Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11116
Gene name
LocationContig_965:8593..9331
Strand-
Gene length (bp)738
Transcript length (bp)738
Coding sequence length (bp)738
Protein length (aa) 246

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02441 Flavoprotein Flavoprotein 1.4E-20 59 220

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P33751|PAD1_YEAST Flavin prenyltransferase PAD1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAD1 PE=1 SV=2 55 245 2.0E-69
sp|P69774|PADL_ECOLX Probable UbiX-like flavin prenyltransferase OS=Escherichia coli GN=ecdB PE=3 SV=1 59 243 2.0E-64
sp|P69772|PADL_ECO57 Probable UbiX-like flavin prenyltransferase OS=Escherichia coli O157:H7 GN=ecdB PE=1 SV=1 59 243 3.0E-64
sp|P69773|PADL_ECO11 Probable UbiX-like flavin prenyltransferase OS=Escherichia coli O111:H- GN=ecdB PE=3 SV=1 59 243 4.0E-63
sp|P94404|PADL_BACSU Probable UbiX-like flavin prenyltransferase OS=Bacillus subtilis (strain 168) GN=bsdB PE=1 SV=1 59 242 2.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P33751|PAD1_YEAST Flavin prenyltransferase PAD1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAD1 PE=1 SV=2 55 245 2.0E-69
sp|P69774|PADL_ECOLX Probable UbiX-like flavin prenyltransferase OS=Escherichia coli GN=ecdB PE=3 SV=1 59 243 2.0E-64
sp|P69772|PADL_ECO57 Probable UbiX-like flavin prenyltransferase OS=Escherichia coli O157:H7 GN=ecdB PE=1 SV=1 59 243 3.0E-64
sp|P69773|PADL_ECO11 Probable UbiX-like flavin prenyltransferase OS=Escherichia coli O111:H- GN=ecdB PE=3 SV=1 59 243 4.0E-63
sp|P94404|PADL_BACSU Probable UbiX-like flavin prenyltransferase OS=Bacillus subtilis (strain 168) GN=bsdB PE=1 SV=1 59 242 2.0E-60
sp|P57767|UBIX_THAAR Flavin prenyltransferase UbiX OS=Thauera aromatica GN=ubiX PE=3 SV=1 59 245 5.0E-60
sp|Q9JXP4|UBIX_NEIMB Flavin prenyltransferase UbiX OS=Neisseria meningitidis serogroup B (strain MC58) GN=ubiX PE=3 SV=2 58 242 1.0E-56
sp|Q9JW78|UBIX_NEIMA Flavin prenyltransferase UbiX OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=ubiX PE=3 SV=1 58 242 6.0E-56
sp|Q9ZD09|UBIX_RICPR Flavin prenyltransferase UbiX OS=Rickettsia prowazekii (strain Madrid E) GN=ubiX PE=3 SV=1 65 240 5.0E-54
sp|O29054|UBIX_ARCFU Flavin prenyltransferase UbiX OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=ubiX PE=3 SV=1 59 239 3.0E-52
sp|Q57566|UBIX_METJA Flavin prenyltransferase UbiX OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ubiX PE=3 SV=1 59 239 4.0E-50
sp|P0AG03|UBIX_ECOLI Flavin prenyltransferase UbiX OS=Escherichia coli (strain K12) GN=ubiX PE=2 SV=1 58 241 7.0E-50
sp|P0AG04|UBIX_ECO57 Flavin prenyltransferase UbiX OS=Escherichia coli O157:H7 GN=ubiX PE=3 SV=1 58 241 7.0E-50
sp|Q4R101|PADL_SEDHY Probable UbiX-like flavin prenyltransferase OS=Sedimentibacter hydroxybenzoicus GN=shdB PE=3 SV=1 59 241 3.0E-49
sp|P0A245|UBIX_SALTY Flavin prenyltransferase UbiX OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ubiX PE=3 SV=1 58 241 1.0E-46
sp|P0A246|UBIX_SALTI Flavin prenyltransferase UbiX OS=Salmonella typhi GN=ubiX PE=3 SV=1 58 241 1.0E-46
sp|O58742|UBIX_PYRHO Flavin prenyltransferase UbiX OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=ubiX PE=3 SV=1 59 240 7.0E-46
sp|Q9V030|UBIX_PYRAB Flavin prenyltransferase UbiX OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=ubiX PE=3 SV=1 59 240 8.0E-46
sp|O26250|UBIX_METTH Flavin prenyltransferase UbiX OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=ubiX PE=3 SV=1 58 241 5.0E-44
sp|Q9HJ72|UBIX_THEAC Flavin prenyltransferase UbiX OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=ubiX PE=3 SV=1 59 239 6.0E-44
sp|Q9RR91|UBIX_DEIRA Flavin prenyltransferase UbiX OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=ubiX PE=3 SV=1 59 239 6.0E-42
sp|Q9KCC2|UBIX_BACHD Flavin prenyltransferase UbiX OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=ubiX PE=3 SV=1 62 240 1.0E-41
sp|O66811|UBIX_AQUAE Flavin prenyltransferase UbiX OS=Aquifex aeolicus (strain VF5) GN=ubiX PE=1 SV=1 58 241 5.0E-39
sp|P94300|UBIX_BACPE Flavin prenyltransferase UbiX OS=Bacillus pseudofirmus (strain OF4) GN=ubiX PE=3 SV=1 53 240 2.0E-38
sp|Q9HX08|UBIX_PSEAE Flavin prenyltransferase UbiX OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ubiX PE=1 SV=1 58 239 2.0E-37
sp|Q9Z8S4|UBIX_CHLPN Flavin prenyltransferase UbiX OS=Chlamydia pneumoniae GN=ubiX PE=3 SV=1 58 241 2.0E-34
sp|P72743|UBIX_SYNY3 Flavin prenyltransferase UbiX OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ubiX PE=3 SV=1 60 241 4.0E-34
sp|Q9PKH2|UBIX_CHLMU Flavin prenyltransferase UbiX OS=Chlamydia muridarum (strain MoPn / Nigg) GN=ubiX PE=3 SV=1 58 239 8.0E-34
sp|Q9KP38|UBIX_VIBCH Flavin prenyltransferase UbiX OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ubiX PE=3 SV=1 56 245 8.0E-34
sp|Q9Y8K8|UBIX_SULSO Flavin prenyltransferase UbiX OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=ubiX PE=3 SV=2 56 241 9.0E-34
sp|O84222|UBIX_CHLTR Flavin prenyltransferase UbiX OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=ubiX PE=3 SV=1 58 239 1.0E-32
sp|Q9YBF0|UBIX_AERPE Flavin prenyltransferase UbiX OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=ubiX PE=3 SV=1 62 241 8.0E-32
sp|O26011|UBIX_HELPY Flavin prenyltransferase UbiX OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=ubiX PE=3 SV=1 59 239 6.0E-27
sp|Q9ZJE3|UBIX_HELPJ Flavin prenyltransferase UbiX OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=ubiX PE=3 SV=1 59 239 2.0E-26
sp|Q9KYP1|UBIX_STRCO Flavin prenyltransferase UbiX OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=ubiX PE=3 SV=1 61 241 1.0E-25
sp|Q9PPF1|UBIX_CAMJE Flavin prenyltransferase UbiX OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=ubiX PE=3 SV=1 122 242 1.0E-23
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 60 79 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11116
MARTWSPPSSPAVEMEEDMEAEDEQQQQQHEEEQVSAAATTTVAAGGGPTAALAPRRRRIIVAMTGATGAPLGIA
TLLALRRLGVETHLVTSRWADRTLRHETDYTPATARALADAAHANADLGSPLASGSFRVDGMVVVPCSMRALAAV
ARGLGGDLVARAADVVLKERRRLVLVARECPLSLVHLDNMAAASRAGAVVFPPVPAFYARPASVQDLVDHTVGRI
LDLFDLDAGNFDRWAGFPAR*
Coding >Hirsu2|11116
ATGGCGCGGACGTGGTCGCCGCCGTCGTCGCCCGCAGTAGAGATGGAGGAGGACATGGAGGCGGAGGACGAGCAG
CAGCAGCAGCAGCACGAAGAAGAACAAGTGAGCGCGGCGGCGACAACAACAGTAGCAGCAGGAGGAGGACCGACG
GCGGCGCTGGCCCCCCGACGGCGGCGCATCATCGTCGCCATGACGGGCGCGACAGGCGCACCGCTCGGCATCGCC
ACGCTGCTGGCCCTGCGCCGGCTCGGCGTCGAGACGCACCTGGTGACGAGCCGGTGGGCGGACCGGACGCTGCGG
CACGAGACGGACTACACGCCGGCGACGGCGCGGGCGCTGGCCGACGCGGCGCACGCCAACGCCGACCTCGGCTCG
CCGCTGGCCAGCGGCTCGTTCCGCGTCGACGGCATGGTCGTCGTGCCGTGCAGCATGCGCGCGCTGGCGGCCGTC
GCCCGCGGCCTGGGCGGCGACCTCGTCGCCCGCGCCGCCGACGTCGTCCTCAAGGAGCGCCGCCGCCTCGTCCTC
GTCGCGCGCGAGTGCCCCCTCAGCCTCGTCCATCTCGACAACATGGCTGCCGCCTCGCGCGCCGGCGCCGTCGTC
TTCCCCCCCGTCCCGGCCTTCTACGCCCGCCCGGCCTCGGTCCAGGACCTCGTCGACCACACCGTCGGCCGCATC
CTTGACCTCTTCGACCTCGACGCCGGCAACTTTGACCGCTGGGCTGGCTTTCCCGCCCGCTGA
Transcript >Hirsu2|11116
ATGGCGCGGACGTGGTCGCCGCCGTCGTCGCCCGCAGTAGAGATGGAGGAGGACATGGAGGCGGAGGACGAGCAG
CAGCAGCAGCAGCACGAAGAAGAACAAGTGAGCGCGGCGGCGACAACAACAGTAGCAGCAGGAGGAGGACCGACG
GCGGCGCTGGCCCCCCGACGGCGGCGCATCATCGTCGCCATGACGGGCGCGACAGGCGCACCGCTCGGCATCGCC
ACGCTGCTGGCCCTGCGCCGGCTCGGCGTCGAGACGCACCTGGTGACGAGCCGGTGGGCGGACCGGACGCTGCGG
CACGAGACGGACTACACGCCGGCGACGGCGCGGGCGCTGGCCGACGCGGCGCACGCCAACGCCGACCTCGGCTCG
CCGCTGGCCAGCGGCTCGTTCCGCGTCGACGGCATGGTCGTCGTGCCGTGCAGCATGCGCGCGCTGGCGGCCGTC
GCCCGCGGCCTGGGCGGCGACCTCGTCGCCCGCGCCGCCGACGTCGTCCTCAAGGAGCGCCGCCGCCTCGTCCTC
GTCGCGCGCGAGTGCCCCCTCAGCCTCGTCCATCTCGACAACATGGCTGCCGCCTCGCGCGCCGGCGCCGTCGTC
TTCCCCCCCGTCCCGGCCTTCTACGCCCGCCCGGCCTCGGTCCAGGACCTCGTCGACCACACCGTCGGCCGCATC
CTTGACCTCTTCGACCTCGACGCCGGCAACTTTGACCGCTGGGCTGGCTTTCCCGCCCGCTGA
Gene >Hirsu2|11116
ATGGCGCGGACGTGGTCGCCGCCGTCGTCGCCCGCAGTAGAGATGGAGGAGGACATGGAGGCGGAGGACGAGCAG
CAGCAGCAGCAGCACGAAGAAGAACAAGTGAGCGCGGCGGCGACAACAACAGTAGCAGCAGGAGGAGGACCGACG
GCGGCGCTGGCCCCCCGACGGCGGCGCATCATCGTCGCCATGACGGGCGCGACAGGCGCACCGCTCGGCATCGCC
ACGCTGCTGGCCCTGCGCCGGCTCGGCGTCGAGACGCACCTGGTGACGAGCCGGTGGGCGGACCGGACGCTGCGG
CACGAGACGGACTACACGCCGGCGACGGCGCGGGCGCTGGCCGACGCGGCGCACGCCAACGCCGACCTCGGCTCG
CCGCTGGCCAGCGGCTCGTTCCGCGTCGACGGCATGGTCGTCGTGCCGTGCAGCATGCGCGCGCTGGCGGCCGTC
GCCCGCGGCCTGGGCGGCGACCTCGTCGCCCGCGCCGCCGACGTCGTCCTCAAGGAGCGCCGCCGCCTCGTCCTC
GTCGCGCGCGAGTGCCCCCTCAGCCTCGTCCATCTCGACAACATGGCTGCCGCCTCGCGCGCCGGCGCCGTCGTC
TTCCCCCCCGTCCCGGCCTTCTACGCCCGCCCGGCCTCGGTCCAGGACCTCGTCGACCACACCGTCGGCCGCATC
CTTGACCTCTTCGACCTCGACGCCGGCAACTTTGACCGCTGGGCTGGCTTTCCCGCCCGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail