Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11112
Gene name
LocationContig_964:3216..5109
Strand+
Gene length (bp)1893
Transcript length (bp)1551
Coding sequence length (bp)1551
Protein length (aa) 517

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.2E-06 11 69
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 6.3E-06 17 84

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11112
MGADINVDVLIIGMGPTGLGAAKRLNQINGPSWLILDSSDKAGGLASTDVTPEGFLYDVGGHVIFSHYKYFDDCI
DEALPKEDDWFTHQRISYVRYKGLWVPYPFQNNISMLPKEDQVKCMDGLIDAAMECRVANAKPKDFDEWIVRMTG
TGIADIFMRPYNYKVWAVPTTKMQCQWLGERVAAPDIKTVTKNVILNKVAGNWGPNATFRFPARDGTGGIWIAVA
DTLPKSKKRFGKQGEVTKVDAAKKVVTLADGTTVGYGKLVNTMAVDHLVEKMGNQELIGLSKGLFYSTTHVIGVG
IRGSRPDRIGDKCWLYFPEDNCPFYRATIFSNYSPYNQPQDDVKLPTMYLADGTKGSSQAKQGPYWSIMLEVSQS
SMKPVDEKNLVRDCIQGLINTEMLKPEDEIVSTYHRRFDHGYPTPTLEREGVLKELLPKLQDMGIYSRGRFGSWR
YEVGNQDHSFMLGVEAADHIVNGAVELTLNYPDFVNTRPNNERRLAQTFNFAKTAEANGSAIKPGR*
Coding >Hirsu2|11112
ATGGGCGCCGACATTAACGTTGATGTCCTCATCATTGGCATGGGACCTACGGGTCTCGGTGCTGCCAAGCGCCTC
AACCAGATCAACGGCCCCTCGTGGCTGATTCTCGACTCCTCCGACAAGGCTGGCGGTCTTGCCAGCACAGACGTC
ACGCCCGAGGGTTTCCTCTACGACGTCGGAGGCCACGTCATCTTCTCGCACTACAAGTACTTCGACGACTGCATC
GACGAAGCCCTGCCCAAGGAGGATGACTGGTTCACCCACCAGCGCATCTCCTACGTCCGCTACAAGGGCCTCTGG
GTCCCCTACCCCTTCCAGAACAACATCTCCATGCTGCCCAAGGAGGACCAGGTCAAGTGCATGGACGGCCTCATC
GACGCCGCCATGGAGTGCCGCGTCGCCAACGCCAAGCCCAAGGACTTCGACGAGTGGATCGTGCGCATGACGGGC
ACCGGCATCGCAGACATCTTCATGCGGCCCTACAACTACAAGGTCTGGGCCGTGCCCACCACCAAGATGCAATGC
CAATGGCTCGGAGAGCGCGTGGCTGCCCCGGACATCAAGACGGTCACCAAGAACGTCATCCTCAACAAGGTCGCC
GGCAACTGGGGCCCCAATGCCACCTTCCGCTTCCCTGCCCGCGACGGCACCGGCGGCATCTGGATCGCCGTGGCC
GACACCCTGCCCAAGAGCAAGAAGCGCTTCGGCAAGCAGGGCGAGGTCACCAAGGTCGACGCCGCCAAGAAGGTC
GTCACCCTGGCCGACGGCACCACCGTCGGCTACGGCAAGCTCGTCAACACCATGGCCGTCGACCACCTGGTCGAG
AAGATGGGCAACCAGGAGCTCATCGGCCTGTCCAAGGGCCTCTTCTACTCGACGACCCACGTCATCGGCGTCGGC
ATCCGTGGATCGCGCCCTGACCGCATCGGCGACAAGTGCTGGCTGTACTTCCCCGAAGACAACTGCCCCTTCTAC
CGCGCCACCATCTTCTCCAACTACTCGCCCTACAACCAGCCCCAGGACGACGTCAAGCTGCCGACCATGTACCTC
GCCGACGGCACCAAGGGCTCGTCCCAGGCCAAGCAGGGCCCCTACTGGTCCATCATGCTCGAGGTCTCCCAGTCG
TCGATGAAGCCGGTGGACGAGAAGAACCTGGTCCGGGACTGCATCCAGGGCCTGATCAACACCGAGATGCTCAAG
CCCGAGGACGAGATCGTCTCGACCTACCACCGCCGCTTCGACCACGGCTACCCCACCCCGACCCTGGAACGCGAG
GGTGTGCTGAAGGAGCTGCTGCCCAAGCTCCAGGACATGGGCATCTACTCGCGCGGCCGCTTCGGCAGCTGGCGA
TACGAGGTCGGCAACCAGGACCACTCGTTCATGCTGGGCGTCGAGGCCGCGGACCACATCGTCAACGGCGCCGTC
GAGCTGACGCTGAACTACCCCGACTTCGTCAACACGCGGCCCAACAACGAACGGCGCCTGGCCCAGACCTTTAAC
TTTGCCAAGACGGCCGAGGCCAACGGCAGCGCCATCAAGCCGGGCAGGTAG
Transcript >Hirsu2|11112
ATGGGCGCCGACATTAACGTTGATGTCCTCATCATTGGCATGGGACCTACGGGTCTCGGTGCTGCCAAGCGCCTC
AACCAGATCAACGGCCCCTCGTGGCTGATTCTCGACTCCTCCGACAAGGCTGGCGGTCTTGCCAGCACAGACGTC
ACGCCCGAGGGTTTCCTCTACGACGTCGGAGGCCACGTCATCTTCTCGCACTACAAGTACTTCGACGACTGCATC
GACGAAGCCCTGCCCAAGGAGGATGACTGGTTCACCCACCAGCGCATCTCCTACGTCCGCTACAAGGGCCTCTGG
GTCCCCTACCCCTTCCAGAACAACATCTCCATGCTGCCCAAGGAGGACCAGGTCAAGTGCATGGACGGCCTCATC
GACGCCGCCATGGAGTGCCGCGTCGCCAACGCCAAGCCCAAGGACTTCGACGAGTGGATCGTGCGCATGACGGGC
ACCGGCATCGCAGACATCTTCATGCGGCCCTACAACTACAAGGTCTGGGCCGTGCCCACCACCAAGATGCAATGC
CAATGGCTCGGAGAGCGCGTGGCTGCCCCGGACATCAAGACGGTCACCAAGAACGTCATCCTCAACAAGGTCGCC
GGCAACTGGGGCCCCAATGCCACCTTCCGCTTCCCTGCCCGCGACGGCACCGGCGGCATCTGGATCGCCGTGGCC
GACACCCTGCCCAAGAGCAAGAAGCGCTTCGGCAAGCAGGGCGAGGTCACCAAGGTCGACGCCGCCAAGAAGGTC
GTCACCCTGGCCGACGGCACCACCGTCGGCTACGGCAAGCTCGTCAACACCATGGCCGTCGACCACCTGGTCGAG
AAGATGGGCAACCAGGAGCTCATCGGCCTGTCCAAGGGCCTCTTCTACTCGACGACCCACGTCATCGGCGTCGGC
ATCCGTGGATCGCGCCCTGACCGCATCGGCGACAAGTGCTGGCTGTACTTCCCCGAAGACAACTGCCCCTTCTAC
CGCGCCACCATCTTCTCCAACTACTCGCCCTACAACCAGCCCCAGGACGACGTCAAGCTGCCGACCATGTACCTC
GCCGACGGCACCAAGGGCTCGTCCCAGGCCAAGCAGGGCCCCTACTGGTCCATCATGCTCGAGGTCTCCCAGTCG
TCGATGAAGCCGGTGGACGAGAAGAACCTGGTCCGGGACTGCATCCAGGGCCTGATCAACACCGAGATGCTCAAG
CCCGAGGACGAGATCGTCTCGACCTACCACCGCCGCTTCGACCACGGCTACCCCACCCCGACCCTGGAACGCGAG
GGTGTGCTGAAGGAGCTGCTGCCCAAGCTCCAGGACATGGGCATCTACTCGCGCGGCCGCTTCGGCAGCTGGCGA
TACGAGGTCGGCAACCAGGACCACTCGTTCATGCTGGGCGTCGAGGCCGCGGACCACATCGTCAACGGCGCCGTC
GAGCTGACGCTGAACTACCCCGACTTCGTCAACACGCGGCCCAACAACGAACGGCGCCTGGCCCAGACCTTTAAC
TTTGCCAAGACGGCCGAGGCCAACGGCAGCGCCATCAAGCCGGGCAGGTAG
Gene >Hirsu2|11112
ATGGGCGCCGACATGTGAGTCCGCACCCATCTGCTTCTGCATCTGCTTTCGCCTGCTCGGCCTGGGATTCCCGCG
ACCGAGACTGACGCGGCTCTCCCAGTAACGTTGATGTCCTCATCATTGGCATGGGACCTACGGGTCTCGGTGCTG
CCAAGCGCCTCAACCAGATCGTGAGCTCCCTCACCGCCCCATCGCCACCACACACGGCGGCACAAGACGACGGCG
GCTGACAGAACGGGCGAACAGAACGGCCCCTCGTGGCTGATTCTCGACTCCTCCGACAAGGCTGGCGGTCTTGCC
AGCACAGACGTCACGCCCGAGGGTTTCGTACGTCCTCTCCCCGGCCCCGGCGACGCTGGACGCCCGCCGCTGACT
TGGACCAGCTCTACGACGTCGGAGGCCACGTCATCTTCTCGCACTACAAGTACTTCGACGACTGCATCGACGAAG
CCCTGCCCAAGGAGGATGACTGGTTCACCCACCAGCGCATCTCCTACGTCCGCTACAAGGGCCTCTGGGTCCCCT
ACCCCTTCCAGAACAACATCTCCATGCTGCCCAAGGAGGACCAGGTCAAGTGCATGGACGGCCTCATCGACGCCG
CCATGGAGTGCCGCGTCGCCAACGCCAAGCCCAAGGACTTCGACGAGTGGATCGTGCGCATGACGGGCACCGGCA
TCGCAGACATCTTCATGCGGCCCTACAACTACAAGGTCTGGGCCGTGCCCACCACCAAGGTATGCGCAACCAACC
GCCCGCACGGGACCCGAGACGGGCTCGGCTGCTGACGCCGCGTCCCCCTGCCTCCAGATGCAATGCCAATGGCTC
GGAGAGCGCGTGGCTGCCCCGGACATCAAGACGGTCACCAAGAACGTCATCCTCAACAAGGTCGCCGGCAACTGG
GGCCCCAATGCCACCTTCCGCTTCCCTGCCCGCGACGGCACCGGCGGCATCTGGATCGCCGTGGCCGACACCCTG
CCCAAGAGCAAGAAGCGCTTCGGCAAGCAGGGCGAGGTCACCAAGGTCGACGCCGCCAAGAAGGTCGTCACCCTG
GCCGACGGCACCACCGTCGGCTACGGCAAGCTCGTCAACACCATGGCCGTCGACCACCTGGTCGAGAAGATGGGC
AACCAGGAGCTCATCGGCCTGTCCAAGGGCCTCTTCTACTCGACGACCCACGTCATCGGCGTCGGCATCCGTGGA
TCGCGCCCTGACCGCATCGGCGACAAGTGCTGGGTAAGACTGCCTGCCCCTTCCGCCGTCGCACGAGGCTGACTC
TGGCGGCAGCTGTACTTCCCCGAAGACAACTGCCCCTTCTACCGCGCCACCATCTTCTCCAACTACTCGCCCTAC
AACCAGCCCCAGGACGACGTCAAGCTGCCGACCATGTACCTCGCCGACGGCACCAAGGGCTCGTCCCAGGCCAAG
CAGGGCCCCTACTGGTCCATCATGCTCGAGGTCTCCCAGTCGTCGATGAAGCCGGTGGACGAGAAGAACCTGGTC
CGGGACTGCATCCAGGGCCTGATCAACACCGAGATGCTCAAGCCCGAGGACGAGATCGTCTCGACCTACCACCGC
CGCTTCGACCACGGCTACCCCACCCCGACCCTGGAACGCGAGGGTGTGCTGAAGGAGCTGCTGCCCAAGCTCCAG
GACATGGGCATCTACTCGCGCGGCCGCTTCGGCAGCTGGCGATACGAGGTCGGCAACCAGGACCACTCGTTCATG
CTGGGCGTCGAGGCCGCGGACCACATCGTCAACGGCGCCGTCGAGCTGACGCTGAACTACCCCGACTTCGTCAAC
ACGCGGCCCAACAACGAACGGCGCCTGGCCCAGACCTTTAACTTTGCCAAGACGGCCGAGGCCAACGGCAGCGCC
ATCAAGCCGGGCAGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail