Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|11100
Gene name
LocationContig_961:7584..8681
Strand+
Gene length (bp)1097
Transcript length (bp)918
Coding sequence length (bp)918
Protein length (aa) 306

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00406 ADK Adenylate kinase 3.2E-41 112 275
PF13207 AAA_17 AAA domain 8.5E-33 113 253
PF13238 AAA_18 AAA domain 5.1E-07 111 251

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P15700|KCY_YEAST Uridylate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URA6 PE=1 SV=1 92 301 1.0E-78
sp|O59845|KCY_LENED UMP-CMP kinase OS=Lentinula edodes GN=uck1 PE=1 SV=1 107 293 2.0E-76
sp|O59771|KCY_SCHPO Uridylate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1795.05c PE=3 SV=1 108 301 6.0E-70
sp|Q5ZKE7|KCY_CHICK UMP-CMP kinase OS=Gallus gallus GN=CMPK PE=2 SV=1 108 290 8.0E-64
sp|Q9DBP5|KCY_MOUSE UMP-CMP kinase OS=Mus musculus GN=Cmpk1 PE=1 SV=1 109 295 4.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P15700|KCY_YEAST Uridylate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URA6 PE=1 SV=1 92 301 1.0E-78
sp|O59845|KCY_LENED UMP-CMP kinase OS=Lentinula edodes GN=uck1 PE=1 SV=1 107 293 2.0E-76
sp|O59771|KCY_SCHPO Uridylate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1795.05c PE=3 SV=1 108 301 6.0E-70
sp|Q5ZKE7|KCY_CHICK UMP-CMP kinase OS=Gallus gallus GN=CMPK PE=2 SV=1 108 290 8.0E-64
sp|Q9DBP5|KCY_MOUSE UMP-CMP kinase OS=Mus musculus GN=Cmpk1 PE=1 SV=1 109 295 4.0E-60
sp|Q4KM73|KCY_RAT UMP-CMP kinase OS=Rattus norvegicus GN=Cmpk1 PE=1 SV=2 109 295 4.0E-60
sp|Q7ZX23|KCY_XENLA UMP-CMP kinase OS=Xenopus laevis GN=cmpk1 PE=2 SV=2 109 294 5.0E-60
sp|Q28H12|KCY_XENTR UMP-CMP kinase OS=Xenopus tropicalis GN=cmpk1 PE=2 SV=2 109 294 5.0E-60
sp|P30085|KCY_HUMAN UMP-CMP kinase OS=Homo sapiens GN=CMPK1 PE=1 SV=3 109 290 2.0E-59
sp|Q29561|KCY_PIG UMP-CMP kinase OS=Sus scrofa GN=CMPK1 PE=1 SV=1 109 290 4.0E-59
sp|Q7ZWE9|KCY_DANRE UMP-CMP kinase OS=Danio rerio GN=cmpk PE=2 SV=2 109 297 4.0E-59
sp|Q2KIW9|KCY_BOVIN UMP-CMP kinase OS=Bos taurus GN=CMPK1 PE=2 SV=2 109 290 4.0E-59
sp|O04905|KCY3_ARATH UMP-CMP kinase 3 OS=Arabidopsis thaliana GN=UMK3 PE=1 SV=1 108 303 2.0E-57
sp|Q7XI40|KCY3_ORYSJ UMP-CMP kinase 3 OS=Oryza sativa subsp. japonica GN=URA6 PE=2 SV=1 107 303 3.0E-57
sp|Q6K7H2|KCY4_ORYSJ UMP-CMP kinase 4 OS=Oryza sativa subsp. japonica GN=Os02g0778400 PE=2 SV=1 107 294 2.0E-54
sp|Q20140|KAD1_CAEEL Adenylate kinase isoenzyme 1 OS=Caenorhabditis elegans GN=F38B2.4 PE=2 SV=1 107 291 7.0E-53
sp|P25824|KAD_SCHMA Adenylate kinase OS=Schistosoma mansoni PE=2 SV=1 109 298 2.0E-51
sp|Q20230|KCY2_CAEEL UMP-CMP kinase 2 OS=Caenorhabditis elegans GN=F40F8.1 PE=1 SV=1 108 299 1.0E-49
sp|Q8VY84|KCY1_ARATH Probable UMP-CMP kinase 1 OS=Arabidopsis thaliana GN=UMK1 PE=2 SV=1 108 290 2.0E-49
sp|P20425|KCY_DICDI UMP-CMP kinase OS=Dictyostelium discoideum GN=pyrK PE=1 SV=2 108 299 4.0E-49
sp|O17622|KCY1_CAEEL UMP-CMP kinase 1 OS=Caenorhabditis elegans GN=C29F7.3 PE=1 SV=1 108 299 2.0E-48
sp|P39069|KAD1_RAT Adenylate kinase isoenzyme 1 OS=Rattus norvegicus GN=Ak1 PE=1 SV=3 109 292 3.0E-47
sp|P00570|KAD1_BOVIN Adenylate kinase isoenzyme 1 OS=Bos taurus GN=AK1 PE=1 SV=2 109 299 1.0E-46
sp|O24464|KCY_PRUAR UMP-CMP kinase OS=Prunus armeniaca PE=2 SV=1 98 290 2.0E-46
sp|Q9R0Y5|KAD1_MOUSE Adenylate kinase isoenzyme 1 OS=Mus musculus GN=Ak1 PE=1 SV=1 109 292 2.0E-46
sp|P00569|KAD1_RABIT Adenylate kinase isoenzyme 1 OS=Oryctolagus cuniculus GN=AK1 PE=1 SV=1 109 299 3.0E-46
sp|P00571|KAD1_PIG Adenylate kinase isoenzyme 1 OS=Sus scrofa GN=AK1 PE=1 SV=1 109 292 4.0E-46
sp|P12115|KAD1_CYPCA Adenylate kinase isoenzyme 1 OS=Cyprinus carpio GN=ak1 PE=1 SV=2 106 291 2.0E-45
sp|Q7XMI0|KCY2_ORYSJ UMP-CMP kinase 2 OS=Oryza sativa subsp. japonica GN=Os04g0105500 PE=2 SV=3 109 295 7.0E-45
sp|P00568|KAD1_HUMAN Adenylate kinase isoenzyme 1 OS=Homo sapiens GN=AK1 PE=1 SV=3 109 299 8.0E-45
sp|P05081|KAD1_CHICK Adenylate kinase isoenzyme 1 OS=Gallus gallus GN=AK1 PE=1 SV=1 109 293 5.0E-44
sp|Q5VRN0|KCY1_ORYSJ UMP-CMP kinase 1 OS=Oryza sativa subsp. japonica GN=Os06g0109600 PE=2 SV=1 107 294 6.0E-41
sp|Q6NMK6|KCY2_ARATH Probable UMP-CMP kinase 2 OS=Arabidopsis thaliana GN=UMK2 PE=2 SV=1 93 300 3.0E-39
sp|Q920P5|KAD5_MOUSE Adenylate kinase isoenzyme 5 OS=Mus musculus GN=Ak5 PE=1 SV=2 109 290 1.0E-38
sp|Q9Y6K8|KAD5_HUMAN Adenylate kinase isoenzyme 5 OS=Homo sapiens GN=AK5 PE=1 SV=2 109 290 1.0E-37
sp|A4IFD0|KAD5_BOVIN Adenylate kinase isoenzyme 5 OS=Bos taurus GN=Ak5 PE=2 SV=1 109 290 2.0E-37
sp|Q89ZJ0|KAD_BACTN Adenylate kinase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=adk PE=3 SV=1 110 292 5.0E-32
sp|A6L0Z9|KAD_BACV8 Adenylate kinase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=adk PE=3 SV=1 110 292 7.0E-31
sp|Q9Y6K8|KAD5_HUMAN Adenylate kinase isoenzyme 5 OS=Homo sapiens GN=AK5 PE=1 SV=2 95 303 1.0E-28
sp|A4IFD0|KAD5_BOVIN Adenylate kinase isoenzyme 5 OS=Bos taurus GN=Ak5 PE=2 SV=1 95 303 1.0E-28
sp|Q920P5|KAD5_MOUSE Adenylate kinase isoenzyme 5 OS=Mus musculus GN=Ak5 PE=1 SV=2 95 303 3.0E-28
sp|Q64XA6|KAD_BACFR Adenylate kinase OS=Bacteroides fragilis (strain YCH46) GN=adk PE=3 SV=1 110 295 4.0E-28
sp|Q5LGH0|KAD_BACFN Adenylate kinase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=adk PE=3 SV=1 110 295 4.0E-28
sp|Q7MW54|KAD_PORGI Adenylate kinase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=adk PE=3 SV=1 110 283 7.0E-27
sp|B2RIY8|KAD_PORG3 Adenylate kinase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=adk PE=3 SV=1 110 283 9.0E-27
sp|A6LD69|KAD_PARD8 Adenylate kinase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=adk PE=3 SV=1 110 290 1.0E-26
sp|B1VEX6|KAD_CORU7 Adenylate kinase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=adk PE=3 SV=1 110 282 2.0E-26
sp|Q7UN00|KAD_RHOBA Adenylate kinase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=adk PE=3 SV=2 110 302 4.0E-26
sp|C0R000|KAD_BRAHW Adenylate kinase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=adk PE=3 SV=1 107 297 8.0E-26
sp|A5FMV7|KAD_FLAJ1 Adenylate kinase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=adk PE=3 SV=1 110 281 2.0E-25
sp|P73302|KAD1_SYNY3 Adenylate kinase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=adk1 PE=3 SV=2 110 298 3.0E-25
sp|Q8DML4|KAD_THEEB Adenylate kinase OS=Thermosynechococcus elongatus (strain BP-1) GN=adk PE=3 SV=1 110 297 1.0E-24
sp|Q46IS8|KAD_PROMT Adenylate kinase OS=Prochlorococcus marinus (strain NATL2A) GN=adk PE=3 SV=1 110 297 1.0E-24
sp|Q3BPM9|KAD_XANC5 Adenylate kinase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=adk PE=3 SV=1 110 297 2.0E-24
sp|Q8PH23|KAD_XANAC Adenylate kinase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=adk PE=3 SV=1 110 297 2.0E-24
sp|B0RP52|KAD_XANCB Adenylate kinase OS=Xanthomonas campestris pv. campestris (strain B100) GN=adk PE=3 SV=1 110 290 2.0E-24
sp|A2C4Y0|KAD_PROM1 Adenylate kinase OS=Prochlorococcus marinus (strain NATL1A) GN=adk PE=3 SV=1 110 297 2.0E-24
sp|Q8P5P5|KAD_XANCP Adenylate kinase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=adk PE=3 SV=1 110 290 2.0E-24
sp|Q4UYC6|KAD_XANC8 Adenylate kinase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=adk PE=3 SV=1 110 290 2.0E-24
sp|A5GIS6|KAD_SYNPW Adenylate kinase OS=Synechococcus sp. (strain WH7803) GN=adk PE=3 SV=1 110 297 2.0E-24
sp|Q5H4A4|KAD_XANOR Adenylate kinase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=adk PE=3 SV=1 110 297 2.0E-24
sp|Q2P743|KAD_XANOM Adenylate kinase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=adk PE=3 SV=1 110 297 2.0E-24
sp|B8HMS3|KAD_CYAP4 Adenylate kinase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=adk PE=3 SV=1 110 294 6.0E-24
sp|A5GVX9|KAD_SYNR3 Adenylate kinase OS=Synechococcus sp. (strain RCC307) GN=adk PE=3 SV=1 110 289 7.0E-24
sp|A2CC47|KAD_PROM3 Adenylate kinase OS=Prochlorococcus marinus (strain MIT 9303) GN=adk PE=3 SV=1 110 297 1.0E-23
sp|Q5Z1Q1|KAD_NOCFA Adenylate kinase OS=Nocardia farcinica (strain IFM 10152) GN=adk PE=3 SV=1 110 299 1.0E-23
sp|Q3AW74|KAD_SYNS9 Adenylate kinase OS=Synechococcus sp. (strain CC9902) GN=adk PE=3 SV=1 110 282 2.0E-23
sp|B4SI37|KAD_STRM5 Adenylate kinase OS=Stenotrophomonas maltophilia (strain R551-3) GN=adk PE=3 SV=1 110 291 2.0E-23
sp|C3PL31|KAD_CORA7 Adenylate kinase OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=adk PE=3 SV=1 112 271 2.0E-23
sp|Q8SVC2|KAD_ENCCU Adenylate kinase OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU06_0650 PE=1 SV=2 110 297 3.0E-23
sp|P49973|KAD_CORGL Adenylate kinase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=adk PE=3 SV=2 110 297 4.0E-23
sp|A4QBP4|KAD_CORGB Adenylate kinase OS=Corynebacterium glutamicum (strain R) GN=adk PE=3 SV=1 110 297 4.0E-23
sp|Q8FS39|KAD_COREF Adenylate kinase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=adk PE=3 SV=1 110 297 5.0E-23
sp|Q7V526|KAD_PROMM Adenylate kinase OS=Prochlorococcus marinus (strain MIT 9313) GN=adk PE=3 SV=1 110 297 5.0E-23
sp|A8MLG1|KAD_ALKOO Adenylate kinase OS=Alkaliphilus oremlandii (strain OhILAs) GN=adk PE=3 SV=1 110 301 6.0E-23
sp|A6GZB9|KAD_FLAPJ Adenylate kinase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=adk PE=3 SV=1 110 281 7.0E-23
sp|O96907|KAD_ENTHI Adenylate kinase OS=Entamoeba histolytica PE=3 SV=1 110 260 7.0E-23
sp|Q2JV96|KAD_SYNJA Adenylate kinase OS=Synechococcus sp. (strain JA-3-3Ab) GN=adk PE=3 SV=1 110 301 1.0E-22
sp|B4U765|KAD_HYDS0 Adenylate kinase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=adk PE=3 SV=1 109 297 2.0E-22
sp|Q1BD73|KAD_MYCSS Adenylate kinase OS=Mycobacterium sp. (strain MCS) GN=adk PE=3 SV=1 110 291 2.0E-22
sp|A1UBR9|KAD_MYCSK Adenylate kinase OS=Mycobacterium sp. (strain KMS) GN=adk PE=3 SV=1 110 291 2.0E-22
sp|A3PVF5|KAD_MYCSJ Adenylate kinase OS=Mycobacterium sp. (strain JLS) GN=adk PE=3 SV=1 110 291 2.0E-22
sp|Q7V9Y1|KAD_PROMA Adenylate kinase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=adk PE=3 SV=1 110 275 2.0E-22
sp|O66490|KAD_AQUAE Adenylate kinase OS=Aquifex aeolicus (strain VF5) GN=adk PE=1 SV=1 109 290 2.0E-22
sp|A2BYR7|KAD_PROM5 Adenylate kinase OS=Prochlorococcus marinus (strain MIT 9515) GN=adk PE=3 SV=1 110 271 2.0E-22
sp|B2FT48|KAD_STRMK Adenylate kinase OS=Stenotrophomonas maltophilia (strain K279a) GN=adk PE=3 SV=1 110 299 2.0E-22
sp|Q8TRS3|KAD_METAC Adenylate kinase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=adk PE=3 SV=1 110 292 3.0E-22
sp|Q5SHQ9|KAD_THET8 Adenylate kinase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=adk PE=1 SV=1 109 302 3.0E-22
sp|Q72I25|KAD_THET2 Adenylate kinase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=adk PE=3 SV=1 109 302 3.0E-22
sp|A7HWT2|KAD_PARL1 Adenylate kinase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=adk PE=3 SV=1 110 297 4.0E-22
sp|Q9RSK7|KAD_DEIRA Adenylate kinase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=adk PE=3 SV=1 109 290 5.0E-22
sp|Q0ID24|KAD_SYNS3 Adenylate kinase OS=Synechococcus sp. (strain CC9311) GN=adk PE=3 SV=1 110 294 5.0E-22
sp|Q0BYD5|KAD_HYPNA Adenylate kinase OS=Hyphomonas neptunium (strain ATCC 15444) GN=adk PE=3 SV=1 110 300 7.0E-22
sp|B1MGB3|KAD_MYCA9 Adenylate kinase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=adk PE=3 SV=1 110 297 7.0E-22
sp|Q46GB9|KAD_METBF Adenylate kinase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=adk PE=3 SV=1 110 298 9.0E-22
sp|B0U1U0|KAD_XYLFM Adenylate kinase OS=Xylella fastidiosa (strain M12) GN=adk PE=3 SV=1 110 289 1.0E-21
sp|Q9PGM3|KAD_XYLFA Adenylate kinase OS=Xylella fastidiosa (strain 9a5c) GN=adk PE=3 SV=2 110 289 1.0E-21
sp|Q7UZW3|KAD_PROMP Adenylate kinase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=adk PE=3 SV=1 110 271 2.0E-21
sp|C0ZW47|KAD_RHOE4 Adenylate kinase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=adk PE=3 SV=1 110 282 2.0E-21
sp|Q87ES6|KAD_XYLFT Adenylate kinase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=adk PE=3 SV=1 110 289 2.0E-21
sp|B2I757|KAD_XYLF2 Adenylate kinase OS=Xylella fastidiosa (strain M23) GN=adk PE=3 SV=1 110 289 2.0E-21
sp|C4LL05|KAD_CORK4 Adenylate kinase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=adk PE=3 SV=1 110 271 3.0E-21
sp|B9L9Y8|KAD_NAUPA Adenylate kinase OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=adk PE=3 SV=1 109 302 3.0E-21
sp|Q73S77|KAD_MYCPA Adenylate kinase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=adk PE=3 SV=1 110 291 4.0E-21
sp|B0SSF7|KAD_LEPBP Adenylate kinase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=adk PE=3 SV=1 110 281 4.0E-21
sp|B0SA26|KAD_LEPBA Adenylate kinase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=adk PE=3 SV=1 110 281 4.0E-21
sp|A9BCM8|KAD_PROM4 Adenylate kinase OS=Prochlorococcus marinus (strain MIT 9211) GN=adk PE=3 SV=1 110 302 5.0E-21
sp|Q4JTB5|KAD_CORJK Adenylate kinase OS=Corynebacterium jeikeium (strain K411) GN=adk PE=3 SV=1 110 282 6.0E-21
sp|Q47LL4|KAD_THEFY Adenylate kinase OS=Thermobifida fusca (strain YX) GN=adk PE=3 SV=1 110 289 6.0E-21
sp|P43414|KAD_STRCO Adenylate kinase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=adk PE=3 SV=3 110 289 8.0E-21
sp|Q6NJ71|KAD_CORDI Adenylate kinase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=adk PE=3 SV=1 110 271 9.0E-21
sp|C3PP86|KAD_RICAE Adenylate kinase OS=Rickettsia africae (strain ESF-5) GN=adk PE=3 SV=1 109 300 9.0E-21
sp|C5CGI1|KAD_KOSOT Adenylate kinase OS=Kosmotoga olearia (strain TBF 19.5.1) GN=adk PE=3 SV=1 110 298 9.0E-21
sp|Q4UMQ8|KAD_RICFE Adenylate kinase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=adk PE=3 SV=1 109 300 1.0E-20
sp|C1CXE5|KAD_DEIDV Adenylate kinase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=adk PE=3 SV=1 109 290 1.0E-20
sp|Q6AD15|KAD_LEIXX Adenylate kinase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=adk PE=3 SV=1 110 289 1.0E-20
sp|P9WKF5|KAD_MYCTU Adenylate kinase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=adk PE=1 SV=1 110 291 1.0E-20
sp|P9WKF4|KAD_MYCTO Adenylate kinase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=adk PE=3 SV=1 110 291 1.0E-20
sp|A5U0B9|KAD_MYCTA Adenylate kinase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=adk PE=3 SV=1 110 291 1.0E-20
sp|C1AL67|KAD_MYCBT Adenylate kinase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=adk PE=3 SV=1 110 291 1.0E-20
sp|A1KGL4|KAD_MYCBP Adenylate kinase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=adk PE=3 SV=1 110 291 1.0E-20
sp|P69439|KAD_MYCBO Adenylate kinase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=adk PE=3 SV=1 110 291 1.0E-20
sp|A3PF28|KAD_PROM0 Adenylate kinase OS=Prochlorococcus marinus (strain MIT 9301) GN=adk PE=3 SV=1 109 282 2.0E-20
sp|A3DJJ3|KAD_CLOTH Adenylate kinase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=adk PE=3 SV=1 110 287 2.0E-20
sp|Q8YPJ8|KAD1_NOSS1 Adenylate kinase 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=adk1 PE=3 SV=1 107 302 2.0E-20
sp|Q8PV26|KAD_METMA Adenylate kinase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=adk PE=3 SV=1 110 297 2.0E-20
sp|A5CU93|KAD_CLAM3 Adenylate kinase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=adk PE=3 SV=1 107 289 2.0E-20
sp|B6YRA7|KAD_AZOPC Adenylate kinase OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=adk PE=3 SV=1 112 297 3.0E-20
sp|A4XLR0|KAD_CALS8 Adenylate kinase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=adk PE=3 SV=1 110 302 5.0E-20
sp|Q92GY7|KAD_RICCN Adenylate kinase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=adk PE=3 SV=1 109 300 5.0E-20
sp|A2BTB8|KAD_PROMS Adenylate kinase OS=Prochlorococcus marinus (strain AS9601) GN=adk PE=3 SV=1 110 271 5.0E-20
sp|Q2JIK8|KAD_SYNJB Adenylate kinase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=adk PE=3 SV=1 110 289 6.0E-20
sp|A1T4T2|KAD_MYCVP Adenylate kinase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=adk PE=3 SV=1 110 297 6.0E-20
sp|B2GJ13|KAD_KOCRD Adenylate kinase OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=adk PE=3 SV=1 107 281 7.0E-20
sp|Q9A8T2|KAD_CAUCR Adenylate kinase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=adk PE=3 SV=1 110 298 7.0E-20
sp|B8H4F5|KAD_CAUCN Adenylate kinase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=adk PE=3 SV=1 110 298 7.0E-20
sp|Q839E3|KAD_ENTFA Adenylate kinase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=adk PE=3 SV=1 110 295 9.0E-20
sp|Q18CH9|KAD_PEPD6 Adenylate kinase OS=Peptoclostridium difficile (strain 630) GN=adk PE=3 SV=1 110 292 1.0E-19
sp|Q7U4I1|KAD_SYNPX Adenylate kinase OS=Synechococcus sp. (strain WH8102) GN=adk PE=3 SV=1 110 297 1.0E-19
sp|B4R8N8|KAD_PHEZH Adenylate kinase OS=Phenylobacterium zucineum (strain HLK1) GN=adk PE=3 SV=1 110 297 1.0E-19
sp|P33107|KAD_MICLU Adenylate kinase OS=Micrococcus luteus GN=adk PE=3 SV=1 107 300 1.0E-19
sp|C5CC42|KAD_MICLC Adenylate kinase OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=adk PE=3 SV=1 107 300 1.0E-19
sp|Q8Y449|KAD_LISMO Adenylate kinase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=adk PE=3 SV=1 110 297 1.0E-19
sp|Q0T7B1|KAD_SHIF8 Adenylate kinase OS=Shigella flexneri serotype 5b (strain 8401) GN=adk PE=3 SV=1 110 297 2.0E-19
sp|Q325C2|KAD_SHIBS Adenylate kinase OS=Shigella boydii serotype 4 (strain Sb227) GN=adk PE=3 SV=1 110 297 2.0E-19
sp|B2U4S7|KAD_SHIB3 Adenylate kinase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=adk PE=3 SV=1 110 297 2.0E-19
sp|B7LV13|KAD_ESCF3 Adenylate kinase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=adk PE=3 SV=1 110 297 2.0E-19
sp|B1LJN2|KAD_ECOSM Adenylate kinase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=adk PE=3 SV=1 110 297 2.0E-19
sp|B6I0C6|KAD_ECOSE Adenylate kinase OS=Escherichia coli (strain SE11) GN=adk PE=3 SV=1 110 297 2.0E-19
sp|B7N927|KAD_ECOLU Adenylate kinase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=adk PE=3 SV=1 110 297 2.0E-19
sp|P69441|KAD_ECOLI Adenylate kinase OS=Escherichia coli (strain K12) GN=adk PE=1 SV=1 110 297 2.0E-19
sp|B1IZC0|KAD_ECOLC Adenylate kinase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=adk PE=3 SV=1 110 297 2.0E-19
sp|A7ZXD2|KAD_ECOHS Adenylate kinase OS=Escherichia coli O9:H4 (strain HS) GN=adk PE=3 SV=1 110 297 2.0E-19
sp|B1XFR1|KAD_ECODH Adenylate kinase OS=Escherichia coli (strain K12 / DH10B) GN=adk PE=3 SV=1 110 297 2.0E-19
sp|C4ZUS8|KAD_ECOBW Adenylate kinase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=adk PE=3 SV=1 110 297 2.0E-19
sp|P69442|KAD_ECO57 Adenylate kinase OS=Escherichia coli O157:H7 GN=adk PE=3 SV=1 110 297 2.0E-19
sp|B7L799|KAD_ECO55 Adenylate kinase OS=Escherichia coli (strain 55989 / EAEC) GN=adk PE=3 SV=1 110 297 2.0E-19
sp|A7ZIN4|KAD_ECO24 Adenylate kinase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=adk PE=3 SV=1 110 297 2.0E-19
sp|Q5UXG8|KAD_HALMA Adenylate kinase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=adk PE=3 SV=1 110 299 2.0E-19
sp|Q32J54|KAD_SHIDS Adenylate kinase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=adk PE=3 SV=1 110 297 2.0E-19
sp|C4ZBT9|KAD_EUBR3 Adenylate kinase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=adk PE=3 SV=1 110 291 2.0E-19
sp|A0ALU7|KAD_LISW6 Adenylate kinase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=adk PE=3 SV=1 110 297 2.0E-19
sp|B8DB29|KAD_LISMH Adenylate kinase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=adk PE=3 SV=1 110 299 2.0E-19
sp|Q8DS33|KAD_STRMU Adenylate kinase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=adk PE=3 SV=1 110 297 2.0E-19
sp|A4J592|KAD_DESRM Adenylate kinase OS=Desulfotomaculum reducens (strain MI-1) GN=adk PE=3 SV=1 110 281 2.0E-19
sp|Q68W99|KAD_RICTY Adenylate kinase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=adk PE=3 SV=1 109 300 2.0E-19
sp|B2HCV5|KAD_MYCMM Adenylate kinase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=adk PE=3 SV=1 110 291 2.0E-19
sp|A0PM98|KAD_MYCUA Adenylate kinase OS=Mycobacterium ulcerans (strain Agy99) GN=adk PE=3 SV=1 110 291 2.0E-19
sp|C4K2F8|KAD_RICPU Adenylate kinase OS=Rickettsia peacockii (strain Rustic) GN=adk PE=3 SV=1 109 300 2.0E-19
sp|Q15RT7|KAD_PSEA6 Adenylate kinase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=adk PE=3 SV=1 110 302 3.0E-19
sp|Q110C6|KAD_TRIEI Adenylate kinase OS=Trichodesmium erythraeum (strain IMS101) GN=adk PE=3 SV=1 110 296 3.0E-19
sp|Q6FM32|KAD2_CANGA Adenylate kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ADK1 PE=3 SV=1 102 297 3.0E-19
sp|Q1QN09|KAD_NITHX Adenylate kinase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=adk PE=3 SV=1 110 304 3.0E-19
sp|B9K8A7|KAD_THENN Adenylate kinase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=adk PE=3 SV=1 110 295 3.0E-19
sp|Q8GGL2|KAD_THENE Adenylate kinase OS=Thermotoga neapolitana GN=adk PE=3 SV=1 110 295 3.0E-19
sp|A8AJW9|KAD_CITK8 Adenylate kinase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=adk PE=3 SV=1 110 297 3.0E-19
sp|Q6A6Q4|KAD_PROAC Adenylate kinase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=adk PE=3 SV=1 110 289 3.0E-19
sp|A8G742|KAD_PROM2 Adenylate kinase OS=Prochlorococcus marinus (strain MIT 9215) GN=adk PE=3 SV=1 110 282 3.0E-19
sp|A6ZYI0|KAD2_YEAS7 Adenylate kinase OS=Saccharomyces cerevisiae (strain YJM789) GN=ADK1 PE=3 SV=1 110 297 3.0E-19
sp|A3CK85|KAD_STRSV Adenylate kinase OS=Streptococcus sanguinis (strain SK36) GN=adk PE=3 SV=1 110 297 3.0E-19
sp|Q0AUK1|KAD_SYNWW Adenylate kinase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=adk PE=3 SV=1 110 299 3.0E-19
sp|B1LBL9|KAD_THESQ Adenylate kinase OS=Thermotoga sp. (strain RQ2) GN=adk PE=3 SV=1 110 295 3.0E-19
sp|A5IMA4|KAD_THEP1 Adenylate kinase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=adk PE=3 SV=1 110 295 3.0E-19
sp|P07170|KAD2_YEAST Adenylate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADK1 PE=1 SV=2 110 297 4.0E-19
sp|B3LG61|KAD2_YEAS1 Adenylate kinase OS=Saccharomyces cerevisiae (strain RM11-1a) GN=ADK1 PE=3 SV=1 110 297 4.0E-19
sp|Q9ZCS6|KAD_RICPR Adenylate kinase OS=Rickettsia prowazekii (strain Madrid E) GN=adk PE=3 SV=1 109 300 4.0E-19
sp|Q1IX93|KAD_DEIGD Adenylate kinase OS=Deinococcus geothermalis (strain DSM 11300) GN=adk PE=3 SV=1 109 298 4.0E-19
sp|Q8FK84|KAD_ECOL6 Adenylate kinase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=adk PE=3 SV=2 110 297 4.0E-19
sp|Q0TKG7|KAD_ECOL5 Adenylate kinase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=adk PE=3 SV=1 110 297 4.0E-19
sp|B7MQI9|KAD_ECO81 Adenylate kinase OS=Escherichia coli O81 (strain ED1a) GN=adk PE=3 SV=1 110 297 4.0E-19
sp|B7NIF6|KAD_ECO7I Adenylate kinase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=adk PE=3 SV=1 110 297 4.0E-19
sp|B7UKF4|KAD_ECO27 Adenylate kinase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=adk PE=3 SV=1 110 297 4.0E-19
sp|Q3IMW0|KAD_NATPD Adenylate kinase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=adk1 PE=3 SV=1 110 301 4.0E-19
sp|Q9Z8U0|KAD_CHLPN Adenylate kinase OS=Chlamydia pneumoniae GN=adk PE=3 SV=1 108 297 5.0E-19
sp|Q9X1I8|KAD_THEMA Adenylate kinase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=adk PE=3 SV=1 110 295 5.0E-19
sp|Q6ZC69|KAD2_ORYSJ Probable adenylate kinase 2, chloroplastic OS=Oryza sativa subsp. japonica GN=Os08g0109300 PE=2 SV=1 110 301 6.0E-19
sp|Q8AVD3|KAD2_XENLA Adenylate kinase 2, mitochondrial OS=Xenopus laevis GN=ak2 PE=2 SV=1 111 292 6.0E-19
sp|Q71WG7|KAD_LISMF Adenylate kinase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=adk PE=3 SV=1 110 297 6.0E-19
sp|C1KZF9|KAD_LISMC Adenylate kinase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=adk PE=3 SV=1 110 297 6.0E-19
sp|A6VQC3|KAD_ACTSZ Adenylate kinase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=adk PE=3 SV=1 110 297 6.0E-19
sp|Q927M8|KAD_LISIN Adenylate kinase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=adk PE=3 SV=1 110 297 7.0E-19
sp|A8GT48|KAD_RICRS Adenylate kinase OS=Rickettsia rickettsii (strain Sheila Smith) GN=adk PE=3 SV=1 109 300 7.0E-19
sp|B0BUN9|KAD_RICRO Adenylate kinase OS=Rickettsia rickettsii (strain Iowa) GN=adk PE=3 SV=1 109 300 7.0E-19
sp|Q0ANS1|KAD_MARMM Adenylate kinase OS=Maricaulis maris (strain MCS10) GN=adk PE=3 SV=1 110 291 7.0E-19
sp|A4W7F8|KAD_ENT38 Adenylate kinase OS=Enterobacter sp. (strain 638) GN=adk PE=3 SV=1 110 297 7.0E-19
sp|A0KL52|KAD_AERHH Adenylate kinase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=adk PE=3 SV=1 110 302 7.0E-19
sp|B0RB59|KAD_CLAMS Adenylate kinase OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=adk PE=3 SV=1 107 289 8.0E-19
sp|B1MVZ4|KAD_LEUCK Adenylate kinase OS=Leuconostoc citreum (strain KM20) GN=adk PE=3 SV=1 110 281 8.0E-19
sp|A8EZJ5|KAD_RICCK Adenylate kinase OS=Rickettsia canadensis (strain McKiel) GN=adk PE=3 SV=1 109 300 8.0E-19
sp|B7MDZ6|KAD_ECO45 Adenylate kinase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=adk PE=3 SV=1 110 297 8.0E-19
sp|Q3J7A3|KAD_NITOC Adenylate kinase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=adk PE=3 SV=1 111 292 9.0E-19
sp|B7M3W6|KAD_ECO8A Adenylate kinase OS=Escherichia coli O8 (strain IAI1) GN=adk PE=3 SV=1 110 297 1.0E-18
sp|B5YHP1|KAD_THEYD Adenylate kinase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=adk PE=3 SV=1 110 290 1.0E-18
sp|Q9PQP0|KAD_UREPA Adenylate kinase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=adk PE=3 SV=1 110 300 1.0E-18
sp|B1AIP0|KAD_UREP2 Adenylate kinase OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=adk PE=3 SV=1 110 300 1.0E-18
sp|A8XZJ0|KAD2_CAEBR Adenylate kinase OS=Caenorhabditis briggsae GN=let-754 PE=3 SV=2 93 297 1.0E-18
sp|C5D3T8|KAD_GEOSW Adenylate kinase OS=Geobacillus sp. (strain WCH70) GN=adk PE=3 SV=1 110 297 1.0E-18
sp|B8HCY6|KAD_ARTCA Adenylate kinase OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=adk PE=3 SV=1 107 299 1.0E-18
sp|Q3SSU5|KAD_NITWN Adenylate kinase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=adk PE=3 SV=1 110 298 1.0E-18
sp|A8GPC9|KAD_RICAH Adenylate kinase OS=Rickettsia akari (strain Hartford) GN=adk PE=3 SV=1 109 300 2.0E-18
sp|B9DSX1|KAD_STRU0 Adenylate kinase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=adk PE=3 SV=1 110 299 2.0E-18
sp|A7ZEH4|KAD_CAMC1 Adenylate kinase OS=Campylobacter concisus (strain 13826) GN=adk PE=3 SV=1 108 301 2.0E-18
sp|Q3ACG0|KAD_CARHZ Adenylate kinase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=adk PE=3 SV=1 110 298 2.0E-18
sp|Q9HPA7|KAD_HALSA Adenylate kinase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=adk PE=2 SV=1 110 292 2.0E-18
sp|B0R683|KAD_HALS3 Adenylate kinase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=adk PE=3 SV=1 110 292 2.0E-18
sp|Q9WUR9|KAD4_MOUSE Adenylate kinase 4, mitochondrial OS=Mus musculus GN=Ak4 PE=1 SV=1 112 284 2.0E-18
sp|P27142|KAD_GEOSE Adenylate kinase OS=Geobacillus stearothermophilus GN=adk PE=1 SV=1 110 297 2.0E-18
sp|Q82DM5|KAD_STRAW Adenylate kinase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=adk PE=3 SV=1 110 289 2.0E-18
sp|A7THY5|KAD2_VANPO Adenylate kinase OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ADK1 PE=3 SV=1 110 297 2.0E-18
sp|Q8R7X4|KAD_CALS4 Adenylate kinase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=adk PE=3 SV=1 110 297 2.0E-18
sp|P34346|KAD2_CAEEL Adenylate kinase OS=Caenorhabditis elegans GN=let-754 PE=3 SV=2 80 301 2.0E-18
sp|Q83M40|KAD_SHIFL Adenylate kinase OS=Shigella flexneri GN=adk PE=3 SV=4 110 297 2.0E-18
sp|Q9PKR0|KAD_CHLMU Adenylate kinase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=adk PE=3 SV=1 110 292 2.0E-18
sp|B0T2E3|KAD_CAUSK Adenylate kinase OS=Caulobacter sp. (strain K31) GN=adk PE=3 SV=1 110 297 2.0E-18
sp|Q0J6P7|KAD5_ORYSJ Probable adenylate kinase 5, chloroplastic OS=Oryza sativa subsp. japonica GN=Os08g0288200 PE=2 SV=2 110 298 3.0E-18
sp|A7Z0Q9|KAD_BACMF Adenylate kinase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=adk PE=3 SV=1 110 297 3.0E-18
sp|B0K5R3|KAD_THEPX Adenylate kinase OS=Thermoanaerobacter sp. (strain X514) GN=adk PE=3 SV=1 110 297 3.0E-18
sp|B0KCM0|KAD_THEP3 Adenylate kinase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=adk PE=3 SV=1 110 297 3.0E-18
sp|Q03ZM5|KAD_LEUMM Adenylate kinase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=adk PE=3 SV=1 110 281 3.0E-18
sp|A6T5N7|KAD_KLEP7 Adenylate kinase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=adk PE=3 SV=1 110 297 4.0E-18
sp|B5Y0N3|KAD_KLEP3 Adenylate kinase OS=Klebsiella pneumoniae (strain 342) GN=adk PE=3 SV=1 110 297 4.0E-18
sp|Q890Q5|KAD_CLOTE Adenylate kinase OS=Clostridium tetani (strain Massachusetts / E88) GN=adk PE=3 SV=1 110 299 4.0E-18
sp|A4IJK9|KAD_GEOTN Adenylate kinase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=adk PE=3 SV=1 110 297 4.0E-18
sp|A5UAD6|KAD_HAEIE Adenylate kinase OS=Haemophilus influenzae (strain PittEE) GN=adk PE=3 SV=1 110 276 4.0E-18
sp|Q1RHP2|KAD_RICBR Adenylate kinase OS=Rickettsia bellii (strain RML369-C) GN=adk PE=3 SV=1 109 300 5.0E-18
sp|Q28F55|KAD2_XENTR Adenylate kinase 2, mitochondrial OS=Xenopus tropicalis GN=ak2 PE=2 SV=1 111 292 5.0E-18
sp|A0LIL1|KAD_SYNFM Adenylate kinase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=adk PE=3 SV=1 110 290 5.0E-18
sp|Q67JW4|KAD_SYMTH Adenylate kinase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=adk PE=3 SV=1 110 300 5.0E-18
sp|Q8ETW3|KAD_OCEIH Adenylate kinase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=adk PE=3 SV=1 110 298 5.0E-18
sp|A1SNJ7|KAD_NOCSJ Adenylate kinase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=adk PE=3 SV=1 110 291 6.0E-18
sp|Q3Z4S5|KAD_SHISS Adenylate kinase OS=Shigella sonnei (strain Ss046) GN=adk PE=3 SV=1 110 297 6.0E-18
sp|Q04G65|KAD_OENOB Adenylate kinase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=adk PE=3 SV=1 110 295 6.0E-18
sp|B1HMV9|KAD_LYSSC Adenylate kinase OS=Lysinibacillus sphaericus (strain C3-41) GN=adk PE=3 SV=1 110 300 6.0E-18
sp|A4SLY1|KAD_AERS4 Adenylate kinase OS=Aeromonas salmonicida (strain A449) GN=adk PE=3 SV=1 110 302 7.0E-18
sp|P0A1V4|KAD_SALTY Adenylate kinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=adk PE=3 SV=1 110 297 8.0E-18
sp|P0A1V5|KAD_SALTI Adenylate kinase OS=Salmonella typhi GN=adk PE=3 SV=1 110 297 8.0E-18
sp|B4TMG6|KAD_SALSV Adenylate kinase OS=Salmonella schwarzengrund (strain CVM19633) GN=adk PE=3 SV=1 110 297 8.0E-18
sp|B5BD44|KAD_SALPK Adenylate kinase OS=Salmonella paratyphi A (strain AKU_12601) GN=adk PE=3 SV=1 110 297 8.0E-18
sp|C0Q812|KAD_SALPC Adenylate kinase OS=Salmonella paratyphi C (strain RKS4594) GN=adk PE=3 SV=1 110 297 8.0E-18
sp|Q5PFK8|KAD_SALPA Adenylate kinase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=adk PE=3 SV=1 110 297 8.0E-18
sp|B4SWY1|KAD_SALNS Adenylate kinase OS=Salmonella newport (strain SL254) GN=adk PE=3 SV=1 110 297 8.0E-18
sp|B4T9I1|KAD_SALHS Adenylate kinase OS=Salmonella heidelberg (strain SL476) GN=adk PE=3 SV=1 110 297 8.0E-18
sp|B5R612|KAD_SALG2 Adenylate kinase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=adk PE=3 SV=1 110 297 8.0E-18
sp|B5QU77|KAD_SALEP Adenylate kinase OS=Salmonella enteritidis PT4 (strain P125109) GN=adk PE=3 SV=1 110 297 8.0E-18
sp|B5FLJ7|KAD_SALDC Adenylate kinase OS=Salmonella dublin (strain CT_02021853) GN=adk PE=3 SV=1 110 297 8.0E-18
sp|Q57S76|KAD_SALCH Adenylate kinase OS=Salmonella choleraesuis (strain SC-B67) GN=adk PE=3 SV=1 110 297 8.0E-18
sp|B5EXN0|KAD_SALA4 Adenylate kinase OS=Salmonella agona (strain SL483) GN=adk PE=3 SV=1 110 297 8.0E-18
sp|Q2RFR8|KAD_MOOTA Adenylate kinase OS=Moorella thermoacetica (strain ATCC 39073) GN=adk PE=3 SV=1 110 291 8.0E-18
sp|Q9FIJ7|KAD2_ARATH Adenylate kinase 2, chloroplastic OS=Arabidopsis thaliana GN=At5g47840 PE=1 SV=1 89 301 8.0E-18
sp|Q87RH4|KAD_VIBPA Adenylate kinase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=adk PE=3 SV=1 110 297 9.0E-18
sp|O33007|KAD_MYCLE Adenylate kinase OS=Mycobacterium leprae (strain TN) GN=adk PE=3 SV=2 110 291 1.0E-17
sp|B8ZS96|KAD_MYCLB Adenylate kinase OS=Mycobacterium leprae (strain Br4923) GN=adk PE=3 SV=1 110 291 1.0E-17
sp|A4VSH4|KAD_STRSY Adenylate kinase OS=Streptococcus suis (strain 05ZYH33) GN=adk PE=3 SV=1 110 290 1.0E-17
sp|A4VYR4|KAD_STRS2 Adenylate kinase OS=Streptococcus suis (strain 98HAH33) GN=adk PE=3 SV=1 110 290 1.0E-17
sp|P61115|KAD_BDEBA Adenylate kinase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=adk PE=3 SV=1 110 298 1.0E-17
sp|A0QSH8|KAD_MYCS2 Adenylate kinase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=adk PE=1 SV=1 110 291 1.0E-17
sp|A8F9A6|KAD_BACP2 Adenylate kinase OS=Bacillus pumilus (strain SAFR-032) GN=adk PE=3 SV=1 110 297 1.0E-17
sp|B0BBB5|KAD_CHLTB Adenylate kinase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=adk PE=3 SV=1 110 301 1.0E-17
sp|B0B9N6|KAD_CHLT2 Adenylate kinase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=adk PE=3 SV=1 110 301 1.0E-17
sp|Q65UF7|KAD_MANSM Adenylate kinase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=adk PE=3 SV=1 110 302 1.0E-17
sp|B0RZT0|KAD_FINM2 Adenylate kinase OS=Finegoldia magna (strain ATCC 29328) GN=adk PE=3 SV=1 110 298 1.0E-17
sp|C4KZM5|KAD_EXISA Adenylate kinase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=adk PE=3 SV=1 110 300 1.0E-17
sp|O29581|KAD_ARCFU Adenylate kinase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=adk PE=3 SV=1 110 294 1.0E-17
sp|Q9WUS0|KAD4_RAT Adenylate kinase 4, mitochondrial OS=Rattus norvegicus GN=Ak4 PE=2 SV=1 112 284 1.0E-17
sp|P65204|KAD_STRA5 Adenylate kinase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=adk PE=3 SV=1 110 297 1.0E-17
sp|P65203|KAD_STRA3 Adenylate kinase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=adk PE=3 SV=1 110 297 1.0E-17
sp|B2A4G2|KAD_NATTJ Adenylate kinase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=adk PE=3 SV=1 110 299 1.0E-17
sp|Q8VYL1|KAD5_ARATH Adenylate kinase 5, chloroplastic OS=Arabidopsis thaliana GN=At5g35170 PE=1 SV=1 110 297 1.0E-17
sp|O84130|KAD_CHLTR Adenylate kinase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=adk PE=3 SV=1 110 301 1.0E-17
sp|Q3KMP1|KAD_CHLTA Adenylate kinase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=adk PE=3 SV=1 110 301 1.0E-17
sp|P38372|KAD_BACHD Adenylate kinase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=adk PE=3 SV=2 110 298 2.0E-17
sp|Q8CRI0|KAD_STAES Adenylate kinase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=adk PE=3 SV=1 110 289 2.0E-17
sp|Q5HM20|KAD_STAEQ Adenylate kinase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=adk PE=3 SV=1 110 289 2.0E-17
sp|P24323|KAD_HAEIN Adenylate kinase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=adk PE=3 SV=2 110 276 2.0E-17
sp|A5UGF8|KAD_HAEIG Adenylate kinase OS=Haemophilus influenzae (strain PittGG) GN=adk PE=3 SV=1 110 276 2.0E-17
sp|Q4QNJ1|KAD_HAEI8 Adenylate kinase OS=Haemophilus influenzae (strain 86-028NP) GN=adk PE=3 SV=1 110 276 2.0E-17
sp|Q8EUD3|KAD_MYCPE Adenylate kinase OS=Mycoplasma penetrans (strain HF-2) GN=adk PE=3 SV=1 110 288 2.0E-17
sp|Q5REI7|KAD2_PONAB Adenylate kinase 2, mitochondrial OS=Pongo abelii GN=AK2 PE=2 SV=3 112 292 2.0E-17
sp|P54819|KAD2_HUMAN Adenylate kinase 2, mitochondrial OS=Homo sapiens GN=AK2 PE=1 SV=2 112 292 2.0E-17
sp|A5FZU4|KAD_ACICJ Adenylate kinase OS=Acidiphilium cryptum (strain JF-5) GN=adk PE=3 SV=1 110 298 2.0E-17
sp|Q290A8|KAD2_DROPS Adenylate kinase OS=Drosophila pseudoobscura pseudoobscura GN=Adk2 PE=3 SV=2 90 294 2.0E-17
sp|A8GAV3|KAD_SERP5 Adenylate kinase OS=Serratia proteamaculans (strain 568) GN=adk PE=3 SV=1 110 274 2.0E-17
sp|A6U880|KAD_SINMW Adenylate kinase OS=Sinorhizobium medicae (strain WSM419) GN=adk PE=3 SV=1 110 297 2.0E-17
sp|Q4FLN8|KAD_PELUB Adenylate kinase OS=Pelagibacter ubique (strain HTCC1062) GN=adk PE=3 SV=1 110 299 2.0E-17
sp|O52352|KAD_MYCGA Adenylate kinase OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=adk PE=3 SV=2 110 283 2.0E-17
sp|P69882|KAD_STRP1 Adenylate kinase OS=Streptococcus pyogenes serotype M1 GN=adk PE=3 SV=1 110 297 2.0E-17
sp|B2IK83|KAD_BEII9 Adenylate kinase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=adk PE=3 SV=1 110 299 2.0E-17
sp|Q7QJX9|KAD2_ANOGA Adenylate kinase OS=Anopheles gambiae GN=Adk2 PE=3 SV=2 111 294 2.0E-17
sp|B9KFZ2|KAD_CAMLR Adenylate kinase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=adk PE=3 SV=1 109 275 2.0E-17
sp|P16304|KAD_BACSU Adenylate kinase OS=Bacillus subtilis (strain 168) GN=adk PE=1 SV=2 110 297 3.0E-17
sp|Q1LTX5|KAD_BAUCH Adenylate kinase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=adk PE=3 SV=1 110 285 3.0E-17
sp|P49974|KAD_STRLI Adenylate kinase (Fragment) OS=Streptomyces lividans GN=adk PE=3 SV=1 110 285 3.0E-17
sp|P0DB93|KAD_STRPQ Adenylate kinase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=adk PE=3 SV=1 110 297 3.0E-17
sp|Q1J8Z2|KAD_STRPF Adenylate kinase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=adk PE=3 SV=1 110 297 3.0E-17
sp|P0DB92|KAD_STRP3 Adenylate kinase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=adk PE=3 SV=1 110 297 3.0E-17
sp|B5FBZ5|KAD_VIBFM Adenylate kinase OS=Vibrio fischeri (strain MJ11) GN=adk PE=3 SV=1 110 297 3.0E-17
sp|Q5E6Q8|KAD_VIBF1 Adenylate kinase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=adk PE=3 SV=1 110 297 3.0E-17
sp|A6LLN4|KAD_THEM4 Adenylate kinase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=adk PE=3 SV=1 110 298 3.0E-17
sp|Q6YR01|KAD_ONYPE Adenylate kinase OS=Onion yellows phytoplasma (strain OY-M) GN=adk PE=3 SV=1 109 289 3.0E-17
sp|B5XJ57|KAD_STRPZ Adenylate kinase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=adk PE=3 SV=1 110 297 3.0E-17
sp|Q48VS8|KAD_STRPM Adenylate kinase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=adk PE=3 SV=1 110 297 3.0E-17
sp|Q1JJ40|KAD_STRPD Adenylate kinase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=adk PE=3 SV=1 110 297 3.0E-17
sp|Q1JNZ6|KAD_STRPC Adenylate kinase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=adk PE=3 SV=1 110 297 3.0E-17
sp|Q1JE38|KAD_STRPB Adenylate kinase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=adk PE=3 SV=1 110 297 3.0E-17
sp|Q8P2Z4|KAD_STRP8 Adenylate kinase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=adk PE=3 SV=1 110 297 3.0E-17
sp|P65202|KAD_STAAW Adenylate kinase OS=Staphylococcus aureus (strain MW2) GN=adk PE=3 SV=1 110 288 3.0E-17
sp|Q6G792|KAD_STAAS Adenylate kinase OS=Staphylococcus aureus (strain MSSA476) GN=adk PE=3 SV=1 110 288 3.0E-17
sp|Q6GEK4|KAD_STAAR Adenylate kinase OS=Staphylococcus aureus (strain MRSA252) GN=adk PE=3 SV=1 110 288 3.0E-17
sp|P99062|KAD_STAAN Adenylate kinase OS=Staphylococcus aureus (strain N315) GN=adk PE=1 SV=1 110 288 3.0E-17
sp|P65201|KAD_STAAM Adenylate kinase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=adk PE=3 SV=1 110 288 3.0E-17
sp|Q5HDX9|KAD_STAAC Adenylate kinase OS=Staphylococcus aureus (strain COL) GN=adk PE=3 SV=1 110 288 3.0E-17
sp|B5XCA1|KAD2_SALSA Adenylate kinase 2, mitochondrial OS=Salmo salar GN=ak2 PE=2 SV=1 111 292 4.0E-17
sp|P33075|KAD2_SCHPO Adenylate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=adk1 PE=1 SV=1 110 290 4.0E-17
sp|B8ELE2|KAD_METSB Adenylate kinase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=adk PE=3 SV=1 110 297 4.0E-17
sp|Q6CG57|KAD2_YARLI Adenylate kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ADK1 PE=3 SV=2 110 297 4.0E-17
sp|B4QBH8|KAD2_DROSI Adenylate kinase OS=Drosophila simulans GN=Adk2 PE=3 SV=1 98 294 4.0E-17
sp|B4I2A8|KAD2_DROSE Adenylate kinase OS=Drosophila sechellia GN=Adk2-1 PE=3 SV=1 98 294 4.0E-17
sp|A7HM31|KAD_FERNB Adenylate kinase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=adk PE=3 SV=1 110 281 5.0E-17
sp|A7MT47|KAD_VIBCB Adenylate kinase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=adk PE=3 SV=1 110 297 5.0E-17
sp|B8IT32|KAD_METNO Adenylate kinase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=adk PE=3 SV=1 110 298 5.0E-17
sp|B6EHK0|KAD_ALISL Adenylate kinase OS=Aliivibrio salmonicida (strain LFI1238) GN=adk PE=3 SV=1 110 297 5.0E-17
sp|P43188|KADC_MAIZE Adenylate kinase, chloroplastic OS=Zea mays GN=ADK1 PE=1 SV=1 110 301 5.0E-17
sp|B5ZB60|KAD_UREU1 Adenylate kinase OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=adk PE=3 SV=1 110 300 7.0E-17
sp|P35140|KAD_BACLD Adenylate kinase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=adk PE=3 SV=2 110 297 7.0E-17
sp|C4L8U2|KAD_TOLAT Adenylate kinase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=adk PE=3 SV=1 110 302 7.0E-17
sp|Q5L5W0|KAD_CHLAB Adenylate kinase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=adk PE=3 SV=1 111 299 7.0E-17
sp|A1JNB1|KAD_YERE8 Adenylate kinase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=adk PE=3 SV=1 110 274 7.0E-17
sp|Q7VMY0|KAD_HAEDU Adenylate kinase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=adk PE=3 SV=1 110 292 8.0E-17
sp|C4Z2V1|KAD_EUBE2 Adenylate kinase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=adk PE=3 SV=1 110 297 8.0E-17
sp|B0BQN2|KAD_ACTPJ Adenylate kinase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=adk PE=3 SV=1 110 297 8.0E-17
sp|B3H271|KAD_ACTP7 Adenylate kinase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=adk PE=3 SV=1 110 297 8.0E-17
sp|A3N1U8|KAD_ACTP2 Adenylate kinase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=adk PE=3 SV=1 110 297 8.0E-17
sp|C0M6X3|KAD_STRE4 Adenylate kinase OS=Streptococcus equi subsp. equi (strain 4047) GN=adk PE=3 SV=1 110 298 8.0E-17
sp|A0B9A2|KAD_METTP Adenylate kinase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=adk PE=3 SV=1 110 297 9.0E-17
sp|Q93FE6|KAD_RHIME Adenylate kinase OS=Rhizobium meliloti (strain 1021) GN=adk PE=3 SV=1 110 297 1.0E-16
sp|B2VHX2|KAD_ERWT9 Adenylate kinase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=adk PE=3 SV=1 110 274 1.0E-16
sp|Q3IKQ1|KAD_PSEHT Adenylate kinase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=adk PE=3 SV=1 110 302 1.0E-16
sp|Q6CK57|KAD2_KLULA Adenylate kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADK1 PE=3 SV=1 110 297 1.0E-16
sp|B4PAR6|KAD2_DROYA Adenylate kinase OS=Drosophila yakuba GN=Adk2 PE=3 SV=1 98 294 1.0E-16
sp|A6Q322|KAD_NITSB Adenylate kinase OS=Nitratiruptor sp. (strain SB155-2) GN=adk PE=3 SV=1 109 294 1.0E-16
sp|C0ME26|KAD_STRS7 Adenylate kinase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=adk PE=3 SV=1 110 298 1.0E-16
sp|Q74ZL1|KAD2_ASHGO Adenylate kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ADK1 PE=3 SV=1 110 297 1.0E-16
sp|B9MKG1|KAD_CALBD Adenylate kinase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=adk PE=3 SV=1 110 302 1.0E-16
sp|Q74L69|KAD_LACJO Adenylate kinase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=adk PE=3 SV=1 110 297 1.0E-16
sp|B4MQT3|KAD2_DROWI Adenylate kinase OS=Drosophila willistoni GN=Adk2 PE=3 SV=1 98 294 1.0E-16
sp|Q3K3U8|KAD_STRA1 Adenylate kinase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=adk PE=3 SV=1 110 297 1.0E-16
sp|Q12ZS7|KAD_METBU Adenylate kinase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=adk PE=3 SV=1 108 297 1.0E-16
sp|Q5R421|KAD4_PONAB Adenylate kinase 4, mitochondrial OS=Pongo abelii GN=AK4 PE=2 SV=1 112 284 1.0E-16
sp|Q5WLP1|KAD_BACSK Adenylate kinase OS=Bacillus clausii (strain KSM-K16) GN=adk PE=3 SV=1 110 294 1.0E-16
sp|Q47B46|KAD_DECAR Adenylate kinase OS=Dechloromonas aromatica (strain RCB) GN=adk PE=3 SV=1 110 271 1.0E-16
sp|B1Z772|KAD_METPB Adenylate kinase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=adk PE=3 SV=1 110 293 1.0E-16
sp|Q83G05|KAD_TROWT Adenylate kinase OS=Tropheryma whipplei (strain Twist) GN=adk PE=3 SV=1 111 294 1.0E-16
sp|Q83I60|KAD_TROW8 Adenylate kinase OS=Tropheryma whipplei (strain TW08/27) GN=adk PE=3 SV=1 111 294 1.0E-16
sp|C1CIB8|KAD_STRZP Adenylate kinase OS=Streptococcus pneumoniae (strain P1031) GN=adk PE=3 SV=1 110 297 2.0E-16
sp|C1CC27|KAD_STRZJ Adenylate kinase OS=Streptococcus pneumoniae (strain JJA) GN=adk PE=3 SV=1 110 297 2.0E-16
sp|Q8DRD4|KAD_STRR6 Adenylate kinase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=adk PE=3 SV=1 110 297 2.0E-16
sp|B8ZKQ1|KAD_STRPJ Adenylate kinase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=adk PE=3 SV=1 110 297 2.0E-16
sp|B1I8L9|KAD_STRPI Adenylate kinase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=adk PE=3 SV=1 110 297 2.0E-16
sp|Q04ML5|KAD_STRP2 Adenylate kinase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=adk PE=1 SV=1 110 297 2.0E-16
sp|A9KJH3|KAD_CLOPH Adenylate kinase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=adk PE=3 SV=1 110 292 2.0E-16
sp|Q6HPN7|KAD_BACHK Adenylate kinase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=adk PE=3 SV=1 110 294 2.0E-16
sp|Q63H69|KAD_BACCZ Adenylate kinase OS=Bacillus cereus (strain ZK / E33L) GN=adk PE=3 SV=1 110 294 2.0E-16
sp|C1ET60|KAD_BACC3 Adenylate kinase OS=Bacillus cereus (strain 03BB102) GN=adk PE=3 SV=1 110 294 2.0E-16
sp|B7JKE1|KAD_BACC0 Adenylate kinase OS=Bacillus cereus (strain AH820) GN=adk PE=3 SV=1 110 294 2.0E-16
sp|Q81VQ9|KAD_BACAN Adenylate kinase OS=Bacillus anthracis GN=adk PE=3 SV=1 110 294 2.0E-16
sp|A0R8K1|KAD_BACAH Adenylate kinase OS=Bacillus thuringiensis (strain Al Hakam) GN=adk PE=3 SV=1 110 294 2.0E-16
sp|C3LJA3|KAD_BACAC Adenylate kinase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=adk PE=3 SV=1 110 294 2.0E-16
sp|C3P9S6|KAD_BACAA Adenylate kinase OS=Bacillus anthracis (strain A0248) GN=adk PE=3 SV=1 110 294 2.0E-16
sp|B2IS63|KAD_STRPS Adenylate kinase OS=Streptococcus pneumoniae (strain CGSP14) GN=adk PE=3 SV=1 110 297 2.0E-16
sp|Q97SU1|KAD_STRPN Adenylate kinase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=adk PE=1 SV=1 110 297 2.0E-16
sp|B5E6H6|KAD_STRP4 Adenylate kinase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=adk PE=3 SV=1 110 297 2.0E-16
sp|B7IT40|KAD_BACC2 Adenylate kinase OS=Bacillus cereus (strain G9842) GN=adk PE=3 SV=1 110 294 2.0E-16
sp|A1USR5|KAD_BARBK Adenylate kinase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=adk PE=3 SV=1 110 288 2.0E-16
sp|B2KEK1|KAD_ELUMP Adenylate kinase OS=Elusimicrobium minutum (strain Pei191) GN=adk PE=3 SV=1 109 295 2.0E-16
sp|P27144|KAD4_HUMAN Adenylate kinase 4, mitochondrial OS=Homo sapiens GN=AK4 PE=1 SV=1 112 284 2.0E-16
sp|P57837|KAD_PASMU Adenylate kinase OS=Pasteurella multocida (strain Pm70) GN=adk PE=3 SV=1 110 276 2.0E-16
sp|Q822Z1|KAD_CHLCV Adenylate kinase OS=Chlamydophila caviae (strain GPIC) GN=adk PE=3 SV=1 111 290 2.0E-16
sp|B9JDU9|KAD_AGRRK Adenylate kinase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=adk PE=3 SV=1 110 297 2.0E-16
sp|Q1L8L9|KAD2_DANRE Adenylate kinase 2, mitochondrial OS=Danio rerio GN=ak2 PE=2 SV=1 111 292 2.0E-16
sp|B4LP08|KAD2_DROVI Adenylate kinase OS=Drosophila virilis GN=Adk2 PE=3 SV=1 98 294 2.0E-16
sp|Q04PV9|KAD_LEPBJ Adenylate kinase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=adk PE=3 SV=1 110 297 2.0E-16
sp|Q9XD15|KAD_LEPIN Adenylate kinase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=adk PE=3 SV=2 110 297 2.0E-16
sp|Q72NI2|KAD_LEPIC Adenylate kinase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=adk PE=3 SV=1 110 297 2.0E-16
sp|Q9U915|KAD2_DROME Adenylate kinase OS=Drosophila melanogaster GN=Adk2 PE=1 SV=1 98 294 2.0E-16
sp|Q2S1E4|KAD_SALRD Adenylate kinase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=adk PE=3 SV=1 110 299 2.0E-16
sp|C1CPA9|KAD_STRZT Adenylate kinase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=adk PE=3 SV=1 110 297 2.0E-16
sp|Q5XEB4|KAD_STRP6 Adenylate kinase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=adk PE=1 SV=1 110 297 3.0E-16
sp|A8IAP0|KAD_AZOC5 Adenylate kinase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=adk PE=3 SV=1 110 289 3.0E-16
sp|Q046A5|KAD_LACGA Adenylate kinase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=adk PE=3 SV=1 110 297 3.0E-16
sp|Q8UE38|KAD_AGRFC Adenylate kinase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=adk PE=3 SV=1 110 297 3.0E-16
sp|B1W3Y6|KAD_STRGG Adenylate kinase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=adk PE=3 SV=1 110 300 3.0E-16
sp|A7GK41|KAD_BACCN Adenylate kinase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=adk PE=3 SV=1 110 294 3.0E-16
sp|Q6MSP5|KAD_MYCMS Adenylate kinase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=adk PE=3 SV=1 110 298 3.0E-16
sp|B0X5E3|KAD2_CULQU Adenylate kinase OS=Culex quinquefasciatus GN=Adk2 PE=3 SV=1 90 302 3.0E-16
sp|Q98N36|KAD_RHILO Adenylate kinase OS=Rhizobium loti (strain MAFF303099) GN=adk PE=3 SV=1 110 299 3.0E-16
sp|B3QS41|KAD_CHLT3 Adenylate kinase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=adk PE=3 SV=1 110 299 3.0E-16
sp|A1STI3|KAD_PSYIN Adenylate kinase OS=Psychromonas ingrahamii (strain 37) GN=adk PE=3 SV=1 110 292 3.0E-16
sp|Q5RDZ0|KAD3_PONAB GTP:AMP phosphotransferase AK3, mitochondrial OS=Pongo abelii GN=AK3 PE=2 SV=3 112 275 3.0E-16
sp|A2RC35|KAD_STRPG Adenylate kinase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=adk PE=3 SV=1 110 297 3.0E-16
sp|P29410|KAD2_RAT Adenylate kinase 2, mitochondrial OS=Rattus norvegicus GN=Ak2 PE=2 SV=2 112 292 4.0E-16
sp|Q0VCP1|KAD4_BOVIN Adenylate kinase 4, mitochondrial OS=Bos taurus GN=AK4 PE=2 SV=1 112 284 4.0E-16
sp|C1CAN3|KAD_STRP7 Adenylate kinase OS=Streptococcus pneumoniae (strain 70585) GN=adk PE=3 SV=1 110 297 4.0E-16
sp|Q9UIJ7|KAD3_HUMAN GTP:AMP phosphotransferase AK3, mitochondrial OS=Homo sapiens GN=AK3 PE=1 SV=4 112 275 4.0E-16
sp|C3KVN0|KAD_CLOB6 Adenylate kinase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=adk PE=3 SV=1 110 297 4.0E-16
sp|P08166|KAD2_BOVIN Adenylate kinase 2, mitochondrial OS=Bos taurus GN=AK2 PE=1 SV=2 93 292 4.0E-16
sp|B3NQ53|KAD2_DROER Adenylate kinase OS=Drosophila erecta GN=Adk2 PE=3 SV=1 98 291 4.0E-16
sp|B1JHN1|KAD_YERPY Adenylate kinase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=adk PE=3 SV=1 110 283 4.0E-16
sp|Q66DP7|KAD_YERPS Adenylate kinase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=adk PE=3 SV=1 110 283 4.0E-16
sp|A4TPA4|KAD_YERPP Adenylate kinase OS=Yersinia pestis (strain Pestoides F) GN=adk PE=3 SV=1 110 283 4.0E-16
sp|Q1CL27|KAD_YERPN Adenylate kinase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=adk PE=3 SV=1 110 283 4.0E-16
sp|A9R0Q7|KAD_YERPG Adenylate kinase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=adk PE=3 SV=1 110 283 4.0E-16
sp|O69172|KAD_YERPE Adenylate kinase OS=Yersinia pestis GN=adk PE=3 SV=1 110 283 4.0E-16
sp|B2K6Z6|KAD_YERPB Adenylate kinase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=adk PE=3 SV=1 110 283 4.0E-16
sp|Q1C4P9|KAD_YERPA Adenylate kinase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=adk PE=3 SV=1 110 283 4.0E-16
sp|A7FL86|KAD_YERP3 Adenylate kinase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=adk PE=3 SV=1 110 283 4.0E-16
sp|C5BD16|KAD_EDWI9 Adenylate kinase OS=Edwardsiella ictaluri (strain 93-146) GN=adk PE=3 SV=1 110 297 4.0E-16
sp|B0TC77|KAD_HELMI Adenylate kinase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=adk PE=3 SV=1 110 302 4.0E-16
sp|Q3Z960|KAD_DEHM1 Adenylate kinase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=adk PE=3 SV=1 108 281 5.0E-16
sp|Q250L1|KAD_DESHY Adenylate kinase OS=Desulfitobacterium hafniense (strain Y51) GN=adk PE=3 SV=1 111 281 5.0E-16
sp|B8G1Y7|KAD_DESHD Adenylate kinase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=adk PE=3 SV=1 111 281 5.0E-16
sp|Q9PHM8|KAD_CAMJE Adenylate kinase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=adk PE=3 SV=1 109 298 6.0E-16
sp|A7H4H3|KAD_CAMJD Adenylate kinase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=adk PE=3 SV=1 109 298 6.0E-16
sp|Q7NKT5|KAD_GLOVI Adenylate kinase OS=Gloeobacter violaceus (strain PCC 7421) GN=adk PE=3 SV=1 110 302 6.0E-16
sp|A1VYZ9|KAD_CAMJJ Adenylate kinase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=adk PE=3 SV=1 109 298 6.0E-16
sp|A8FL60|KAD_CAMJ8 Adenylate kinase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=adk PE=3 SV=1 109 298 6.0E-16
sp|Q2NIX5|KAD_AYWBP Adenylate kinase OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=adk PE=3 SV=1 109 289 7.0E-16
sp|Q9WTP6|KAD2_MOUSE Adenylate kinase 2, mitochondrial OS=Mus musculus GN=Ak2 PE=1 SV=5 112 292 7.0E-16
sp|B9IZL5|KAD_BACCQ Adenylate kinase OS=Bacillus cereus (strain Q1) GN=adk PE=3 SV=1 110 294 7.0E-16
sp|B7HQW5|KAD_BACC7 Adenylate kinase OS=Bacillus cereus (strain AH187) GN=adk PE=3 SV=1 110 294 7.0E-16
sp|Q73F75|KAD_BACC1 Adenylate kinase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=adk PE=3 SV=1 110 294 7.0E-16
sp|Q6D7Z5|KAD_PECAS Adenylate kinase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=adk PE=3 SV=1 110 297 7.0E-16
sp|A9H3J9|KAD_GLUDA Adenylate kinase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=adk PE=3 SV=1 107 293 8.0E-16
sp|Q8RE31|KAD_FUSNN Adenylate kinase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=adk PE=3 SV=1 110 283 8.0E-16
sp|P08760|KAD3_BOVIN GTP:AMP phosphotransferase AK3, mitochondrial OS=Bos taurus GN=AK3 PE=1 SV=3 112 275 8.0E-16
sp|C6DB87|KAD_PECCP Adenylate kinase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=adk PE=3 SV=1 110 297 8.0E-16
sp|P10251|KAD_MYCCT Adenylate kinase OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=adk PE=3 SV=2 110 298 8.0E-16
sp|B4J672|KAD2_DROGR Adenylate kinase OS=Drosophila grimshawi GN=Adk2 PE=3 SV=1 111 294 9.0E-16
sp|Q4WJ21|KAD2_ASPFU Adenylate kinase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=adk1 PE=3 SV=1 110 292 9.0E-16
sp|B0XPW9|KAD2_ASPFC Adenylate kinase OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=adk1 PE=3 SV=1 110 292 9.0E-16
sp|B0UT69|KAD_HISS2 Adenylate kinase OS=Histophilus somni (strain 2336) GN=adk PE=3 SV=1 110 297 9.0E-16
sp|Q0I2Y5|KAD_HAES1 Adenylate kinase OS=Haemophilus somnus (strain 129Pt) GN=adk PE=3 SV=1 110 297 9.0E-16
sp|Q5M2D4|KAD_STRT2 Adenylate kinase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=adk PE=3 SV=1 110 299 9.0E-16
sp|Q5LXT2|KAD_STRT1 Adenylate kinase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=adk PE=3 SV=1 110 299 9.0E-16
sp|B3MCQ5|KAD2_DROAN Adenylate kinase OS=Drosophila ananassae GN=Adk2 PE=3 SV=1 98 294 9.0E-16
sp|A9VP98|KAD_BACWK Adenylate kinase OS=Bacillus weihenstephanensis (strain KBAB4) GN=adk PE=3 SV=1 110 294 9.0E-16
sp|Q5L3R8|KAD_GEOKA Adenylate kinase OS=Geobacillus kaustophilus (strain HTA426) GN=adk PE=3 SV=1 110 293 9.0E-16
sp|A1D3M8|KAD2_NEOFI Adenylate kinase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=adk1 PE=3 SV=1 110 292 9.0E-16
sp|Q8Z0M3|KAD2_NOSS1 Adenylate kinase 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=adk2 PE=3 SV=1 110 300 1.0E-15
sp|Q2K9J5|KAD_RHIEC Adenylate kinase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=adk PE=3 SV=1 110 297 1.0E-15
sp|B4KLY1|KAD2_DROMO Adenylate kinase OS=Drosophila mojavensis GN=Adk2 PE=3 SV=1 98 294 1.0E-15
sp|A7GJ53|KAD_CLOBL Adenylate kinase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=adk PE=3 SV=1 110 297 1.0E-15
sp|Q81J22|KAD_BACCR Adenylate kinase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=adk PE=3 SV=1 110 294 1.0E-15
sp|B7HJ69|KAD_BACC4 Adenylate kinase OS=Bacillus cereus (strain B4264) GN=adk PE=3 SV=1 110 294 1.0E-15
sp|A8AZK4|KAD_STRGC Adenylate kinase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=adk PE=3 SV=1 110 298 1.0E-15
sp|A1CQR5|KAD2_ASPCL Adenylate kinase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=adk1 PE=3 SV=1 110 292 1.0E-15
sp|Q7MMR5|KAD_VIBVY Adenylate kinase OS=Vibrio vulnificus (strain YJ016) GN=adk PE=3 SV=1 110 297 1.0E-15
sp|A2QPN9|KAD2_ASPNC Adenylate kinase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=adk1 PE=3 SV=1 110 290 1.0E-15
sp|Q8DFM1|KAD_VIBVU Adenylate kinase OS=Vibrio vulnificus (strain CMCP6) GN=adk PE=3 SV=1 110 297 1.0E-15
sp|Q5FM70|KAD_LACAC Adenylate kinase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=adk PE=3 SV=1 110 294 1.0E-15
sp|B1KSK4|KAD_CLOBM Adenylate kinase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=adk PE=3 SV=1 110 297 1.0E-15
sp|A8YXM6|KAD_LACH4 Adenylate kinase OS=Lactobacillus helveticus (strain DPC 4571) GN=adk PE=3 SV=1 110 294 1.0E-15
sp|A5FRW5|KAD_DEHMB Adenylate kinase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=adk PE=3 SV=1 108 281 2.0E-15
sp|B1I3R5|KAD_DESAP Adenylate kinase OS=Desulforudis audaxviator (strain MP104C) GN=adk PE=3 SV=1 110 302 2.0E-15
sp|A6RHI1|KAD2_AJECN Adenylate kinase OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=ADK1 PE=3 SV=1 103 292 2.0E-15
sp|Q38UT2|KAD_LACSS Adenylate kinase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=adk PE=3 SV=1 110 297 2.0E-15
sp|Q8G092|KAD_BRUSU Adenylate kinase OS=Brucella suis biovar 1 (strain 1330) GN=adk PE=3 SV=1 110 297 2.0E-15
sp|A5VQY5|KAD_BRUO2 Adenylate kinase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=adk PE=3 SV=1 110 297 2.0E-15
sp|A9M5M9|KAD_BRUC2 Adenylate kinase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=adk PE=3 SV=1 110 297 2.0E-15
sp|B4RU55|KAD_ALTMD Adenylate kinase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=adk PE=3 SV=1 110 297 2.0E-15
sp|Q1GBJ7|KAD_LACDA Adenylate kinase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=adk PE=3 SV=1 110 294 2.0E-15
sp|Q03IH2|KAD_STRTD Adenylate kinase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=adk PE=3 SV=1 110 299 2.0E-15
sp|B0CH11|KAD_BRUSI Adenylate kinase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=adk PE=3 SV=1 110 297 2.0E-15
sp|Q2UBH0|KAD2_ASPOR Adenylate kinase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=adk1 PE=3 SV=2 102 292 2.0E-15
sp|Q04BZ4|KAD_LACDB Adenylate kinase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=adk PE=3 SV=1 110 294 2.0E-15
sp|P84139|KAD_SPOGL Adenylate kinase OS=Sporosarcina globispora GN=adk PE=1 SV=1 110 300 2.0E-15
sp|C0RJI0|KAD_BRUMB Adenylate kinase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=adk PE=3 SV=1 110 297 2.0E-15
sp|Q57CS9|KAD_BRUAB Adenylate kinase OS=Brucella abortus biovar 1 (strain 9-941) GN=adk PE=3 SV=1 110 297 2.0E-15
sp|Q2YRT7|KAD_BRUA2 Adenylate kinase OS=Brucella abortus (strain 2308) GN=adk PE=3 SV=1 110 297 2.0E-15
sp|B2S658|KAD_BRUA1 Adenylate kinase OS=Brucella abortus (strain S19) GN=adk PE=3 SV=1 110 297 2.0E-15
sp|B6IRS7|KAD_RHOCS Adenylate kinase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=adk PE=3 SV=1 110 281 2.0E-15
sp|Q5HVD2|KAD_CAMJR Adenylate kinase OS=Campylobacter jejuni (strain RM1221) GN=adk PE=3 SV=1 109 274 2.0E-15
sp|Q1HQK0|KAD2_AEDAE Adenylate kinase OS=Aedes aegypti GN=Adk2 PE=2 SV=1 91 294 2.0E-15
sp|A8PR17|KAD2_MALGO Adenylate kinase OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=ADK1 PE=3 SV=1 110 290 2.0E-15
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 52 74 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|11100
MAAPLRLLRALPRQPGLGFRSRTLGASAGPLRGLASSAGAGGRNGRSGRGGGGIKFWPFLAIVALGSAGYVALVH
RRKEMAAPATEAATPALAAPPKPTPTFSPDDVTVLFVLGGPGAGKGTQCARLVDRHGFTHLSAGDLLRAEQERPG
SQFGDLIRDHIKNGLIVPMEVTVQLLENAMTDALAGQPDGDKSRGRFLIDGFPRKMDQAARFEQAVCPARLVLFF
DCPEDVMRARLLERGKTSGRADDNADSILKRFHTFVETSMPVVDHYDRQGRVLKVDATDPPDVVFANTEKQLRAT
LGPAF*
Coding >Hirsu2|11100
ATGGCCGCCCCCTTGCGCCTGCTGCGCGCGCTCCCGCGGCAGCCGGGGCTGGGCTTCCGTTCGCGGACGCTGGGC
GCGTCGGCCGGCCCGCTTCGGGGGCTGGCCTCGTCGGCCGGCGCCGGCGGCAGGAATGGTCGCAGCGGCCGAGGC
GGCGGCGGCATCAAGTTTTGGCCCTTCTTGGCCATTGTTGCGCTAGGCTCGGCCGGCTACGTCGCCCTCGTCCAC
CGCCGCAAGGAAATGGCCGCCCCCGCCACCGAAGCGGCGACGCCGGCGCTCGCGGCCCCGCCCAAGCCGACGCCG
ACCTTCTCGCCCGACGACGTCACCGTCCTCTTCGTCCTGGGCGGGCCCGGCGCCGGCAAGGGAACGCAGTGCGCC
CGCCTCGTCGACCGCCACGGCTTCACCCACCTGTCGGCCGGCGACCTGCTGCGGGCCGAGCAGGAGCGGCCGGGC
TCGCAGTTCGGCGACCTGATCCGCGACCACATCAAGAACGGGCTGATCGTGCCGATGGAGGTGACGGTCCAGCTG
CTGGAGAACGCCATGACGGACGCCCTGGCCGGCCAGCCCGACGGCGACAAGAGCCGCGGCCGCTTCCTCATCGAC
GGCTTCCCCCGCAAGATGGACCAGGCCGCCCGCTTCGAGCAGGCCGTCTGCCCCGCCCGCCTCGTCCTCTTCTTC
GACTGCCCCGAGGACGTGATGCGCGCCCGCCTGCTGGAGCGCGGCAAGACGAGCGGCCGCGCCGACGACAACGCC
GACAGCATCCTCAAGCGCTTCCACACCTTTGTCGAGACCAGCATGCCCGTCGTCGACCACTACGACCGCCAGGGC
CGCGTCCTCAAGGTCGACGCCACCGACCCGCCCGACGTCGTCTTCGCCAACACCGAGAAGCAGCTCCGCGCCACC
CTCGGGCCCGCCTTCTGA
Transcript >Hirsu2|11100
ATGGCCGCCCCCTTGCGCCTGCTGCGCGCGCTCCCGCGGCAGCCGGGGCTGGGCTTCCGTTCGCGGACGCTGGGC
GCGTCGGCCGGCCCGCTTCGGGGGCTGGCCTCGTCGGCCGGCGCCGGCGGCAGGAATGGTCGCAGCGGCCGAGGC
GGCGGCGGCATCAAGTTTTGGCCCTTCTTGGCCATTGTTGCGCTAGGCTCGGCCGGCTACGTCGCCCTCGTCCAC
CGCCGCAAGGAAATGGCCGCCCCCGCCACCGAAGCGGCGACGCCGGCGCTCGCGGCCCCGCCCAAGCCGACGCCG
ACCTTCTCGCCCGACGACGTCACCGTCCTCTTCGTCCTGGGCGGGCCCGGCGCCGGCAAGGGAACGCAGTGCGCC
CGCCTCGTCGACCGCCACGGCTTCACCCACCTGTCGGCCGGCGACCTGCTGCGGGCCGAGCAGGAGCGGCCGGGC
TCGCAGTTCGGCGACCTGATCCGCGACCACATCAAGAACGGGCTGATCGTGCCGATGGAGGTGACGGTCCAGCTG
CTGGAGAACGCCATGACGGACGCCCTGGCCGGCCAGCCCGACGGCGACAAGAGCCGCGGCCGCTTCCTCATCGAC
GGCTTCCCCCGCAAGATGGACCAGGCCGCCCGCTTCGAGCAGGCCGTCTGCCCCGCCCGCCTCGTCCTCTTCTTC
GACTGCCCCGAGGACGTGATGCGCGCCCGCCTGCTGGAGCGCGGCAAGACGAGCGGCCGCGCCGACGACAACGCC
GACAGCATCCTCAAGCGCTTCCACACCTTTGTCGAGACCAGCATGCCCGTCGTCGACCACTACGACCGCCAGGGC
CGCGTCCTCAAGGTCGACGCCACCGACCCGCCCGACGTCGTCTTCGCCAACACCGAGAAGCAGCTCCGCGCCACC
CTCGGGCCCGCCTTCTGA
Gene >Hirsu2|11100
ATGGCCGCCCCCTTGCGCCTGCTGCGCGCGCTCCCGCGGCAGCCGGGGCTGGGCTTCCGTTCGCGGACGCTGGGC
GCGTCGGCCGGCCCGCTTCGGGGGCTGGCCTCGTCGGCCGGCGCCGGCGGCAGGAATGGTCGCAGCGGCCGAGGC
GGCGGCGGCATCAAGTTTTGGCCCTTCTTGGCCATTGTTGCGCTAGGCTCGGCCGGCTACGTCGCCCTCGTCCAC
CGCCGCAAGGGTACGTCCTTGTACTCTCTCCATCTTCGGCATCATCATCATCACCACCTGGCACCACCCCATCTC
TCCTCTCTCCCTCTCTTTCTCCCTCTCTCTCTCTCACACACACATATACACACACACACTCTCTCTCTCTCTCTT
CCTCTCTCTGTGTCCCATCCAACTCAAACCGCCTCCTAGAAATGGCCGCCCCCGCCACCGAAGCGGCGACGCCGG
CGCTCGCGGCCCCGCCCAAGCCGACGCCGACCTTCTCGCCCGACGACGTCACCGTCCTCTTCGTCCTGGGCGGGC
CCGGCGCCGGCAAGGGAACGCAGTGCGCCCGCCTCGTCGACCGCCACGGCTTCACCCACCTGTCGGCCGGCGACC
TGCTGCGGGCCGAGCAGGAGCGGCCGGGCTCGCAGTTCGGCGACCTGATCCGCGACCACATCAAGAACGGGCTGA
TCGTGCCGATGGAGGTGACGGTCCAGCTGCTGGAGAACGCCATGACGGACGCCCTGGCCGGCCAGCCCGACGGCG
ACAAGAGCCGCGGCCGCTTCCTCATCGACGGCTTCCCCCGCAAGATGGACCAGGCCGCCCGCTTCGAGCAGGCCG
TCTGCCCCGCCCGCCTCGTCCTCTTCTTCGACTGCCCCGAGGACGTGATGCGCGCCCGCCTGCTGGAGCGCGGCA
AGACGAGCGGCCGCGCCGACGACAACGCCGACAGCATCCTCAAGCGCTTCCACACCTTTGTCGAGACCAGCATGC
CCGTCGTCGACCACTACGACCGCCAGGGCCGCGTCCTCAAGGTCGACGCCACCGACCCGCCCGACGTCGTCTTCG
CCAACACCGAGAAGCAGCTCCGCGCCACCCTCGGGCCCGCCTTCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail