCCGCAACCACAGCAGCCGAACCAACACCAG
GGCCACGGCATGTACCAGCCGCAGTACGGCGTGCCCCAGCAGGGCATGCAGCAGGTCCCCTACGGGATGCCGGGC
ATCCAGGCGGCCGCAATGGCCGCCACGGCCGCCGCCTCCGGCTCCAACTACCCCTACATGCACTCGGACCCCAGC
ATCGGCCAGACGTCGCCCAGGATGGCCGGCGACAGCTCCAAGAAGGACACGCGCCAGTCGCCCCGGATAAACAGC
ATGTCGCAAATACCCGGGCGGCGCATGAGCCAAGTGACGAGCCCCGGCGTGCCCAGCGGCCCGGCCATGATGAAC
CACGGCGGGCCGCGCCCCGGCGTCGCGCCCCCGCAGATCCCGCCCGGCCAGGCCATGCAGCACCCCCAATCGCCC
GAGATGCCGACCGGCGCGGCCGAGGAGTCGCCCCTGTACGTCAATGCGAAGCAGTTCCATCGGATCCTCAAGCGG
AGAGTGGCGCGCCAACGGCTGGAGGAGCAGCTGCGGCTGACGTCCAAGGGCCGGAAGCCCTACCTCCATGAGTCG
CGCCACAACCATGCCATGCGCCGGCCTCGCGGCCCGGGCGGCCGCTTCCTGACGGCCGACGAGGTGACGGCGCTG
GAGAAGGAGAACAAGGGCGAGGACGCGAACAAGACGGAGGGCGCAGACGCAGCCGCCGCCAAGGCCGCGGACTCC
GCAGGTACGAAGCGCAAGTCCGAAGCCGCGTCGGGGTCTCCTAATAAGAAGTCCAAGACAAGCACCAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail